Query psy5023
Match_columns 82
No_of_seqs 125 out of 882
Neff 6.5
Searched_HMMs 46136
Date Fri Aug 16 23:52:07 2013
Command hhsearch -i /work/01045/syshi/Psyhhblits/psy5023.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5023hhsearch_cdd -cpu 12 -v 0
No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM
1 KOG0566|consensus 100.0 2.1E-32 4.6E-37 219.0 7.5 77 1-81 711-787 (1080)
2 smart00128 IPPc Inositol polyp 100.0 7.7E-32 1.7E-36 196.2 7.0 78 2-82 179-257 (310)
3 PLN03191 Type I inositol-1,4,5 100.0 4.7E-31 1E-35 205.2 7.9 76 1-80 466-541 (621)
4 COG5411 Phosphatidylinositol 5 99.9 1.4E-25 3E-30 169.5 4.7 78 1-82 203-282 (460)
5 PTZ00312 inositol-1,4,5-tripho 99.7 4.1E-17 8.9E-22 119.6 4.0 70 2-73 126-220 (356)
6 KOG0565|consensus 98.6 2.1E-08 4.5E-13 65.7 1.5 38 4-44 108-145 (145)
7 KOG1976|consensus 97.5 7.1E-05 1.5E-09 55.9 3.1 22 55-76 305-327 (391)
8 KOG3870|consensus 89.0 0.15 3.3E-06 39.4 0.6 17 1-17 349-365 (434)
9 PF03372 Exo_endo_phos: Endonu 83.5 0.64 1.4E-05 30.3 1.2 14 6-19 158-171 (249)
10 COG3568 ElsH Metal-dependent h 72.6 1.9 4.2E-05 31.4 1.1 15 6-20 166-187 (259)
11 PRK11756 exonuclease III; Prov 68.0 2.6 5.6E-05 29.5 0.9 15 4-18 143-157 (268)
12 PF14529 Exo_endo_phos_2: Endo 66.9 2.4 5.2E-05 25.4 0.5 13 6-18 32-44 (119)
13 TIGR00195 exoDNase_III exodeox 64.5 3.3 7.2E-05 28.7 0.9 14 5-18 139-152 (254)
14 PF01937 DUF89: Protein of unk 62.4 1.4 3E-05 32.8 -1.4 17 2-18 294-310 (355)
15 PRK13911 exodeoxyribonuclease 60.9 4.6 0.0001 28.7 1.1 14 5-18 137-150 (250)
16 PF10515 APP_amyloid: beta-amy 60.7 2.2 4.8E-05 24.0 -0.4 7 67-73 45-51 (52)
17 cd08164 MPP_Ted1 Saccharomyces 55.3 7.1 0.00015 27.2 1.3 10 4-13 45-54 (193)
18 cd08166 MPP_Cdc1_like_1 unchar 54.3 21 0.00046 24.8 3.5 16 3-21 42-57 (195)
19 TIGR03395 sphingomy sphingomye 54.0 8.9 0.00019 27.7 1.7 14 5-18 178-191 (283)
20 smart00476 DNaseIc deoxyribonu 53.4 7.3 0.00016 28.4 1.1 14 5-18 177-190 (276)
21 TIGR00633 xth exodeoxyribonucl 53.4 6.7 0.00015 26.7 0.9 15 4-18 141-155 (255)
22 KOG3873|consensus 52.8 11 0.00023 29.3 1.9 17 2-18 168-184 (422)
23 PRK05421 hypothetical protein; 52.2 7.8 0.00017 27.4 1.1 10 6-15 184-193 (263)
24 KOG3662|consensus 51.2 21 0.00045 27.8 3.3 37 3-44 93-129 (410)
25 PRK11439 pphA serine/threonine 49.5 20 0.00044 24.6 2.8 28 3-35 44-71 (218)
26 PF00149 Metallophos: Calcineu 48.7 15 0.00033 21.6 1.9 16 3-18 31-46 (200)
27 KOG2756|consensus 37.3 18 0.00038 27.3 1.0 15 5-19 244-258 (349)
28 cd00838 MPP_superfamily metall 36.0 30 0.00065 20.1 1.8 16 3-18 26-41 (131)
29 PRK15251 cytolethal distending 35.4 21 0.00045 26.2 1.2 9 6-14 186-194 (271)
30 PRK09968 serine/threonine-spec 34.9 41 0.0009 23.2 2.6 27 3-34 42-68 (218)
31 COG0708 XthA Exonuclease III [ 34.6 21 0.00046 26.0 1.1 13 5-17 141-153 (261)
32 cd00842 MPP_ASMase acid sphing 34.6 27 0.00058 24.7 1.6 14 3-16 68-81 (296)
33 cd07379 MPP_239FB Homo sapiens 33.4 32 0.00069 21.4 1.7 14 2-15 18-31 (135)
34 cd07390 MPP_AQ1575 Aquifex aeo 33.1 34 0.00073 22.4 1.8 16 2-17 41-56 (168)
35 PLN03144 Carbon catabolite rep 30.5 27 0.00058 28.4 1.2 23 6-35 457-479 (606)
36 cd07423 MPP_PrpE Bacillus subt 29.9 89 0.0019 21.5 3.6 24 4-32 38-61 (234)
37 PF09222 Fim-adh_lectin: Fimbr 29.5 33 0.00071 23.5 1.3 13 4-16 79-91 (171)
38 cd07400 MPP_YydB Bacillus subt 29.2 38 0.00083 21.0 1.5 13 3-15 35-47 (144)
39 cd07404 MPP_MS158 Microscilla 29.1 39 0.00085 21.6 1.6 15 2-16 25-39 (166)
