Query         psy5023
Match_columns 82
No_of_seqs    125 out of 882
Neff          6.5 
Searched_HMMs 46136
Date          Fri Aug 16 23:52:07 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5023.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5023hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0566|consensus              100.0 2.1E-32 4.6E-37  219.0   7.5   77    1-81    711-787 (1080)
  2 smart00128 IPPc Inositol polyp 100.0 7.7E-32 1.7E-36  196.2   7.0   78    2-82    179-257 (310)
  3 PLN03191 Type I inositol-1,4,5 100.0 4.7E-31   1E-35  205.2   7.9   76    1-80    466-541 (621)
  4 COG5411 Phosphatidylinositol 5  99.9 1.4E-25   3E-30  169.5   4.7   78    1-82    203-282 (460)
  5 PTZ00312 inositol-1,4,5-tripho  99.7 4.1E-17 8.9E-22  119.6   4.0   70    2-73    126-220 (356)
  6 KOG0565|consensus               98.6 2.1E-08 4.5E-13   65.7   1.5   38    4-44    108-145 (145)
  7 KOG1976|consensus               97.5 7.1E-05 1.5E-09   55.9   3.1   22   55-76    305-327 (391)
  8 KOG3870|consensus               89.0    0.15 3.3E-06   39.4   0.6   17    1-17    349-365 (434)
  9 PF03372 Exo_endo_phos:  Endonu  83.5    0.64 1.4E-05   30.3   1.2   14    6-19    158-171 (249)
 10 COG3568 ElsH Metal-dependent h  72.6     1.9 4.2E-05   31.4   1.1   15    6-20    166-187 (259)
 11 PRK11756 exonuclease III; Prov  68.0     2.6 5.6E-05   29.5   0.9   15    4-18    143-157 (268)
 12 PF14529 Exo_endo_phos_2:  Endo  66.9     2.4 5.2E-05   25.4   0.5   13    6-18     32-44  (119)
 13 TIGR00195 exoDNase_III exodeox  64.5     3.3 7.2E-05   28.7   0.9   14    5-18    139-152 (254)
 14 PF01937 DUF89:  Protein of unk  62.4     1.4   3E-05   32.8  -1.4   17    2-18    294-310 (355)
 15 PRK13911 exodeoxyribonuclease   60.9     4.6  0.0001   28.7   1.1   14    5-18    137-150 (250)
 16 PF10515 APP_amyloid:  beta-amy  60.7     2.2 4.8E-05   24.0  -0.4    7   67-73     45-51  (52)
 17 cd08164 MPP_Ted1 Saccharomyces  55.3     7.1 0.00015   27.2   1.3   10    4-13     45-54  (193)
 18 cd08166 MPP_Cdc1_like_1 unchar  54.3      21 0.00046   24.8   3.5   16    3-21     42-57  (195)
 19 TIGR03395 sphingomy sphingomye  54.0     8.9 0.00019   27.7   1.7   14    5-18    178-191 (283)
 20 smart00476 DNaseIc deoxyribonu  53.4     7.3 0.00016   28.4   1.1   14    5-18    177-190 (276)
 21 TIGR00633 xth exodeoxyribonucl  53.4     6.7 0.00015   26.7   0.9   15    4-18    141-155 (255)
 22 KOG3873|consensus               52.8      11 0.00023   29.3   1.9   17    2-18    168-184 (422)
 23 PRK05421 hypothetical protein;  52.2     7.8 0.00017   27.4   1.1   10    6-15    184-193 (263)
 24 KOG3662|consensus               51.2      21 0.00045   27.8   3.3   37    3-44     93-129 (410)
 25 PRK11439 pphA serine/threonine  49.5      20 0.00044   24.6   2.8   28    3-35     44-71  (218)
 26 PF00149 Metallophos:  Calcineu  48.7      15 0.00033   21.6   1.9   16    3-18     31-46  (200)
 27 KOG2756|consensus               37.3      18 0.00038   27.3   1.0   15    5-19    244-258 (349)
 28 cd00838 MPP_superfamily metall  36.0      30 0.00065   20.1   1.8   16    3-18     26-41  (131)
 29 PRK15251 cytolethal distending  35.4      21 0.00045   26.2   1.2    9    6-14    186-194 (271)
 30 PRK09968 serine/threonine-spec  34.9      41  0.0009   23.2   2.6   27    3-34     42-68  (218)
 31 COG0708 XthA Exonuclease III [  34.6      21 0.00046   26.0   1.1   13    5-17    141-153 (261)
 32 cd00842 MPP_ASMase acid sphing  34.6      27 0.00058   24.7   1.6   14    3-16     68-81  (296)
 33 cd07379 MPP_239FB Homo sapiens  33.4      32 0.00069   21.4   1.7   14    2-15     18-31  (135)
 34 cd07390 MPP_AQ1575 Aquifex aeo  33.1      34 0.00073   22.4   1.8   16    2-17     41-56  (168)
 35 PLN03144 Carbon catabolite rep  30.5      27 0.00058   28.4   1.2   23    6-35    457-479 (606)
 36 cd07423 MPP_PrpE Bacillus subt  29.9      89  0.0019   21.5   3.6   24    4-32     38-61  (234)
 37 PF09222 Fim-adh_lectin:  Fimbr  29.5      33 0.00071   23.5   1.3   13    4-16     79-91  (171)
 38 cd07400 MPP_YydB Bacillus subt  29.2      38 0.00083   21.0   1.5   13    3-15     35-47  (144)
 39 cd07404 MPP_MS158 Microscilla   29.1      39 0.00085   21.6   1.6   15    2-16     25-39  (166)
 40 cd07384 MPP_Cdc1_like Saccharo  28.0      40 0.00088   22.3   1.5   11    3-13     45-55  (171)
 41 KOG2338|consensus               28.0      30 0.00066   27.6   1.0   13    6-18    294-306 (495)
 42 COG3021 Uncharacterized protei  28.0      31 0.00067   25.9   1.0    9    7-15    225-233 (309)
 43 COG4531 ZnuA ABC-type Zn2+ tra  27.2      35 0.00077   25.6   1.2   11    1-11     73-83  (318)
 44 cd07393 MPP_DR1119 Deinococcus  25.6      50  0.0011   22.7   1.7   15    2-16     40-54  (232)
 45 cd07395 MPP_CSTP1 Homo sapiens  25.0      52  0.0011   22.8   1.7   11    3-13     49-59  (262)
 46 cd00841 MPP_YfcE Escherichia c  24.7      49  0.0011   20.8   1.4   16    3-18     24-39  (155)
 47 cd07952 ED_3B_like Uncharacter  24.3 1.2E+02  0.0026   21.4   3.5   42    6-47    163-212 (256)
 48 PF12850 Metallophos_2:  Calcin  22.8      65  0.0014   19.8   1.7   12    2-13     24-35  (156)
 49 cd07413 MPP_PA3087 Pseudomonas  22.0 1.5E+02  0.0032   20.4   3.5   25    3-32     33-57  (222)
 50 cd07392 MPP_PAE1087 Pyrobaculu  21.8      61  0.0013   20.6   1.5   14    3-16     23-36  (188)
 51 cd07402 MPP_GpdQ Enterobacter   21.1      61  0.0013   21.8   1.4   11    3-13     40-50  (240)
 52 cd08165 MPP_MPPE1 human MPPE1   20.5      66  0.0014   20.9   1.4   11    3-13     38-48  (156)
 53 cd07422 MPP_ApaH Escherichia c  20.5 1.7E+02  0.0036   21.0   3.6   26    3-33     26-51  (257)
 54 cd08163 MPP_Cdc1 Saccharomyces  20.2      62  0.0013   23.0   1.3   14    3-19     45-58  (257)
 55 PF09111 SLIDE:  SLIDE;  InterP  20.1 1.8E+02  0.0038   18.6   3.3   50   27-76      3-53  (118)

No 1  
>KOG0566|consensus
Probab=99.97  E-value=2.1e-32  Score=218.98  Aligned_cols=77  Identities=36%  Similarity=0.782  Sum_probs=75.4