40 cd07384 MPP_Cdc1_like Saccharo 28.0 40 0.00088 22.3 1.5 11 3-13 45-55 (171)
41 KOG2338|consensus 28.0 30 0.00066 27.6 1.0 13 6-18 294-306 (495)
42 COG3021 Uncharacterized protei 28.0 31 0.00067 25.9 1.0 9 7-15 225-233 (309)
43 COG4531 ZnuA ABC-type Zn2+ tra 27.2 35 0.00077 25.6 1.2 11 1-11 73-83 (318)
44 cd07393 MPP_DR1119 Deinococcus 25.6 50 0.0011 22.7 1.7 15 2-16 40-54 (232)
45 cd07395 MPP_CSTP1 Homo sapiens 25.0 52 0.0011 22.8 1.7 11 3-13 49-59 (262)
46 cd00841 MPP_YfcE Escherichia c 24.7 49 0.0011 20.8 1.4 16 3-18 24-39 (155)
47 cd07952 ED_3B_like Uncharacter 24.3 1.2E+02 0.0026 21.4 3.5 42 6-47 163-212 (256)
48 PF12850 Metallophos_2: Calcin 22.8 65 0.0014 19.8 1.7 12 2-13 24-35 (156)
49 cd07413 MPP_PA3087 Pseudomonas 22.0 1.5E+02 0.0032 20.4 3.5 25 3-32 33-57 (222)
50 cd07392 MPP_PAE1087 Pyrobaculu 21.8 61 0.0013 20.6 1.5 14 3-16 23-36 (188)
51 cd07402 MPP_GpdQ Enterobacter 21.1 61 0.0013 21.8 1.4 11 3-13 40-50 (240)
52 cd08165 MPP_MPPE1 human MPPE1 20.5 66 0.0014 20.9 1.4 11 3-13 38-48 (156)
53 cd07422 MPP_ApaH Escherichia c 20.5 1.7E+02 0.0036 21.0 3.6 26 3-33 26-51 (257)
54 cd08163 MPP_Cdc1 Saccharomyces 20.2 62 0.0013 23.0 1.3 14 3-19 45-58 (257)
55 PF09111 SLIDE: SLIDE; InterP 20.1 1.8E+02 0.0038 18.6 3.3 50 27-76 3-53 (118)
No 1
>KOG0566|consensus
Probab=99.97 E-value=2.1e-32 Score=218.98 Aligned_cols=77 Identities=36% Similarity=0.782 Sum_probs=75.4
Q ss_pred CCCccEEEEeCcCCCccCCCCCCCHHHHHHHHhccChHHHHHhHHHHHHHhhCcccCCcccCCCCCCCCCCCcCCCCCcc
Q psy5023 1 MDKLSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQFNDLLEQDQLRAVMQSGEAFSEFNETTPTFQPTFKYQFNSHNYD 80 (82)
Q Consensus 1 ~~~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~~f~E~~I~F~PTYK~~~~s~~Yd 80 (82)
|.+||+|||||||||||+ ++.++|+..|.+++|+.|+++|||+++|.+|.+|.||.|++|+|+||||||.||+.||
T Consensus 711 I~~HD~ifW~GDFNYRI~----l~nEEVr~~v~~~d~~kL~e~DQL~~q~~~G~vF~gF~E~~ltF~PTYKyD~gTd~YD 786 (1080)
T KOG0566|consen 711 IFSHDYIFWLGDFNYRID----LSNEEVRRLVRNQDLDKLLEYDQLTQQMNAGQVFPGFHEGQLTFPPTYKYDPGTDDYD 786 (1080)
T ss_pred ccCCceEEEecccceeec----CCHHHHHHHHHhccHHHHhhHHHHHHHHhcCcccccccccccccCCcccccCCCCccc
Confidence 578999999999999999 6999999999999999999999999999999999999999999999999999999999
Q ss_pred C
Q psy5023 81 N 81 (82)
Q Consensus 81 t 81 (82)
|
T Consensus 787 T 787 (1080)
T KOG0566|consen 787 T 787 (1080)
T ss_pred c
Confidence 8
No 2
>smart00128 IPPc Inositol polyphosphate phosphatase, catalytic domain homologues. Mg(2+)-dependent/Li(+)-sensitive enzymes.
Probab=99.97 E-value=7.7e-32 Score=196.21 Aligned_cols=78 Identities=40% Similarity=0.797 Sum_probs=72.8
Q ss_pred CCccEEEEeCcCCCccCCCCCCCHHHHHHHHhccChHHHHHhHHHHHHHhhCcccCCcccCCCCCCCCCCCc-CCCCCcc
Q psy5023 2 DKLSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQFNDLLEQDQLRAVMQSGEAFSEFNETTPTFQPTFKYQ-FNSHNYD 80 (82)
Q Consensus 2 ~~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~~f~E~~I~F~PTYK~~-~~s~~Yd 80 (82)
.++|+|||||||||||+.. ..++|+++|+.++|..|+++|||..+++++.+|.||.|++|+|||||||+ .+++.||
T Consensus 179 ~~~d~~f~~GDlNyRi~~~---~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~~f~E~~I~F~PTYK~~~~~t~~Yd 255 (310)
T smart00128 179 FDHDVVFWFGDLNFRLDSP---SYEEVRRKISKKEFDDLLEKDQLNRQKEAGKVFKGFQEGPITFPPTYKYDSVGTETYD 255 (310)
T ss_pred cccceEEEecCcceeecCC---CHHHHHHHHhhCcHHHHhhhhhHHHHhhcccccCcCccCCcCCCCCeeecCCCCcccc
Confidence 4799999999999999952 23789999999999999999999999999999999999999999999999 9999999
Q ss_pred CC
Q psy5023 81 NK 82 (82)
Q Consensus 81 tk 82 (82)
++
T Consensus 256 ~~ 257 (310)
T smart00128 256 TS 257 (310)
T ss_pred Cc
Confidence 85
No 3
>PLN03191 Type I inositol-1,4,5-trisphosphate 5-phosphatase 2; Provisional
Probab=99.97 E-value=4.7e-31 Score=205.18 Aligned_cols=76 Identities=34% Similarity=0.696 Sum_probs=72.8
Q ss_pred CCCccEEEEeCcCCCccCCCCCCCHHHHHHHHhccChHHHHHhHHHHHHHhhCcccCCcccCCCCCCCCCCCcCCCCCcc
Q psy5023 1 MDKLSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQFNDLLEQDQLRAVMQSGEAFSEFNETTPTFQPTFKYQFNSHNYD 80 (82)
Q Consensus 1 ~~~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~~f~E~~I~F~PTYK~~~~s~~Yd 80 (82)
|.+||+|||+|||||||+ ++.++|+++|..++|..||++|||..+++++.+|.||+|++|+|||||||++||+.||
T Consensus 466 I~dhD~vFWlGDLNYRId----l~~~ev~~lI~~~~~~~LL~~DQL~~e~~~g~vF~GF~Eg~I~FpPTYKYd~gSd~Yd 541 (621)
T PLN03191 466 IPSHDQIFWFGDLNYRLN----MLDTEVRKLVAQKRWDELINSDQLIKELRSGHVFDGWKEGPIKFPPTYKYEINSDRYV 541 (621)
T ss_pred ccccceEEEecCcccccc----CCHHHHHHHHhhccHHHHHHHhHHHHHHHcCCccCCcccCCccCCCCcccccCCcccc
Confidence 357999999999999999 5788999999999999999999999999999999999999999999999999999997
No 4
>COG5411 Phosphatidylinositol 5-phosphate phosphatase [Signal transduction mechanisms]
Probab=99.92 E-value=1.4e-25 Score=169.50 Aligned_cols=78 Identities=35% Similarity=0.715 Sum_probs=71.7
Q ss_pred CCCccEEEEeCcCCCccCCCCCCCHHHHHHHHhccC--hHHHHHhHHHHHHHhhCcccCCcccCCCCCCCCCCCcCCCCC
Q psy5023 1 MDKLSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQ--FNDLLEQDQLRAVMQSGEAFSEFNETTPTFQPTFKYQFNSHN 78 (82)
Q Consensus 1 ~~~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~--~~~Ll~~DQL~~~~~~~~~f~~f~E~~I~F~PTYK~~~~s~~ 78 (82)
|.+||+|||+|||||||.+ +.++++..+...+ +..|+++|||+.+++.+.+|.+|.|..|+|||||||+.|++.
T Consensus 203 I~~hdti~w~GDlNyRVts----~~e~v~~~~~~~~g~~~~l~~~DqL~~e~~~g~~f~~f~E~~i~FpPTYKfd~gt~~ 278 (460)
T COG5411 203 IYDHDTIFWLGDLNYRVTS----TNEEVRPEIASDDGRLDKLFEYDQLLWEMEVGNVFPGFKEPVITFPPTYKFDYGTDE 278 (460)
T ss_pred ecccceEEEecccCceeec----CchhcchhhhCCcchhhhhhhhhhHhhhhcccccccceecccccCCCceEeecCCcc
Confidence 5689999999999999994 6778888887766 788999999999999999999999999999999999999999
Q ss_pred ccCC
Q psy5023 79 YDNK 82 (82)
Q Consensus 79 Ydtk 82 (82)
||++
T Consensus 279 ydts 282 (460)
T COG5411 279 YDTS 282 (460)
T ss_pred cccc
Confidence 9984
No 5
>PTZ00312 inositol-1,4,5-triphosphate 5-phosphatase; Provisional
Probab=99.67 E-value=4.1e-17 Score=119.58 Aligned_cols=70 Identities=21% Similarity=0.380 Sum_probs=53.6
Q ss_pred CCccEEEEeCcCCCccCCCCCCCHHHHHH------HHh------ccChHHHHHhHHHHHHHhh-------------Cccc
Q psy5023 2 DKLSYIFWIGDLNFRLNNPETYTQDIITD------RIR------DGQFNDLLEQDQLRAVMQS-------------GEAF 56 (82)
Q Consensus 2 ~~~d~vfw~GDlNyRi~~~~~l~~~~v~~------~i~------~~~~~~Ll~~DQL~~~~~~-------------~~~f 56 (82)
..++++||+||||||++... ..+.+.. .++ ...|.+|++.|||.++++. .+.+
T Consensus 126 ~~~~~lF~fGDfNyRld~~~--~~e~L~ek~Ql~ve~~~g~~~~P~hf~~Lf~~dQl~rE~~~fd~e~q~l~~~va~~s~ 203 (356)
T PTZ00312 126 SPSDPLFIFGDFNVRLDGHN--LLEWLKEKMQIDVKIEVKRVRAPDRFWELFTNPQTQGEIRRFDLELQRLMDVVAQQSG 203 (356)
T ss_pred CCCCcEEEeccceeeecccc--HHHHhcccccccccccccccCChHHHHHHhcChhhhHHHhhhhhhhhhhhhhhhhhcc
Confidence 46899999999999999632 1111111 111 2468999999999999985 6788
Q ss_pred CCcccCCCCCCCCCCCc
Q psy5023 57 SEFNETTPTFQPTFKYQ 73 (82)
Q Consensus 57 ~~f~E~~I~F~PTYK~~ 73 (82)
.++.|.+|+||||||-.