Q ss_pred             CCCccEEEEeCcCCCccCCCCCCCHHHHHHHHhccChHHHHHhHHHHHHHhhCcccCCcccCCCCCCCCCCCcCCCCCcc
Q psy5023           1 MDKLSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQFNDLLEQDQLRAVMQSGEAFSEFNETTPTFQPTFKYQFNSHNYD   80 (82)
Q Consensus         1 ~~~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~~f~E~~I~F~PTYK~~~~s~~Yd   80 (82)
                      |.+||+|||||||||||+    ++.++|+..|.+++|+.|+++|||+++|.+|.+|.||.|++|+|+||||||.||+.||
T Consensus       711 I~~HD~ifW~GDFNYRI~----l~nEEVr~~v~~~d~~kL~e~DQL~~q~~~G~vF~gF~E~~ltF~PTYKyD~gTd~YD  786 (1080)
T KOG0566|consen  711 IFSHDYIFWLGDFNYRID----LSNEEVRRLVRNQDLDKLLEYDQLTQQMNAGQVFPGFHEGQLTFPPTYKYDPGTDDYD  786 (1080)
T ss_pred             ccCCceEEEecccceeec----CCHHHHHHHHHhccHHHHhhHHHHHHHHhcCcccccccccccccCCcccccCCCCccc
Confidence            578999999999999999    6999999999999999999999999999999999999999999999999999999999


Q ss_pred             C
Q psy5023          81 N   81 (82)
Q Consensus        81 t   81 (82)
                      |
T Consensus       787 T  787 (1080)
T KOG0566|consen  787 T  787 (1080)
T ss_pred             c
Confidence            8


No 2  
>smart00128 IPPc Inositol polyphosphate phosphatase, catalytic domain homologues. Mg(2+)-dependent/Li(+)-sensitive enzymes.
Probab=99.97  E-value=7.7e-32  Score=196.21  Aligned_cols=78  Identities=40%  Similarity=0.797  Sum_probs=72.8

Q ss_pred             CCccEEEEeCcCCCccCCCCCCCHHHHHHHHhccChHHHHHhHHHHHHHhhCcccCCcccCCCCCCCCCCCc-CCCCCcc
Q psy5023           2 DKLSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQFNDLLEQDQLRAVMQSGEAFSEFNETTPTFQPTFKYQ-FNSHNYD   80 (82)
Q Consensus         2 ~~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~~f~E~~I~F~PTYK~~-~~s~~Yd   80 (82)
                      .++|+|||||||||||+..   ..++|+++|+.++|..|+++|||..+++++.+|.||.|++|+|||||||+ .+++.||
T Consensus       179 ~~~d~~f~~GDlNyRi~~~---~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~~f~E~~I~F~PTYK~~~~~t~~Yd  255 (310)
T smart00128      179 FDHDVVFWFGDLNFRLDSP---SYEEVRRKISKKEFDDLLEKDQLNRQKEAGKVFKGFQEGPITFPPTYKYDSVGTETYD  255 (310)
T ss_pred             cccceEEEecCcceeecCC---CHHHHHHHHhhCcHHHHhhhhhHHHHhhcccccCcCccCCcCCCCCeeecCCCCcccc
Confidence            4799999999999999952   23789999999999999999999999999999999999999999999999 9999999


Q ss_pred             CC
Q psy5023          81 NK   82 (82)
Q Consensus        81 tk   82 (82)
                      ++
T Consensus       256 ~~  257 (310)
T smart00128      256 TS  257 (310)
T ss_pred             Cc
Confidence            85


No 3  
>PLN03191 Type I inositol-1,4,5-trisphosphate 5-phosphatase 2; Provisional
Probab=99.97  E-value=4.7e-31  Score=205.18  Aligned_cols=76  Identities=34%  Similarity=0.696  Sum_probs=72.8

Q ss_pred             CCCccEEEEeCcCCCccCCCCCCCHHHHHHHHhccChHHHHHhHHHHHHHhhCcccCCcccCCCCCCCCCCCcCCCCCcc
Q psy5023           1 MDKLSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQFNDLLEQDQLRAVMQSGEAFSEFNETTPTFQPTFKYQFNSHNYD   80 (82)
Q Consensus         1 ~~~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~~f~E~~I~F~PTYK~~~~s~~Yd   80 (82)
                      |.+||+|||+|||||||+    ++.++|+++|..++|..||++|||..+++++.+|.||+|++|+|||||||++||+.||
T Consensus       466 I~dhD~vFWlGDLNYRId----l~~~ev~~lI~~~~~~~LL~~DQL~~e~~~g~vF~GF~Eg~I~FpPTYKYd~gSd~Yd  541 (621)
T PLN03191        466 IPSHDQIFWFGDLNYRLN----MLDTEVRKLVAQKRWDELINSDQLIKELRSGHVFDGWKEGPIKFPPTYKYEINSDRYV  541 (621)
T ss_pred             ccccceEEEecCcccccc----CCHHHHHHHHhhccHHHHHHHhHHHHHHHcCCccCCcccCCccCCCCcccccCCcccc
Confidence            357999999999999999    5788999999999999999999999999999999999999999999999999999997


No 4  
>COG5411 Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms]
Probab=99.92  E-value=1.4e-25  Score=169.50  Aligned_cols=78  Identities=35%  Similarity=0.715  Sum_probs=71.7

Q ss_pred             CCCccEEEEeCcCCCccCCCCCCCHHHHHHHHhccC--hHHHHHhHHHHHHHhhCcccCCcccCCCCCCCCCCCcCCCCC
Q psy5023           1 MDKLSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQ--FNDLLEQDQLRAVMQSGEAFSEFNETTPTFQPTFKYQFNSHN   78 (82)
Q Consensus         1 ~~~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~--~~~Ll~~DQL~~~~~~~~~f~~f~E~~I~F~PTYK~~~~s~~   78 (82)
                      |.+||+|||+|||||||.+    +.++++..+...+  +..|+++|||+.+++.+.+|.+|.|..|+|||||||+.|++.
T Consensus       203 I~~hdti~w~GDlNyRVts----~~e~v~~~~~~~~g~~~~l~~~DqL~~e~~~g~~f~~f~E~~i~FpPTYKfd~gt~~  278 (460)
T COG5411         203 IYDHDTIFWLGDLNYRVTS----TNEEVRPEIASDDGRLDKLFEYDQLLWEMEVGNVFPGFKEPVITFPPTYKFDYGTDE  278 (460)
T ss_pred             ecccceEEEecccCceeec----CchhcchhhhCCcchhhhhhhhhhHhhhhcccccccceecccccCCCceEeecCCcc
Confidence            5689999999999999994    6778888887766  788999999999999999999999999999999999999999


Q ss_pred             ccCC
Q psy5023          79 YDNK   82 (82)
Q Consensus        79 Ydtk   82 (82)
                      ||++
T Consensus       279 ydts  282 (460)
T COG5411         279 YDTS  282 (460)
T ss_pred             cccc
Confidence            9984


No 5  
>PTZ00312 inositol-1,4,5-triphosphate 5-phosphatase; Provisional
Probab=99.67  E-value=4.1e-17  Score=119.58  Aligned_cols=70  Identities=21%  Similarity=0.380  Sum_probs=53.6

Q ss_pred             CCccEEEEeCcCCCccCCCCCCCHHHHHH------HHh------ccChHHHHHhHHHHHHHhh-------------Cccc
Q psy5023           2 DKLSYIFWIGDLNFRLNNPETYTQDIITD------RIR------DGQFNDLLEQDQLRAVMQS-------------GEAF   56 (82)
Q Consensus         2 ~~~d~vfw~GDlNyRi~~~~~l~~~~v~~------~i~------~~~~~~Ll~~DQL~~~~~~-------------~~~f   56 (82)
                      ..++++||+||||||++...  ..+.+..      .++      ...|.+|++.|||.++++.             .+.+
T Consensus       126 ~~~~~lF~fGDfNyRld~~~--~~e~L~ek~Ql~ve~~~g~~~~P~hf~~Lf~~dQl~rE~~~fd~e~q~l~~~va~~s~  203 (356)
T PTZ00312        126 SPSDPLFIFGDFNVRLDGHN--LLEWLKEKMQIDVKIEVKRVRAPDRFWELFTNPQTQGEIRRFDLELQRLMDVVAQQSG  203 (356)
T ss_pred             CCCCcEEEeccceeeecccc--HHHHhcccccccccccccccCChHHHHHHhcChhhhHHHhhhhhhhhhhhhhhhhhcc
Confidence            46899999999999999632  1111111      111      2468999999999999985             6788