T Consensus 204 ~eLaE~pI~FpPTYkrv 220 (356)
T PTZ00312 204 VELAEFAIRFPPTYPRV 220 (356)
T ss_pred cchhcccccCCCcchhh
Confidence 89999999999999943
No 6
>KOG0565|consensus
Probab=98.57 E-value=2.1e-08 Score=65.70 Aligned_cols=38 Identities=34% Similarity=0.617 Sum_probs=30.0
Q ss_pred ccEEEEeCcCCCccCCCCCCCHHHHHHHHhccChHHHHHhH
Q psy5023 4 LSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQFNDLLEQD 44 (82)
Q Consensus 4 ~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~~~~Ll~~D 44 (82)
||.|||+||||||+.++ +...+...+....+..|++.|
T Consensus 108 ~D~v~w~GDlN~Rl~~~---~~~~~~~~~~~~~~~~l~~~d 145 (145)
T KOG0565|consen 108 HDTVIWLGDLNYRLSGP---SYLEVRTLISVKSRDGLLEKD 145 (145)
T ss_pred ccEEEEecceeeeecCc---ccccchhhhhhcchhhhhccC
Confidence 79999999999999964 255667777777777777665
No 7
>KOG1976|consensus
Probab=97.55 E-value=7.1e-05 Score=55.92 Aligned_cols=22 Identities=27% Similarity=0.532 Sum_probs=17.5
Q ss_pred ccCC-cccCCCCCCCCCCCcCCC
Q psy5023 55 AFSE-FNETTPTFQPTFKYQFNS 76 (82)
Q Consensus 55 ~f~~-f~E~~I~F~PTYK~~~~s 76 (82)
.|+. ..|..|.|||||-|+.+.
T Consensus 305 nf~~kl~E~~i~FpPsypysed~ 327 (391)
T KOG1976|consen 305 NFAFKLKEETIFFPPSYPYSEDD 327 (391)
T ss_pred HHHHHHhheeecCCCCCCCCcCc
Confidence 4443 789999999999998753
No 8
>KOG3870|consensus
Probab=89.04 E-value=0.15 Score=39.36 Aligned_cols=17 Identities=41% Similarity=0.772 Sum_probs=14.6
Q ss_pred CCCccEEEEeCcCCCcc
Q psy5023 1 MDKLSYIFWIGDLNFRL 17 (82)
Q Consensus 1 ~~~~d~vfw~GDlNyRi 17 (82)
|..++.||+=||||||=
T Consensus 349 L~~S~LvIFKGDLNYRK 365 (434)
T KOG3870|consen 349 LQKSSLVIFKGDLNYRK 365 (434)
T ss_pred HhhCcEEEEeccccHHH
Confidence 35689999999999994
No 9
>PF03372 Exo_endo_phos: Endonuclease/Exonuclease/phosphatase family Subset of Pfam family Subset of Pfam family; InterPro: IPR005135 This domain is found in a large number of proteins including magnesium dependent endonucleases and phosphatases involved in intracellular signalling []. Proteins this domain is found in include: AP endonuclease proteins (4.2.99.18 from EC), DNase I proteins (3.1.21.1 from EC), Synaptojanin an inositol-1,4,5-trisphosphate phosphatase (3.1.3.56 from EC) and Sphingomyelinase (3.1.4.12 from EC).; PDB: 2J63_A 2JC4_A 3TEB_B 3MTC_A 3N9V_B 1ZWX_A 2F1N_A 1Y21_A 1NTF_A 2IMQ_X ....
Probab=83.48 E-value=0.64 Score=30.28 Aligned_cols=14 Identities=29% Similarity=0.494 Sum_probs=10.4
Q ss_pred EEEEeCcCCCccCC
Q psy5023 6 YIFWIGDLNFRLNN 19 (82)
Q Consensus 6 ~vfw~GDlNyRi~~ 19 (82)
.++++||||.+...
T Consensus 158 ~~iv~GDfN~~~~~ 171 (249)
T PF03372_consen 158 PVIVMGDFNSRPDS 171 (249)
T ss_dssp EEEEEEE-SS-BSS
T ss_pred eEEEEeecccCCcc
Confidence 59999999999883
No 10
>COG3568 ElsH Metal-dependent hydrolase [General function prediction only]
Probab=72.56 E-value=1.9 Score=31.41 Aligned_cols=15 Identities=33% Similarity=0.614 Sum_probs=12.0
Q ss_pred EEEEeCcCC-------CccCCC
Q psy5023 6 YIFWIGDLN-------FRLNNP 20 (82)
Q Consensus 6 ~vfw~GDlN-------yRi~~~ 20 (82)
.+++||||| ||+-..
T Consensus 166 p~vl~GDFN~~p~s~~yr~~~~ 187 (259)
T COG3568 166 PTVLMGDFNNEPGSAEYRLAAR 187 (259)
T ss_pred ceEEEccCCCCCCCccceeccC
Confidence 689999999 776643
No 11
>PRK11756 exonuclease III; Provisional
Probab=68.01 E-value=2.6 Score=29.52 Aligned_cols=15 Identities=20% Similarity=0.361 Sum_probs=11.2
Q ss_pred ccEEEEeCcCCCccC
Q psy5023 4 LSYIFWIGDLNFRLN 18 (82)
Q Consensus 4 ~d~vfw~GDlNyRi~ 18 (82)
..-++++||||--.+
T Consensus 143 ~~pvIl~GDfN~~~~ 157 (268)
T PRK11756 143 DNPLLIMGDMNISPT 157 (268)
T ss_pred CCCEEEEeecccCCC
Confidence 346999999996443
No 12
>PF14529 Exo_endo_phos_2: Endonuclease-reverse transcriptase ; PDB: 2EI9_A 1WDU_B.
Probab=66.92 E-value=2.4 Score=25.43 Aligned_cols=13 Identities=31% Similarity=0.212 Sum_probs=7.0
Q ss_pred EEEEeCcCCCccC
Q psy5023 6 YIFWIGDLNFRLN 18 (82)
Q Consensus 6 ~vfw~GDlNyRi~ 18 (82)
.++++||||-...
T Consensus 32 ~~Ii~GDFN~~~~ 44 (119)
T PF14529_consen 32 PIIIGGDFNAHHP 44 (119)
T ss_dssp SEEEEEE-----G
T ss_pred CEEEEeECCCCch
Confidence 7899999999655
No 13
>TIGR00195 exoDNase_III exodeoxyribonuclease III. The model brings in reverse transcriptases at scores below 50, model also contains eukaryotic apurinic/apyrimidinic endonucleases which group in the same family
Probab=64.48 E-value=3.3 Score=28.67 Aligned_cols=14 Identities=21% Similarity=0.375 Sum_probs=11.2
Q ss_pred cEEEEeCcCCCccC
Q psy5023 5 SYIFWIGDLNFRLN 18 (82)
Q Consensus 5 d~vfw~GDlNyRi~ 18 (82)
.-|+++||||-...
T Consensus 139 ~pvIi~GDfN~~~~ 152 (254)
T TIGR00195 139 KPVLICGDMNIAPT 152 (254)
T ss_pred CcEEEEeecccCCC
Confidence 46999999996554
No 14
>PF01937 DUF89: Protein of unknown function DUF89; InterPro: IPR002791 This entry contains uncharacterised proteins. Those with structural information consist of two domains: an all-alpha domain with a 3-helical bundle fold, and an alpha-beta domain in 3 layers, alpha/beta/alpha. ; PDB: 2FFJ_B 1XFI_A 2Q40_A 2G8L_B 3PT1_A.
Probab=62.41 E-value=1.4 Score=32.84 Aligned_cols=17 Identities=29% Similarity=0.597 Sum_probs=14.1
Q ss_pred CCccEEEEeCcCCCccC
Q psy5023 2 DKLSYIFWIGDLNFRLN 18 (82)
Q Consensus 2 ~~~d~vfw~GDlNyRi~ 18 (82)
.++|.|+.=||+|||-=
T Consensus 294 ~~adLVI~KG~~Nyr~L 310 (355)
T PF01937_consen 294 SEADLVIFKGDLNYRKL 310 (355)
T ss_dssp CC-SEEEEEHHHHHHHH
T ss_pred hhCCEEEEeCCHHHhhh
Confidence 57999999999999954
No 15
>PRK13911 exodeoxyribonuclease III; Provisional
Probab=60.90 E-value=4.6 Score=28.67 Aligned_cols=14 Identities=36% Similarity=0.427 Sum_probs=11.0
Q ss_pred cEEEEeCcCCCccC
Q psy5023 5 SYIFWIGDLNFRLN 18 (82)
Q Consensus 5 d~vfw~GDlNyRi~ 18 (82)
..++|+||||=..+
T Consensus 137 ~~~Ii~GD~Nva~~ 150 (250)
T PRK13911 137 KPVIVCGDLNVAHN 150 (250)
T ss_pred CCEEEEccccCCCC
Confidence 47899999995544
No 16
>PF10515 APP_amyloid: beta-amyloid precursor protein C-terminus; InterPro: IPR019543 This is the amyloid, C-terminal, protein of the beta-Amyloid precursor protein (APP) which is a conserved and ubiquitous transmembrane glycoprotein strongly implicated in the pathogenesis of Alzheimer's disease but whose normal biological function is unknown. The C-terminal 100 residues are released and aggregate into amyloid deposits which are strongly implicated in the pathology of Alzheimer's disease plaque-formation. The domain is associated with IPR008154 from INTERPRO, further towards the N terminus. ; PDB: 2ROZ_A 3DXD_D 1X11_D 2LP1_A 2LOH_A 3MXC_L 3MXY_L 3DXC_B 3DXE_D 3L81_B ....
Probab=60.68 E-value=2.2 Score=23.99 Aligned_cols=7 Identities=57% Similarity=1.156 Sum_probs=5.2
Q ss_pred CCCCCCc
Q psy5023 67 QPTFKYQ 73 (82)
Q Consensus 67 ~PTYK~~ 73 (82)
-|||||-
T Consensus 45 NPTYkyf 51 (52)
T PF10515_consen 45 NPTYKYF 51 (52)
T ss_dssp SCTCHHC
T ss_pred CCceecc
Confidence 4899973
No 17
>cd08164 MPP_Ted1 Saccharomyces cerevisiae Ted1 and related proteins, metallophosphatase domain. Saccharomyces cerevisiae Ted1 (trafficking of Emp24p/Erv25p-dependent cargo disrupted 1) is a metallophosphatase domain-containing protein which acts together with Emp24p and Erv25p in cargo exit from the ER. Ted1 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the
Probab=55.32 E-value=7.1 Score=27.16 Aligned_cols=10 Identities=30% Similarity=0.491 Sum_probs=9.1
Q ss_pred ccEEEEeCcC
Q psy5023 4 LSYIFWIGDL 13 (82)
Q Consensus 4 ~d~vfw~GDl 13 (82)
=|+|+++|||
T Consensus 45 Pd~V~fLGDL 54 (193)
T cd08164 45 PDAVVVLGDL 54 (193)
T ss_pred CCEEEEeccc
Confidence 4899999999
No 18
>cd08166 MPP_Cdc1_like_1 uncharacterized subgroup related to Saccharomyces cerevisiae CDC1, metallophosphatase domain. A functionally uncharacterized subgroup related to the metallophosphatase domain of Saccharomyces cerevisiae Cdc1, S. cerevisiae Ted1 and human MPPE1. Cdc1 is an endoplasmic reticulum-localized transmembrane lipid phosphatase and is a subunit of DNA polymerase delta. TED1 (trafficking of Emp24p/Erv25p-dependent cargo disrupted 1), acts together with Emp24p and Erv25p in cargo exit from the ER. The MPPE1 gene is a candidate susceptibility gene for Bipolar disorder. Proteins in this uncharacterized subgroup belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like R
Probab=54.34 E-value=21 Score=24.83 Aligned_cols=16 Identities=19% Similarity=0.611 Sum_probs=12.7
Q ss_pred CccEEEEeCcCCCccCCCC
Q psy5023 3 KLSYIFWIGDLNFRLNNPE 21 (82)
Q Consensus 3 ~~d~vfw~GDlNyRi~~~~ 21 (82)
+-|.||++||| ++...
T Consensus 42 ~PD~Vi~lGDL---~D~G~ 57 (195)
T cd08166 42 QPDIVIFLGDL---MDEGS 57 (195)
T ss_pred CCCEEEEeccc---cCCCC
Confidence 46899999999 77543
No 19
>TIGR03395 sphingomy sphingomyelin phosphodiesterase. Members of this family are bacterial proteins that act as sphingomyelin phosphodiesterase (EC 3.1.4.12), also called sphingomyelinase. Some members of this family have been shown to act as hemolysins.