Q ss_pred             CCcccCCCCCCCCCCCc
Q psy5023          57 SEFNETTPTFQPTFKYQ   73 (82)
Q Consensus        57 ~~f~E~~I~F~PTYK~~   73 (82)
                      .++.|.+|+||||||-.
T Consensus       204 ~eLaE~pI~FpPTYkrv  220 (356)
T PTZ00312        204 VELAEFAIRFPPTYPRV  220 (356)
T ss_pred             cchhcccccCCCcchhh
Confidence            89999999999999943


No 6  
>KOG0565|consensus
Probab=98.57  E-value=2.1e-08  Score=65.70  Aligned_cols=38  Identities=34%  Similarity=0.617  Sum_probs=30.0

Q ss_pred             ccEEEEeCcCCCccCCCCCCCHHHHHHHHhccChHHHHHhH
Q psy5023           4 LSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQFNDLLEQD   44 (82)
Q Consensus         4 ~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~~~~Ll~~D   44 (82)
                      ||.|||+||||||+.++   +...+...+....+..|++.|
T Consensus       108 ~D~v~w~GDlN~Rl~~~---~~~~~~~~~~~~~~~~l~~~d  145 (145)
T KOG0565|consen  108 HDTVIWLGDLNYRLSGP---SYLEVRTLISVKSRDGLLEKD  145 (145)
T ss_pred             ccEEEEecceeeeecCc---ccccchhhhhhcchhhhhccC
Confidence            79999999999999964   255667777777777777665


No 7  
>KOG1976|consensus
Probab=97.55  E-value=7.1e-05  Score=55.92  Aligned_cols=22  Identities=27%  Similarity=0.532  Sum_probs=17.5

Q ss_pred             ccCC-cccCCCCCCCCCCCcCCC
Q psy5023          55 AFSE-FNETTPTFQPTFKYQFNS   76 (82)
Q Consensus        55 ~f~~-f~E~~I~F~PTYK~~~~s   76 (82)
                      .|+. ..|..|.|||||-|+.+.
T Consensus       305 nf~~kl~E~~i~FpPsypysed~  327 (391)
T KOG1976|consen  305 NFAFKLKEETIFFPPSYPYSEDD  327 (391)
T ss_pred             HHHHHHhheeecCCCCCCCCcCc
Confidence            4443 789999999999998753


No 8  
>KOG3870|consensus
Probab=89.04  E-value=0.15  Score=39.36  Aligned_cols=17  Identities=41%  Similarity=0.772  Sum_probs=14.6

Q ss_pred             CCCccEEEEeCcCCCcc
Q psy5023           1 MDKLSYIFWIGDLNFRL   17 (82)
Q Consensus         1 ~~~~d~vfw~GDlNyRi   17 (82)
                      |..++.||+=||||||=
T Consensus       349 L~~S~LvIFKGDLNYRK  365 (434)
T KOG3870|consen  349 LQKSSLVIFKGDLNYRK  365 (434)
T ss_pred             HhhCcEEEEeccccHHH
Confidence            35689999999999994


No 9  
>PF03372 Exo_endo_phos:  Endonuclease/Exonuclease/phosphatase family Subset of Pfam family Subset of Pfam family;  InterPro: IPR005135  This domain is found in a large number of proteins including magnesium dependent endonucleases and phosphatases involved in intracellular signalling []. Proteins this domain is found in include: AP endonuclease proteins (4.2.99.18 from EC), DNase I proteins (3.1.21.1 from EC), Synaptojanin an inositol-1,4,5-trisphosphate phosphatase (3.1.3.56 from EC) and Sphingomyelinase (3.1.4.12 from EC).; PDB: 2J63_A 2JC4_A 3TEB_B 3MTC_A 3N9V_B 1ZWX_A 2F1N_A 1Y21_A 1NTF_A 2IMQ_X ....
Probab=83.48  E-value=0.64  Score=30.28  Aligned_cols=14  Identities=29%  Similarity=0.494  Sum_probs=10.4

Q ss_pred             EEEEeCcCCCccCC
Q psy5023           6 YIFWIGDLNFRLNN   19 (82)
Q Consensus         6 ~vfw~GDlNyRi~~   19 (82)
                      .++++||||.+...
T Consensus       158 ~~iv~GDfN~~~~~  171 (249)
T PF03372_consen  158 PVIVMGDFNSRPDS  171 (249)
T ss_dssp             EEEEEEE-SS-BSS
T ss_pred             eEEEEeecccCCcc
Confidence            59999999999883


No 10 
>COG3568 ElsH Metal-dependent hydrolase [General function prediction only]
Probab=72.56  E-value=1.9  Score=31.41  Aligned_cols=15  Identities=33%  Similarity=0.614  Sum_probs=12.0

Q ss_pred             EEEEeCcCC-------CccCCC
Q psy5023           6 YIFWIGDLN-------FRLNNP   20 (82)
Q Consensus         6 ~vfw~GDlN-------yRi~~~   20 (82)
                      .+++|||||       ||+-..
T Consensus       166 p~vl~GDFN~~p~s~~yr~~~~  187 (259)
T COG3568         166 PTVLMGDFNNEPGSAEYRLAAR  187 (259)
T ss_pred             ceEEEccCCCCCCCccceeccC
Confidence            689999999       776643


No 11 
>PRK11756 exonuclease III; Provisional
Probab=68.01  E-value=2.6  Score=29.52  Aligned_cols=15  Identities=20%  Similarity=0.361  Sum_probs=11.2

Q ss_pred             ccEEEEeCcCCCccC
Q psy5023           4 LSYIFWIGDLNFRLN   18 (82)
Q Consensus         4 ~d~vfw~GDlNyRi~   18 (82)
                      ..-++++||||--.+
T Consensus       143 ~~pvIl~GDfN~~~~  157 (268)
T PRK11756        143 DNPLLIMGDMNISPT  157 (268)
T ss_pred             CCCEEEEeecccCCC
Confidence            346999999996443


No 12 
>PF14529 Exo_endo_phos_2:  Endonuclease-reverse transcriptase ; PDB: 2EI9_A 1WDU_B.
Probab=66.92  E-value=2.4  Score=25.43  Aligned_cols=13  Identities=31%  Similarity=0.212  Sum_probs=7.0

Q ss_pred             EEEEeCcCCCccC
Q psy5023           6 YIFWIGDLNFRLN   18 (82)
Q Consensus         6 ~vfw~GDlNyRi~   18 (82)
                      .++++||||-...
T Consensus        32 ~~Ii~GDFN~~~~   44 (119)
T PF14529_consen   32 PIIIGGDFNAHHP   44 (119)
T ss_dssp             SEEEEEE-----G
T ss_pred             CEEEEeECCCCch
Confidence            7899999999655


No 13 
>TIGR00195 exoDNase_III exodeoxyribonuclease III. The model brings in reverse transcriptases at scores below 50, model also contains eukaryotic apurinic/apyrimidinic endonucleases which group in the same family
Probab=64.48  E-value=3.3  Score=28.67  Aligned_cols=14  Identities=21%  Similarity=0.375  Sum_probs=11.2

Q ss_pred             cEEEEeCcCCCccC
Q psy5023           5 SYIFWIGDLNFRLN   18 (82)
Q Consensus         5 d~vfw~GDlNyRi~   18 (82)
                      .-|+++||||-...
T Consensus       139 ~pvIi~GDfN~~~~  152 (254)
T TIGR00195       139 KPVLICGDMNIAPT  152 (254)
T ss_pred             CcEEEEeecccCCC
Confidence            46999999996554


No 14 
>PF01937 DUF89:  Protein of unknown function DUF89;  InterPro: IPR002791 This entry contains uncharacterised proteins. Those with structural information consist of two domains: an all-alpha domain with a 3-helical bundle fold, and an alpha-beta domain in 3 layers, alpha/beta/alpha. ; PDB: 2FFJ_B 1XFI_A 2Q40_A 2G8L_B 3PT1_A.
Probab=62.41  E-value=1.4  Score=32.84  Aligned_cols=17  Identities=29%  Similarity=0.597  Sum_probs=14.1

Q ss_pred             CCccEEEEeCcCCCccC
Q psy5023           2 DKLSYIFWIGDLNFRLN   18 (82)
Q Consensus         2 ~~~d~vfw~GDlNyRi~   18 (82)
                      .++|.|+.=||+|||-=
T Consensus       294 ~~adLVI~KG~~Nyr~L  310 (355)
T PF01937_consen  294 SEADLVIFKGDLNYRKL  310 (355)
T ss_dssp             CC-SEEEEEHHHHHHHH
T ss_pred             hhCCEEEEeCCHHHhhh
Confidence            57999999999999954


No 15 
>PRK13911 exodeoxyribonuclease III; Provisional
Probab=60.90  E-value=4.6  Score=28.67  Aligned_cols=14  Identities=36%  Similarity=0.427  Sum_probs=11.0

Q ss_pred             cEEEEeCcCCCccC
Q psy5023           5 SYIFWIGDLNFRLN   18 (82)
Q Consensus         5 d~vfw~GDlNyRi~   18 (82)
                      ..++|+||||=..+
T Consensus       137 ~~~Ii~GD~Nva~~  150 (250)
T PRK13911        137 KPVIVCGDLNVAHN  150 (250)
T ss_pred             CCEEEEccccCCCC
Confidence            47899999995544


No 16 
>PF10515 APP_amyloid:  beta-amyloid precursor protein C-terminus;  InterPro: IPR019543  This is the amyloid, C-terminal, protein of the beta-Amyloid precursor protein (APP) which is a conserved and ubiquitous transmembrane glycoprotein strongly implicated in the pathogenesis of Alzheimer's disease but whose normal biological function is unknown. The C-terminal 100 residues are released and aggregate into amyloid deposits which are strongly implicated in the pathology of Alzheimer's disease plaque-formation. The domain is associated with IPR008154 from INTERPRO, further towards the N terminus. ; PDB: 2ROZ_A 3DXD_D 1X11_D 2LP1_A 2LOH_A 3MXC_L 3MXY_L 3DXC_B 3DXE_D 3L81_B ....
Probab=60.68  E-value=2.2  Score=23.99  Aligned_cols=7  Identities=57%  Similarity=1.156  Sum_probs=5.2

Q ss_pred             CCCCCCc
Q psy5023          67 QPTFKYQ   73 (82)
Q Consensus        67 ~PTYK~~   73 (82)
                      -|||||-
T Consensus        45 NPTYkyf   51 (52)
T PF10515_consen   45 NPTYKYF   51 (52)
T ss_dssp             SCTCHHC
T ss_pred             CCceecc
Confidence            4899973


No 17 
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain. Saccharomyces cerevisiae Ted1 (trafficking of Emp24p/Erv25p-dependent cargo disrupted 1) is a metallophosphatase domain-containing protein which acts together with Emp24p and Erv25p in cargo exit from the ER.  Ted1 belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the
Probab=55.32  E-value=7.1  Score=27.16  Aligned_cols=10  Identities=30%  Similarity=0.491  Sum_probs=9.1

Q ss_pred             ccEEEEeCcC
Q psy5023           4 LSYIFWIGDL   13 (82)
Q Consensus         4 ~d~vfw~GDl   13 (82)
                      =|+|+++|||
T Consensus        45 Pd~V~fLGDL   54 (193)
T cd08164          45 PDAVVVLGDL   54 (193)
T ss_pred             CCEEEEeccc
Confidence            4899999999


No 18 
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain. A functionally uncharacterized subgroup related to the metallophosphatase domain of Saccharomyces cerevisiae Cdc1, S. cerevisiae Ted1 and human MPPE1. Cdc1 is an endoplasmic reticulum-localized transmembrane lipid phosphatase and is a subunit of DNA polymerase delta. TED1 (trafficking of Emp24p/Erv25p-dependent cargo disrupted 1), acts together with Emp24p and Erv25p in cargo exit from the ER.  The MPPE1 gene is a candidate susceptibility gene for Bipolar disorder.  Proteins in this uncharacterized subgroup belong to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like R
Probab=54.34  E-value=21  Score=24.83  Aligned_cols=16  Identities=19%  Similarity=0.611  Sum_probs=12.7

Q ss_pred             CccEEEEeCcCCCccCCCC
Q psy5023           3 KLSYIFWIGDLNFRLNNPE   21 (82)
Q Consensus         3 ~~d~vfw~GDlNyRi~~~~   21 (82)
                      +-|.||++|||   ++...
T Consensus        42 ~PD~Vi~lGDL---~D~G~   57 (195)
T cd08166          42 QPDIVIFLGDL---MDEGS   57 (195)
T ss_pred             CCCEEEEeccc---cCCCC
Confidence            46899999999   77543


No 19 
>TIGR03395 sphingomy sphingomyelin phosphodiesterase. Members of this family are bacterial proteins that act as sphingomyelin phosphodiesterase (EC 3.1.4.12), also called sphingomyelinase. Some members of this family have been shown to act as hemolysins.
Probab=54.02  E-value=8.9  Score=27.68  Aligned_cols=14  Identities=29%  Similarity=0.356  Sum_probs=11.2

Q ss_pred             cEEEEeCcCCCccC
Q psy5023           5 SYIFWIGDLNFRLN   18 (82)
Q Consensus         5 d~vfw~GDlNyRi~   18 (82)
                      .-||++||||-.-.
T Consensus       178 ~pvIl~GDfN~~~~  191 (283)
T TIGR03395       178 ETVLIGGDLNVNKG  191 (283)
T ss_pred             ceEEEEeeCCCCCC
Confidence            45899999997654


No 20 
>smart00476 DNaseIc deoxyribonuclease I. Deoxyribonuclease I catalyzes the endonucleolytic cleavage of double-stranded DNA. The enzyme is secreted outside the cell and also involved in apoptosis in the nucleus.
Probab=53.37  E-value=7.3  Score=28.40  Aligned_cols=14  Identities=21%  Similarity=0.496  Sum_probs=11.2

Q ss_pred             cEEEEeCcCCCccC
Q psy5023           5 SYIFWIGDLNFRLN   18 (82)
Q Consensus         5 d~vfw~GDlNyRi~   18 (82)
                      +-|+++||||=-.+
T Consensus       177 ~~villGDFNa~~~  190 (276)
T smart00476      177 EDVIFMGDFNAGCS  190 (276)
T ss_pred             CCEEEEccCCCCCC
Confidence            45899999998654


No 21 
>TIGR00633 xth exodeoxyribonuclease III (xth). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=53.36  E-value=6.7  Score=26.70  Aligned_cols=15  Identities=20%  Similarity=0.220  Sum_probs=11.6

Q ss_pred             ccEEEEeCcCCCccC
Q psy5023           4 LSYIFWIGDLNFRLN   18 (82)
Q Consensus         4 ~d~vfw~GDlNyRi~   18 (82)
                      ..-++++||||-...
T Consensus       141 ~~~~Il~GDFN~~~~  155 (255)
T TIGR00633       141 GKPVIICGDMNVAHT  155 (255)
T ss_pred             CCcEEEEeecccCCC
Confidence            357899999996554


No 22 
>KOG3873|consensus
Probab=52.82  E-value=11  Score=29.35  Aligned_cols=17  Identities=24%  Similarity=0.454  Sum_probs=14.6

Q ss_pred             CCccEEEEeCcCCCccC
Q psy5023           2 DKLSYIFWIGDLNFRLN   18 (82)
Q Consensus         2 ~~~d~vfw~GDlNyRi~   18 (82)
                      ...|.|+..||||-+-.
T Consensus       168 q~~~vVI~~GDLN~~P~  184 (422)
T KOG3873|consen  168 QNADVVILAGDLNMQPQ  184 (422)
T ss_pred             cCCcEEEEecCCCCCcc
Confidence            35799999999998866


No 23 
>PRK05421 hypothetical protein; Provisional
Probab=52.21  E-value=7.8  Score=27.38  Aligned_cols=10  Identities=30%  Similarity=0.481  Sum_probs=8.6