Probab=54.02 E-value=8.9 Score=27.68 Aligned_cols=14 Identities=29% Similarity=0.356 Sum_probs=11.2
Q ss_pred cEEEEeCcCCCccC
Q psy5023 5 SYIFWIGDLNFRLN 18 (82)
Q Consensus 5 d~vfw~GDlNyRi~ 18 (82)
.-||++||||-.-.
T Consensus 178 ~pvIl~GDfN~~~~ 191 (283)
T TIGR03395 178 ETVLIGGDLNVNKG 191 (283)
T ss_pred ceEEEEeeCCCCCC
Confidence 45899999997654
No 20
>smart00476 DNaseIc deoxyribonuclease I. Deoxyribonuclease I catalyzes the endonucleolytic cleavage of double-stranded DNA. The enzyme is secreted outside the cell and also involved in apoptosis in the nucleus.
Probab=53.37 E-value=7.3 Score=28.40 Aligned_cols=14 Identities=21% Similarity=0.496 Sum_probs=11.2
Q ss_pred cEEEEeCcCCCccC
Q psy5023 5 SYIFWIGDLNFRLN 18 (82)
Q Consensus 5 d~vfw~GDlNyRi~ 18 (82)
+-|+++||||=-.+
T Consensus 177 ~~villGDFNa~~~ 190 (276)
T smart00476 177 EDVIFMGDFNAGCS 190 (276)
T ss_pred CCEEEEccCCCCCC
Confidence 45899999998654
No 21
>TIGR00633 xth exodeoxyribonuclease III (xth). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=53.36 E-value=6.7 Score=26.70 Aligned_cols=15 Identities=20% Similarity=0.220 Sum_probs=11.6
Q ss_pred ccEEEEeCcCCCccC
Q psy5023 4 LSYIFWIGDLNFRLN 18 (82)
Q Consensus 4 ~d~vfw~GDlNyRi~ 18 (82)
..-++++||||-...
T Consensus 141 ~~~~Il~GDFN~~~~ 155 (255)
T TIGR00633 141 GKPVIICGDMNVAHT 155 (255)
T ss_pred CCcEEEEeecccCCC
Confidence 357899999996554
No 22
>KOG3873|consensus
Probab=52.82 E-value=11 Score=29.35 Aligned_cols=17 Identities=24% Similarity=0.454 Sum_probs=14.6
Q ss_pred CCccEEEEeCcCCCccC
Q psy5023 2 DKLSYIFWIGDLNFRLN 18 (82)
Q Consensus 2 ~~~d~vfw~GDlNyRi~ 18 (82)
...|.|+..||||-+-.
T Consensus 168 q~~~vVI~~GDLN~~P~ 184 (422)
T KOG3873|consen 168 QNADVVILAGDLNMQPQ 184 (422)
T ss_pred cCCcEEEEecCCCCCcc
Confidence 35799999999998866
No 23
>PRK05421 hypothetical protein; Provisional
Probab=52.21 E-value=7.8 Score=27.38 Aligned_cols=10 Identities=30% Similarity=0.481 Sum_probs=8.6
Q ss_pred EEEEeCcCCC
Q psy5023 6 YIFWIGDLNF 15 (82)
Q Consensus 6 ~vfw~GDlNy 15 (82)
-++++||||=
T Consensus 184 p~Il~GDFN~ 193 (263)
T PRK05421 184 PVILAGDFNT 193 (263)
T ss_pred CEEEEccccc
Confidence 5899999993
No 24
>KOG3662|consensus
Probab=51.23 E-value=21 Score=27.80 Aligned_cols=37 Identities=19% Similarity=0.464 Sum_probs=23.4
Q ss_pred CccEEEEeCcCCCccCCCCCCCHHHHHHHHhccChHHHHHhH
Q psy5023 3 KLSYIFWIGDLNFRLNNPETYTQDIITDRIRDGQFNDLLEQD 44 (82)
Q Consensus 3 ~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~~~~~Ll~~D 44 (82)
+=|++|++||| .+...-++.++-.+-.+. ++.++..+
T Consensus 93 kPdvvffLGDL---fDeG~~~~~eEf~~~~~R--fkkIf~~k 129 (410)
T KOG3662|consen 93 KPDVVFFLGDL---FDEGQWAGDEEFKKRYER--FKKIFGRK 129 (410)
T ss_pred CCCEEEEeccc---cccCccCChHHHHHHHHH--HHHhhCCC
Confidence 34899999999 774433566665555432 55555544
No 25
>PRK11439 pphA serine/threonine protein phosphatase 1; Provisional
Probab=49.51 E-value=20 Score=24.58 Aligned_cols=28 Identities=11% Similarity=0.139 Sum_probs=19.5
Q ss_pred CccEEEEeCcCCCccCCCCCCCHHHHHHHHhcc
Q psy5023 3 KLSYIFWIGDLNFRLNNPETYTQDIITDRIRDG 35 (82)
Q Consensus 3 ~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~ 35 (82)
..|.++.+||+ |+-.. ...+|++++.+.
T Consensus 44 ~~D~li~lGDl---vDrGp--~s~~vl~~l~~~ 71 (218)
T PRK11439 44 WRDLLISVGDL---IDRGP--QSLRCLQLLEEH 71 (218)
T ss_pred ccCEEEEcCcc---cCCCc--CHHHHHHHHHcC
Confidence 46899999999 76332 455677776653
No 26
>PF00149 Metallophos: Calcineurin-like phosphoesterase; InterPro: IPR004843 This domain is found in a diverse range of phosphoesterases [], including protein phosphoserine phosphatases, nucleotidases, sphingomyelin phosphodiesterases and 2'-3' cAMP phosphodiesterases, as well as nucleases such as bacterial SbcD or yeast MRE11. The most conserved regions in this domain centre around the metal chelating residues.; GO: 0016787 hydrolase activity; PDB: 2IAE_C 3DW8_F 3FGA_C 2IE4_C 2NYM_C 2NYL_C 3K7V_C 2NPP_C 2IE3_C 3K7W_C ....
Probab=48.69 E-value=15 Score=21.64 Aligned_cols=16 Identities=38% Similarity=0.519 Sum_probs=12.4
Q ss_pred CccEEEEeCcCCCccC
Q psy5023 3 KLSYIFWIGDLNFRLN 18 (82)
Q Consensus 3 ~~d~vfw~GDlNyRi~ 18 (82)
+.|.|++.||+=.+-.
T Consensus 31 ~~d~ii~~GD~~~~~~ 46 (200)
T PF00149_consen 31 KPDFIIFLGDLVDGGN 46 (200)
T ss_dssp TTSEEEEESTSSSSSS
T ss_pred CCCEEEeecccccccc
Confidence 5799999999944444
No 27
>KOG2756|consensus
Probab=37.34 E-value=18 Score=27.28 Aligned_cols=15 Identities=27% Similarity=0.448 Sum_probs=12.4
Q ss_pred cEEEEeCcCCCccCC
Q psy5023 5 SYIFWIGDLNFRLNN 19 (82)
Q Consensus 5 d~vfw~GDlNyRi~~ 19 (82)
-.||+-||+|.|=..
T Consensus 244 A~ViFGGD~NlrD~e 258 (349)
T KOG2756|consen 244 ATVIFGGDTNLRDRE 258 (349)
T ss_pred ceEEEcCcccchhhh
Confidence 468999999999664
No 28
>cd00838 MPP_superfamily metallophosphatase superfamily, metallophosphatase domain. Metallophosphatases (MPPs), also known as metallophosphoesterases, phosphodiesterases (PDEs), binuclear metallophosphoesterases, and dimetal-containing phosphoesterases (DMPs), represent a diverse superfamily of enzymes with a conserved domain containing an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. This superfamily includes: the phosphoprotein phosphatases (PPPs), Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive me
Probab=35.97 E-value=30 Score=20.05 Aligned_cols=16 Identities=25% Similarity=0.295 Sum_probs=13.3
Q ss_pred CccEEEEeCcCCCccC
Q psy5023 3 KLSYIFWIGDLNFRLN 18 (82)
Q Consensus 3 ~~d~vfw~GDlNyRi~ 18 (82)
+.|.|+++||+-..-.
T Consensus 26 ~~~~vi~~GD~~~~~~ 41 (131)
T cd00838 26 KPDFVLVLGDLVGDGP 41 (131)
T ss_pred CCCEEEECCcccCCCC
Confidence 5689999999977666
No 29
>PRK15251 cytolethal distending toxin subunit CdtB; Provisional
Probab=35.44 E-value=21 Score=26.23 Aligned_cols=9 Identities=33% Similarity=0.479 Sum_probs=7.8
Q ss_pred EEEEeCcCC
Q psy5023 6 YIFWIGDLN 14 (82)
Q Consensus 6 ~vfw~GDlN 14 (82)
=++++||||
T Consensus 186 pw~I~GDFN 194 (271)
T PRK15251 186 NWMIAGDFN 194 (271)
T ss_pred CEEEeccCC
Confidence 478999999
No 30
>PRK09968 serine/threonine-specific protein phosphatase 2; Provisional
Probab=34.92 E-value=41 Score=23.15 Aligned_cols=27 Identities=7% Similarity=0.151 Sum_probs=17.3
Q ss_pred CccEEEEeCcCCCccCCCCCCCHHHHHHHHhc
Q psy5023 3 KLSYIFWIGDLNFRLNNPETYTQDIITDRIRD 34 (82)
Q Consensus 3 ~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~~ 34 (82)
+.|.+|.+||+ ++-.. ...++++.+..
T Consensus 42 ~~d~l~~lGD~---vdrG~--~~~~~l~~l~~ 68 (218)
T PRK09968 42 ETDLLISVGDN---IDRGP--ESLNVLRLLNQ 68 (218)
T ss_pred CCCEEEECCCC---cCCCc--CHHHHHHHHhh
Confidence 57999999999 55221 33456666544
No 31
>COG0708 XthA Exonuclease III [DNA replication, recombination, and repair]
Probab=34.65 E-value=21 Score=26.04 Aligned_cols=13 Identities=23% Similarity=0.350 Sum_probs=10.1
Q ss_pred cEEEEeCcCCCcc
Q psy5023 5 SYIFWIGDLNFRL 17 (82)
Q Consensus 5 d~vfw~GDlNyRi 17 (82)
--++++||+|=.-
T Consensus 141 ~~~vl~GD~NIap 153 (261)
T COG0708 141 KPVVLCGDFNIAP 153 (261)
T ss_pred CCEEEecccccCC
Confidence 4689999999543
No 32
>cd00842 MPP_ASMase acid sphingomyelinase and related proteins, metallophosphatase domain. Acid sphingomyelinase (ASMase) is a ubiquitously expressed phosphodiesterase which hydrolyzes sphingomyelin in acid pH conditions to form ceramide, a bioactive second messenger, as part of the sphingomyelin signaling pathway. ASMase is localized at the noncytosolic leaflet of biomembranes (for example the luminal leaflet of endosomes, lysosomes and phagosomes, and the extracellular leaflet of plasma membranes). ASMase-deficient humans develop Niemann-Pick disease. This disease is characterized by lysosomal storage of sphingomyelin in all tissues. Although ASMase-deficient mice are resistant to stress-induced apoptosis, they have greater susceptibility to bacterial infection. The latter correlates with defective phagolysosomal fusion and antibacterial killing activity in ASMase-deficient macrophages. ASMase belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but
Probab=34.61 E-value=27 Score=24.73 Aligned_cols=14 Identities=43% Similarity=0.871 Sum_probs=11.4
Q ss_pred CccEEEEeCcCCCc
Q psy5023 3 KLSYIFWIGDLNFR 16 (82)
Q Consensus 3 ~~d~vfw~GDlNyR 16 (82)
+.|.|+|.||+=..