Q ss_pred             EEEEeCcCCC
Q psy5023           6 YIFWIGDLNF   15 (82)
Q Consensus         6 ~vfw~GDlNy   15 (82)
                      -++++||||=
T Consensus       184 p~Il~GDFN~  193 (263)
T PRK05421        184 PVILAGDFNT  193 (263)
T ss_pred             CEEEEccccc
Confidence            5899999993


No 24 
>KOG3662|consensus
Probab=51.23  E-value=21  Score=27.80  Aligned_cols=37  Identities=19%  Similarity=0.464  Sum_probs=23.4

Q ss_pred             CccEEEEeCcCCCccCCCCCCCHHHHHHHHhccChHHHHHhH
Q psy5023           3 KLSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQFNDLLEQD   44 (82)
Q Consensus         3 ~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~~~~Ll~~D   44 (82)
                      +=|++|++|||   .+...-++.++-.+-.+.  ++.++..+
T Consensus        93 kPdvvffLGDL---fDeG~~~~~eEf~~~~~R--fkkIf~~k  129 (410)
T KOG3662|consen   93 KPDVVFFLGDL---FDEGQWAGDEEFKKRYER--FKKIFGRK  129 (410)
T ss_pred             CCCEEEEeccc---cccCccCChHHHHHHHHH--HHHhhCCC
Confidence            34899999999   774433566665555432  55555544


No 25 
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional
Probab=49.51  E-value=20  Score=24.58  Aligned_cols=28  Identities=11%  Similarity=0.139  Sum_probs=19.5

Q ss_pred             CccEEEEeCcCCCccCCCCCCCHHHHHHHHhcc
Q psy5023           3 KLSYIFWIGDLNFRLNNPETYTQDIITDRIRDG   35 (82)
Q Consensus         3 ~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~   35 (82)
                      ..|.++.+||+   |+-..  ...+|++++.+.
T Consensus        44 ~~D~li~lGDl---vDrGp--~s~~vl~~l~~~   71 (218)
T PRK11439         44 WRDLLISVGDL---IDRGP--QSLRCLQLLEEH   71 (218)
T ss_pred             ccCEEEEcCcc---cCCCc--CHHHHHHHHHcC
Confidence            46899999999   76332  455677776653


No 26 
>PF00149 Metallophos:  Calcineurin-like phosphoesterase;  InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11. The most conserved regions in this domain centre around the metal chelating residues.; GO: 0016787 hydrolase activity; PDB: 2IAE_C 3DW8_F 3FGA_C 2IE4_C 2NYM_C 2NYL_C 3K7V_C 2NPP_C 2IE3_C 3K7W_C ....
Probab=48.69  E-value=15  Score=21.64  Aligned_cols=16  Identities=38%  Similarity=0.519  Sum_probs=12.4

Q ss_pred             CccEEEEeCcCCCccC
Q psy5023           3 KLSYIFWIGDLNFRLN   18 (82)
Q Consensus         3 ~~d~vfw~GDlNyRi~   18 (82)
                      +.|.|++.||+=.+-.
T Consensus        31 ~~d~ii~~GD~~~~~~   46 (200)
T PF00149_consen   31 KPDFIIFLGDLVDGGN   46 (200)
T ss_dssp             TTSEEEEESTSSSSSS
T ss_pred             CCCEEEeecccccccc
Confidence            5799999999944444


No 27 
>KOG2756|consensus
Probab=37.34  E-value=18  Score=27.28  Aligned_cols=15  Identities=27%  Similarity=0.448  Sum_probs=12.4

Q ss_pred             cEEEEeCcCCCccCC
Q psy5023           5 SYIFWIGDLNFRLNN   19 (82)
Q Consensus         5 d~vfw~GDlNyRi~~   19 (82)
                      -.||+-||+|.|=..
T Consensus       244 A~ViFGGD~NlrD~e  258 (349)
T KOG2756|consen  244 ATVIFGGDTNLRDRE  258 (349)
T ss_pred             ceEEEcCcccchhhh
Confidence            468999999999664


No 28 
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain. Metallophosphatases (MPPs), also known as metallophosphoesterases, phosphodiesterases (PDEs), binuclear metallophosphoesterases, and dimetal-containing phosphoesterases (DMPs), represent a diverse superfamily of enzymes with a conserved domain containing an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. This superfamily includes: the phosphoprotein phosphatases (PPPs), Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets.  This domain is thought to allow for productive me
Probab=35.97  E-value=30  Score=20.05  Aligned_cols=16  Identities=25%  Similarity=0.295  Sum_probs=13.3

Q ss_pred             CccEEEEeCcCCCccC
Q psy5023           3 KLSYIFWIGDLNFRLN   18 (82)
Q Consensus         3 ~~d~vfw~GDlNyRi~   18 (82)
                      +.|.|+++||+-..-.
T Consensus        26 ~~~~vi~~GD~~~~~~   41 (131)
T cd00838          26 KPDFVLVLGDLVGDGP   41 (131)
T ss_pred             CCCEEEECCcccCCCC
Confidence            5689999999977666


No 29 
>PRK15251 cytolethal distending toxin subunit CdtB; Provisional
Probab=35.44  E-value=21  Score=26.23  Aligned_cols=9  Identities=33%  Similarity=0.479  Sum_probs=7.8

Q ss_pred             EEEEeCcCC
Q psy5023           6 YIFWIGDLN   14 (82)
Q Consensus         6 ~vfw~GDlN   14 (82)
                      =++++||||
T Consensus       186 pw~I~GDFN  194 (271)
T PRK15251        186 NWMIAGDFN  194 (271)
T ss_pred             CEEEeccCC
Confidence            478999999


No 30 
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional
Probab=34.92  E-value=41  Score=23.15  Aligned_cols=27  Identities=7%  Similarity=0.151  Sum_probs=17.3

Q ss_pred             CccEEEEeCcCCCccCCCCCCCHHHHHHHHhc
Q psy5023           3 KLSYIFWIGDLNFRLNNPETYTQDIITDRIRD   34 (82)
Q Consensus         3 ~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~   34 (82)
                      +.|.+|.+||+   ++-..  ...++++.+..
T Consensus        42 ~~d~l~~lGD~---vdrG~--~~~~~l~~l~~   68 (218)
T PRK09968         42 ETDLLISVGDN---IDRGP--ESLNVLRLLNQ   68 (218)
T ss_pred             CCCEEEECCCC---cCCCc--CHHHHHHHHhh
Confidence            57999999999   55221  33456666544


No 31 
>COG0708 XthA Exonuclease III [DNA replication, recombination, and repair]
Probab=34.65  E-value=21  Score=26.04  Aligned_cols=13  Identities=23%  Similarity=0.350  Sum_probs=10.1

Q ss_pred             cEEEEeCcCCCcc
Q psy5023           5 SYIFWIGDLNFRL   17 (82)
Q Consensus         5 d~vfw~GDlNyRi   17 (82)
                      --++++||+|=.-
T Consensus       141 ~~~vl~GD~NIap  153 (261)
T COG0708         141 KPVVLCGDFNIAP  153 (261)
T ss_pred             CCEEEecccccCC
Confidence            4689999999543


No 32 
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain. Acid sphingomyelinase (ASMase) is a ubiquitously expressed phosphodiesterase which hydrolyzes sphingomyelin in acid pH conditions to form ceramide, a bioactive second messenger, as part of the sphingomyelin signaling pathway.  ASMase is localized at the noncytosolic leaflet of biomembranes (for example the luminal leaflet of endosomes, lysosomes and phagosomes, and the extracellular leaflet of plasma membranes).  ASMase-deficient humans develop Niemann-Pick disease. This disease is characterized by lysosomal storage of sphingomyelin in all tissues.  Although ASMase-deficient mice are resistant to stress-induced apoptosis, they have greater susceptibility to bacterial infection. The latter correlates with defective phagolysosomal fusion and antibacterial killing activity in ASMase-deficient macrophages.  ASMase belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but
Probab=34.61  E-value=27  Score=24.73  Aligned_cols=14  Identities=43%  Similarity=0.871  Sum_probs=11.4

Q ss_pred             CccEEEEeCcCCCc
Q psy5023           3 KLSYIFWIGDLNFR   16 (82)
Q Consensus         3 ~~d~vfw~GDlNyR   16 (82)
                      +.|.|+|.||+=..
T Consensus        68 ~~dfii~tGD~v~h   81 (296)
T cd00842          68 KPDFILWTGDLVRH   81 (296)
T ss_pred             CCCEEEEcCCCCCC
Confidence            67999999999433


No 33 
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain. 239FB (Fetal brain protein 239) is thought to play a role in central nervous system development, but its specific role in unknown.  239FB is expressed predominantly in human fetal brain from a gene located in the chromosome 11p13 region associated with the mental retardation component of the WAGR (Wilms tumor, Aniridia, Genitourinary anomalies, Mental retardation) syndrome. Orthologous brp-like (brain protein 239-like) proteins have been identified in the invertebrate amphioxus group and in vertebrates.  239FB belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzyme
Probab=33.40  E-value=32  Score=21.39  Aligned_cols=14  Identities=21%  Similarity=0.214  Sum_probs=11.5

Q ss_pred             CCccEEEEeCcCCC
Q psy5023           2 DKLSYIFWIGDLNF   15 (82)
Q Consensus         2 ~~~d~vfw~GDlNy   15 (82)
                      .+.|.|+.+||+-.
T Consensus        18 ~~~D~vi~~GD~~~   31 (135)
T cd07379          18 PDGDVLIHAGDLTE   31 (135)
T ss_pred             CCCCEEEECCCCCC
Confidence            46799999999843


No 34 
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain. This family includes bacterial and archeal proteins homologous to AQ1575, an uncharacterized Aquifex aeolicus protein.  AQ1575 may play an accessory role in DNA repair, based on the close proximity of its gene to Holliday junction resolvasome genes.  The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a d
Probab=33.14  E-value=34  Score=22.37  Aligned_cols=16  Identities=19%  Similarity=0.420  Sum_probs=12.5

Q ss_pred             CCccEEEEeCcCCCcc
Q psy5023           2 DKLSYIFWIGDLNFRL   17 (82)
Q Consensus         2 ~~~d~vfw~GDlNyRi   17 (82)
                      .+.|.|+.+||+=.+-
T Consensus        41 ~~~d~vi~~GDl~~~~   56 (168)
T cd07390          41 GPDDTVYHLGDFSFGG   56 (168)
T ss_pred             CCCCEEEEeCCCCCCC
Confidence            4579999999995543


No 35 
>PLN03144 Carbon catabolite repressor protein 4 homolog; Provisional
Probab=30.46  E-value=27  Score=28.41  Aligned_cols=23  Identities=17%  Similarity=0.122  Sum_probs=15.0

Q ss_pred             EEEEeCcCCCccCCCCCCCHHHHHHHHhcc
Q psy5023           6 YIFWIGDLNFRLNNPETYTQDIITDRIRDG   35 (82)
Q Consensus         6 ~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~   35 (82)
                      -|+++||||---+       ..+-+++..|
T Consensus       457 PvIlcGDFNS~P~-------S~vy~lLt~G  479 (606)
T PLN03144        457 PMLVCGDFNSVPG-------SAPHCLLATG  479 (606)
T ss_pred             ceEEeccCCCCCC-------ChhhhhhhcC
Confidence            4899999996443       3455555554


No 36 
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain. PrpE (protein phosphatase E) is a bacterial member of the PPP (phosphoprotein phosphatase) family of serine/threonine phosphatases and a key signal transduction pathway component controlling the expression of spore germination receptors GerA and GerK in Bacillus subtilis. PrpE is closely related to ApaH (also known symmetrical Ap(4)A hydrolase and bis(5'nucleosyl)-tetraphosphatase).  PrpE has specificity for phosphotyrosine only, unlike the serine/threonine phosphatases to which it is related. The Bacilli members of this family are single domain proteins while the other members have N- and C-terminal domains in addition to this phosphatase domain.  The PPP (phosphoprotein phosphatase) family, to which PrpE belongs, is one of two known protein phosphatase families specific for serine and threonine.  The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpA/Prp
Probab=29.91  E-value=89  Score=21.53  Aligned_cols=24  Identities=13%  Similarity=0.228  Sum_probs=16.1

Q ss_pred             ccEEEEeCcCCCccCCCCCCCHHHHHHHH
Q psy5023           4 LSYIFWIGDLNFRLNNPETYTQDIITDRI   32 (82)
Q Consensus         4 ~d~vfw~GDlNyRi~~~~~l~~~~v~~~i   32 (82)
                      .|.++++||+   |+...  ...+|++.+
T Consensus        38 ~d~lv~lGDl---IDrG~--~s~evl~~l   61 (234)
T cd07423          38 GRRAVFVGDL---VDRGP--DSPEVLRLV   61 (234)
T ss_pred             CCEEEEECCc---cCCCC--CHHHHHHHH
Confidence            5899999999   66332  344555554


No 37 
>PF09222 Fim-adh_lectin:  Fimbrial adhesin F17-AG, lectin domain;  InterPro: IPR015303 This entry represents the carbohydrate-specific lectin domain found in bacterial fimbrial adhesins. It adopts a compact, elongated structure consisting of a beta-sandwich with two major sheets: one consisting of five long strands in mixed orientations, and a front sheet with four antiparallel strands, forming an immunoglobin-like fold []. ; GO: 0044406 adhesion to host, 0009289 pilus; PDB: 3F64_A 1O9Z_A 3F6J_A 1ZPL_A 1O9V_A 1O9W_A 2BSC_A 1ZK5_A 2BS8_A 2BS7_1 ....
Probab=29.51  E-value=33  Score=23.50  Aligned_cols=13  Identities=31%  Similarity=0.961  Sum_probs=10.5

Q ss_pred             ccEEEEeCcCCCc
Q psy5023           4 LSYIFWIGDLNFR   16 (82)
Q Consensus         4 ~d~vfw~GDlNyR   16 (82)
                      --.++|+||-||-
T Consensus        79 iGilV~~GDt~ys   91 (171)
T PF09222_consen   79 IGILVWAGDTNYS   91 (171)
T ss_dssp             EEEEEEEESSSGG
T ss_pred             eEEEEEeCCcCcc
Confidence            3478999999983


No 38 
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain. YydB (BSU40220) is an uncharacterized Bacillus subtilis protein that  belongs to the following Bacillus subtilis gene cluster yydB-yydC-yydD-yydG-yydH-yydI-yydJ.  YydB belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productiv
Probab=29.22  E-value=38  Score=20.97  Aligned_cols=13  Identities=23%  Similarity=0.327  Sum_probs=10.7

Q ss_pred             CccEEEEeCcCCC
Q psy5023           3 KLSYIFWIGDLNF   15 (82)
Q Consensus         3 ~~d~vfw~GDlNy   15 (82)
                      ..|.|+.+||+=.
T Consensus        35 ~~d~vi~~GDl~~   47 (144)
T cd07400          35 DPDLVVITGDLTQ   47 (144)
T ss_pred             CCCEEEECCCCCC
Confidence            5699999999933


No 39 
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain. MS158 is an uncharacterized Microscilla protein with a metallophosphatase domain.  Microscilla proteins MS152, and MS153 are also included in this family.  The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is t
Probab=29.09  E-value=39  Score=21.63  Aligned_cols=15  Identities=13%  Similarity=0.383  Sum_probs=11.8

Q ss_pred             CCccEEEEeCcCCCc
Q psy5023           2 DKLSYIFWIGDLNFR   16 (82)
Q Consensus         2 ~~~d~vfw~GDlNyR   16 (82)
                      .+.|.|+++||+-.+
T Consensus        25 ~~~d~li~~GDi~~~   39 (166)
T cd07404          25 PDADILVLAGDIGYL   39 (166)
T ss_pred             CCCCEEEECCCCCCC
Confidence            357999999999543


No 40 
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain. Cdc1 (also known as XlCdc1 in Xenopus laevis) is an endoplasmic reticulum-localized transmembrane lipid phosphatase with a metallophosphatase domain facing the ER lumen.  In budding yeast, the gene encoding CDC1 is essential while nonlethal mutations cause defects in Golgi inheritance and actin polarization.  Cdc1 mutant cells accumulate an unidentified phospholipid, suggesting that Cdc1 is a lipid phosphatase.  Cdc1 mutant cells also have highly elevated intracellular calcium levels suggesting a possible role for Cdc1 in calcium regulation.  The 5' flanking region of Cdc1 is a regulatory region with conserved binding site motifs for AP1, AP2, Sp1, NF-1 and CREB.  DNA polymerase delta consists of at least four subunits - Pol3, Cdc1, Cdc27, and Cdm1.  This group also contains Saccharomyces cerevisiae TED1 (Trafficking of Emp24p/Erv25p-dependent cargo disrupted 1), which acts together wit
Probab=28.01  E-value=40  Score=22.34  Aligned_cols=11  Identities=36%  Similarity=0.821  Sum_probs=9.9

Q ss_pred             CccEEEEeCcC
Q psy5023           3 KLSYIFWIGDL   13 (82)
Q Consensus         3 ~~d~vfw~GDl   13 (82)
                      +.|.|+++|||
T Consensus        45 ~pd~vi~lGDl   55 (171)
T cd07384          45 KPDVVLFLGDL   55 (171)
T ss_pred             CCCEEEEeccc
Confidence            56899999999


No 41 
>KOG2338|consensus
Probab=27.99  E-value=30  Score=27.59  Aligned_cols=13  Identities=38%  Similarity=0.547  Sum_probs=10.1

Q ss_pred             EEEEeCcCCCccC
Q psy5023           6 YIFWIGDLNFRLN   18 (82)
Q Consensus         6 ~vfw~GDlNyRi~   18 (82)
                      .||++||||=-=+
T Consensus       294 pi~l~GDfNt~p~  306 (495)
T KOG2338|consen  294 PIFLCGDFNTEPD  306 (495)
T ss_pred             CeEEecCCCCCCC
Confidence            7999999995433


No 42 
>COG3021 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.97  E-value=31  Score=25.88  Aligned_cols=9  Identities=33%  Similarity=0.645  Sum_probs=8.0

Q ss_pred             EEEeCcCCC
Q psy5023           7 IFWIGDLNF   15 (82)
Q Consensus         7 vfw~GDlNy   15 (82)
                      |++.||||=
T Consensus       225 vIlaGDfNa  233 (309)
T COG3021         225 VILAGDFNA  233 (309)
T ss_pred             eEEeecCCC
Confidence            789999986


No 43 
>COG4531 ZnuA ABC-type Zn2+ transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism]
Probab=27.18  E-value=35  Score=25.59  Aligned_cols=11  Identities=18%  Similarity=0.915  Sum_probs=7.7

Q ss_pred             CCCccEEEEeC
Q psy5023           1 MDKLSYIFWIG   11 (82)
Q Consensus         1 ~~~~d~vfw~G   11 (82)
                      |..+|.|||+|
T Consensus        73 lq~Adlv~WvG   83 (318)
T COG4531          73 LQSADLVVWVG   83 (318)
T ss_pred             hhcCCEEEEEC
Confidence            34567788877


No 44 
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain. DR1119 is an uncharacterized Deinococcus radiodurans protein with a metallophosphatase domain.  The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordinat
Probab=25.58  E-value=50  Score=22.74  Aligned_cols=15  Identities=13%  Similarity=0.330  Sum_probs=12.1

Q ss_pred             CCccEEEEeCcCCCc
Q psy5023           2 DKLSYIFWIGDLNFR   16 (82)
Q Consensus         2 ~~~d~vfw~GDlNyR   16 (82)
                      .+.|.|++.|||-.+
T Consensus        40 ~~~D~viiaGDl~~~   54 (232)
T cd07393          40 APEDIVLIPGDISWA   54 (232)
T ss_pred             CCCCEEEEcCCCccC
Confidence            367999999999643


No 45 
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain. CSTP1 (complete S-transactivated protein 1) is an uncharacterized Homo sapiens protein with a metallophosphatase domain, that is transactivated by the complete S protein of hepatitis B virus.  CSTP1 belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is th
Probab=24.96  E-value=52  Score=22.77  Aligned_cols=11  Identities=36%  Similarity=0.634  Sum_probs=9.9

Q ss_pred             CccEEEEeCcC
Q psy5023           3 KLSYIFWIGDL   13 (82)
Q Consensus         3 ~~d~vfw~GDl   13 (82)
                      +.|.|++.|||
T Consensus        49 ~pd~ii~~GDl   59 (262)
T cd07395          49 KPKFVVVCGDL   59 (262)
T ss_pred             CCCEEEEeCCc
Confidence            56999999999


No 46 
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain. YfcE is a manganase-dependent metallophosphatase, found in bacteria and archaea, that cleaves bis-p-nitrophenyl phosphate, thymidine 5'-monophosphate-p-nitrophenyl ester, and p-nitrophenyl phosphorylcholine, but is unable to hydrolyze 2',3 ' or 3',5' cyclic nucleic phosphodiesters, and various phosphomonoesters, including p-nitrophenyl phosphate. This family also includes the Bacilus subtilis YsnB and Methanococcus jannaschii MJ0936 proteins.  This domain family belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid ph
Probab=24.70  E-value=49  Score=20.79  Aligned_cols=16  Identities=19%  Similarity=0.318  Sum_probs=12.0

Q ss_pred             CccEEEEeCcCCCccC
Q psy5023           3 KLSYIFWIGDLNFRLN   18 (82)
Q Consensus         3 ~~d~vfw~GDlNyRi~   18 (82)
                      +.|.|+.+||+-.+-.
T Consensus        24 ~~d~ii~~GD~~~~~~   39 (155)
T cd00841          24 DVDLIIHAGDVLYPGP   39 (155)
T ss_pred             CCCEEEECCccccccc
Confidence            4799999999855443


No 47 
>cd07952 ED_3B_like Uncharacterized class III extradiol dioxygenases. This subfamily is composed of proteins of unknown function with similarity to the catalytic B subunit of class III extradiol dioxygenases. Class III extradiol dioxygenases use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. They play key roles in the degradation of aromatic compounds.
Probab=24.30  E-value=1.2e+02  Score=21.37  Aligned_cols=42  Identities=19%  Similarity=0.230  Sum_probs=29.5

Q ss_pred             EEEEeCcCCCccCCCCC-----CC---HHHHHHHHhccChHHHHHhHHHH
Q psy5023           6 YIFWIGDLNFRLNNPET-----YT---QDIITDRIRDGQFNDLLEQDQLR   47 (82)
Q Consensus         6 ~vfw~GDlNyRi~~~~~-----l~---~~~v~~~i~~~~~~~Ll~~DQL~   47 (82)
                      .|+-.|||+-++....+     ..   .+.+++.|..+++..|++.++..
T Consensus       163 liIaSGdlSH~l~~~~p~~~~~~a~~fD~~~~~~l~~~d~~~l~~~~~~~  212 (256)
T cd07952         163 AVIISADHAHTHDPDGPYGYSPDAAEYDAAIVEAIENNDFEALLELDDEL  212 (256)
T ss_pred             EEEEecCccccCCCCCCCCCCcchHHHHHHHHHHHHcCCHHHHHhCCHHH
Confidence            57789999999872211     11   13566778999999999886643


No 48 
>PF12850 Metallophos_2:  Calcineurin-like phosphoesterase superfamily domain;  InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [].; PDB: 2GJU_A 1Z2W_A 1Z2X_B 3PSO_B 3PSN_B 1W24_A 2R17_B 3QFN_B 3QFO_A 3QFM_A ....
Probab=22.83  E-value=65  Score=19.81  Aligned_cols=12  Identities=17%  Similarity=0.720  Sum_probs=9.2

Q ss_pred             CCccEEEEeCcC
Q psy5023           2 DKLSYIFWIGDL   13 (82)
Q Consensus         2 ~~~d~vfw~GDl   13 (82)
                      .+.|.|+.+||+
T Consensus        24 ~~~d~vi~~GDi   35 (156)
T PF12850_consen   24 NEPDFVIILGDI   35 (156)
T ss_dssp             TTESEEEEES-S
T ss_pred             cCCCEEEECCCc
Confidence            357999999997


No 49 
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain. PA3087 is an uncharacterized protein from Pseudomonas aeruginosa with a metallophosphatase domain that belongs to the phosphoprotein phosphatase (PPP) family.  The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-).  The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes.  Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes.  PPPs belong to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of 
Probab=21.97  E-value=1.5e+02  Score=20.43  Aligned_cols=25  Identities=12%  Similarity=0.304  Sum_probs=16.1

Q ss_pred             CccEEEEeCcCCCccCCCCCCCHHHHHHHH
Q psy5023           3 KLSYIFWIGDLNFRLNNPETYTQDIITDRI   32 (82)
Q Consensus         3 ~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i   32 (82)
                      ..|.++++||+   |+-.+  ...+|++.+
T Consensus        33 ~~d~lvflGD~---IDRGp--~S~~vl~~l   57 (222)
T cd07413          33 PERQVVFLGDL---IDRGP--EIRELLEIV   57 (222)
T ss_pred             CCCEEEEeCcc---cCCCC--CHHHHHHHH
Confidence            36899999999   77432  334455544


No 50 
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain. PAE1087 is an uncharacterized Pyrobaculum aerophilum protein with a metallophosphatase domain.  The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordina
Probab=21.82  E-value=61  Score=20.64  Aligned_cols=14  Identities=14%  Similarity=0.176  Sum_probs=11.3

Q ss_pred             CccEEEEeCcCCCc
Q psy5023           3 KLSYIFWIGDLNFR   16 (82)
Q Consensus         3 ~~d~vfw~GDlNyR   16 (82)
                      +.|.|+..|||-.+
T Consensus        23 ~~D~vv~~GDl~~~   36 (188)
T cd07392          23 EADAVIVAGDITNF   36 (188)
T ss_pred             CCCEEEECCCccCc
Confidence            57999999999543


No 51 
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents.  The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosa
Probab=21.13  E-value=61  Score=21.80  Aligned_cols=11  Identities=27%  Similarity=0.549  Sum_probs=10.1

Q ss_pred             CccEEEEeCcC
Q psy5023           3 KLSYIFWIGDL   13 (82)
Q Consensus         3 ~~d~vfw~GDl   13 (82)
                      +.|.|++.||+
T Consensus        40 ~~d~vi~~GDl   50 (240)
T cd07402          40 RPDLVLVTGDL   50 (240)
T ss_pred             CCCEEEECccC
Confidence            67999999998


No 52 
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain. MPPE1 is a functionally uncharacterized metallophosphatase domain-containing protein. The MPPE1 gene is located on chromosome 18 and is a candidate susceptibility gene for Bipolar disorder.  MPPE1 belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases).  The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to 
Probab=20.50  E-value=66  Score=20.93  Aligned_cols=11  Identities=36%  Similarity=0.733  Sum_probs=9.9

Q ss_pred             CccEEEEeCcC
Q psy5023           3 KLSYIFWIGDL   13 (82)
Q Consensus         3 ~~d~vfw~GDl   13 (82)
                      +.|.|++.|||
T Consensus        38 ~pd~vv~~GDl   48 (156)
T cd08165          38 QPDVVFVLGDL   48 (156)
T ss_pred             CCCEEEECCCC
Confidence            46899999999


No 53 
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain. ApaH (also known as symmetrically cleaving Ap4A hydrolase and bis(5'nucleosyl)-tetraphosphatase) is a bacterial member of the PPP (phosphoprotein phosphatase) family of serine/threonine phosphatases that hydrolyzes the nucleotide-signaling molecule diadenosine tetraphosphate (Ap(4)A) into two ADP and also hydrolyzes Ap(5)A, Gp(4)G, and other extending compounds.  Null mutations in apaH result in high intracellular levels of Ap(4)A which correlate with multiple phenotypes, including a decreased expression of catabolite-repressible genes, a reduction in the expression of flagellar operons, and an increased sensitivity to UV  and heat.  Ap4A hydrolase is important in responding to heat shock and oxidative stress via regulating the concentration of Ap4A in bacteria.  Ap4A hydrolase is also thought to play a role in siderophore production, but the mechanism by which ApaH interacts with siderophore pathwa
Probab=20.50  E-value=1.7e+02  Score=21.04  Aligned_cols=26  Identities=15%  Similarity=0.232  Sum_probs=16.9

Q ss_pred             CccEEEEeCcCCCccCCCCCCCHHHHHHHHh
Q psy5023           3 KLSYIFWIGDLNFRLNNPETYTQDIITDRIR   33 (82)
Q Consensus         3 ~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~   33 (82)
                      ..|.++++||+   ++-..  ...+|++.+.
T Consensus        26 ~~D~Li~lGDl---VdRGp--~s~evl~~l~   51 (257)
T cd07422          26 AKDRLWLVGDL---VNRGP--DSLETLRFVK   51 (257)
T ss_pred             CCCEEEEecCc---CCCCc--CHHHHHHHHH
Confidence            46999999999   66332  3344555544


No 54 
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain. Cdc1 (also known as XlCdc1 in Xenopus laevis) is an endoplasmic reticulum-localized transmembrane lipid phosphatase with a metallophosphatase domain facing the ER lumen.  In budding yeast, the gene encoding CDC1 is essential while nonlethal mutations cause defects in Golgi inheritance and actin polarization.  Cdc1 mutant cells accumulate an unidentified phospholipid, suggesting that Cdc1 is a lipid phosphatase.  Cdc1 mutant cells also have highly elevated intracellular calcium levels suggesting a possible role for Cdc1 in calcium regulation.  The 5' flanking region of Cdc1 is a regulatory region with conserved binding site motifs for AP1, AP2, Sp1, NF-1 and CREB.  DNA polymerase delta consists of at least four subunits - Pol3, Cdc1, Cdc27, and Cdm1.  Cdc1 belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site 
Probab=20.17  E-value=62  Score=23.03  Aligned_cols=14  Identities=29%  Similarity=0.624  Sum_probs=11.5

Q ss_pred             CccEEEEeCcCCCccCC
Q psy5023           3 KLSYIFWIGDLNFRLNN   19 (82)
Q Consensus         3 ~~d~vfw~GDlNyRi~~   19 (82)
                      +-|.||++|||   ++.
T Consensus        45 ~PD~vv~lGDL---~d~   58 (257)
T cd08163          45 KPDSTIFLGDL---FDG   58 (257)
T ss_pred             CCCEEEEeccc---ccC
Confidence            46899999999   554


No 55 
>PF09111 SLIDE:  SLIDE;  InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices. It has a role in DNA binding, contacting DNA target sites similar to c-Myb (IPR014778 from INTERPRO) repeats or homeodomains []. ; GO: 0003676 nucleic acid binding, 0005524 ATP binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006338 chromatin remodeling, 0005634 nucleus; PDB: 2NOG_A 2Y9Y_A 2Y9Z_A 1OFC_X.
Probab=20.10  E-value=1.8e+02  Score=18.62  Aligned_cols=50  Identities=22%  Similarity=0.288  Sum_probs=23.1

Q ss_pred             HHHHHHhccChHHHHHhHHHHHHHhhCcccCC-cccCCCCCCCCCCCcCCC
Q psy5023          27 IITDRIRDGQFNDLLEQDQLRAVMQSGEAFSE-FNETTPTFQPTFKYQFNS   76 (82)
Q Consensus        27 ~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~~-f~E~~I~F~PTYK~~~~s   76 (82)
                      .+...|+.|.=...-...|...-++.-..+.. +.|-.|+++|+.+-...|
T Consensus         3 k~i~~IE~gE~k~~k~~~~~~~l~~Kv~~~~~P~~~L~i~y~~~~~~k~ys   53 (118)
T PF09111_consen    3 KIIKRIEKGEKKIEKRKEQQEALRKKVEQYKNPWQELKINYPPNNKKKVYS   53 (118)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHCC-SSHHHH---SSTSTSS-SSS-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCHHHCeeccCCCCCCCCcC
Confidence            45556665542222223333333333445555 888999999977655444


Done!