T Consensus 68 ~~dfii~tGD~v~h 81 (296)
T cd00842 68 KPDFILWTGDLVRH 81 (296)
T ss_pred CCCEEEEcCCCCCC
Confidence 67999999999433
No 33
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain. 239FB (Fetal brain protein 239) is thought to play a role in central nervous system development, but its specific role in unknown. 239FB is expressed predominantly in human fetal brain from a gene located in the chromosome 11p13 region associated with the mental retardation component of the WAGR (Wilms tumor, Aniridia, Genitourinary anomalies, Mental retardation) syndrome. Orthologous brp-like (brain protein 239-like) proteins have been identified in the invertebrate amphioxus group and in vertebrates. 239FB belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzyme
Probab=33.40 E-value=32 Score=21.39 Aligned_cols=14 Identities=21% Similarity=0.214 Sum_probs=11.5
Q ss_pred CCccEEEEeCcCCC
Q psy5023 2 DKLSYIFWIGDLNF 15 (82)
Q Consensus 2 ~~~d~vfw~GDlNy 15 (82)
.+.|.|+.+||+-.
T Consensus 18 ~~~D~vi~~GD~~~ 31 (135)
T cd07379 18 PDGDVLIHAGDLTE 31 (135)
T ss_pred CCCCEEEECCCCCC
Confidence 46799999999843
No 34
>cd07390 MPP_AQ1575 Aquifex aeolicus AQ1575 and related proteins, metallophosphatase domain. This family includes bacterial and archeal proteins homologous to AQ1575, an uncharacterized Aquifex aeolicus protein. AQ1575 may play an accessory role in DNA repair, based on the close proximity of its gene to Holliday junction resolvasome genes. The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a d
Probab=33.14 E-value=34 Score=22.37 Aligned_cols=16 Identities=19% Similarity=0.420 Sum_probs=12.5
Q ss_pred CCccEEEEeCcCCCcc
Q psy5023 2 DKLSYIFWIGDLNFRL 17 (82)
Q Consensus 2 ~~~d~vfw~GDlNyRi 17 (82)
.+.|.|+.+||+=.+-
T Consensus 41 ~~~d~vi~~GDl~~~~ 56 (168)
T cd07390 41 GPDDTVYHLGDFSFGG 56 (168)
T ss_pred CCCCEEEEeCCCCCCC
Confidence 4579999999995543
No 35
>PLN03144 Carbon catabolite repressor protein 4 homolog; Provisional
Probab=30.46 E-value=27 Score=28.41 Aligned_cols=23 Identities=17% Similarity=0.122 Sum_probs=15.0
Q ss_pred EEEEeCcCCCccCCCCCCCHHHHHHHHhcc
Q psy5023 6 YIFWIGDLNFRLNNPETYTQDIITDRIRDG 35 (82)
Q Consensus 6 ~vfw~GDlNyRi~~~~~l~~~~v~~~i~~~ 35 (82)
-|+++||||---+ ..+-+++..|
T Consensus 457 PvIlcGDFNS~P~-------S~vy~lLt~G 479 (606)
T PLN03144 457 PMLVCGDFNSVPG-------SAPHCLLATG 479 (606)
T ss_pred ceEEeccCCCCCC-------ChhhhhhhcC
Confidence 4899999996443 3455555554
No 36
>cd07423 MPP_PrpE Bacillus subtilis PrpE and related proteins, metallophosphatase domain. PrpE (protein phosphatase E) is a bacterial member of the PPP (phosphoprotein phosphatase) family of serine/threonine phosphatases and a key signal transduction pathway component controlling the expression of spore germination receptors GerA and GerK in Bacillus subtilis. PrpE is closely related to ApaH (also known symmetrical Ap(4)A hydrolase and bis(5'nucleosyl)-tetraphosphatase). PrpE has specificity for phosphotyrosine only, unlike the serine/threonine phosphatases to which it is related. The Bacilli members of this family are single domain proteins while the other members have N- and C-terminal domains in addition to this phosphatase domain. The PPP (phosphoprotein phosphatase) family, to which PrpE belongs, is one of two known protein phosphatase families specific for serine and threonine. The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpA/Prp
Probab=29.91 E-value=89 Score=21.53 Aligned_cols=24 Identities=13% Similarity=0.228 Sum_probs=16.1
Q ss_pred ccEEEEeCcCCCccCCCCCCCHHHHHHHH
Q psy5023 4 LSYIFWIGDLNFRLNNPETYTQDIITDRI 32 (82)
Q Consensus 4 ~d~vfw~GDlNyRi~~~~~l~~~~v~~~i 32 (82)
.|.++++||+ |+... ...+|++.+
T Consensus 38 ~d~lv~lGDl---IDrG~--~s~evl~~l 61 (234)
T cd07423 38 GRRAVFVGDL---VDRGP--DSPEVLRLV 61 (234)
T ss_pred CCEEEEECCc---cCCCC--CHHHHHHHH
Confidence 5899999999 66332 344555554
No 37
>PF09222 Fim-adh_lectin: Fimbrial adhesin F17-AG, lectin domain; InterPro: IPR015303 This entry represents the carbohydrate-specific lectin domain found in bacterial fimbrial adhesins. It adopts a compact, elongated structure consisting of a beta-sandwich with two major sheets: one consisting of five long strands in mixed orientations, and a front sheet with four antiparallel strands, forming an immunoglobin-like fold []. ; GO: 0044406 adhesion to host, 0009289 pilus; PDB: 3F64_A 1O9Z_A 3F6J_A 1ZPL_A 1O9V_A 1O9W_A 2BSC_A 1ZK5_A 2BS8_A 2BS7_1 ....
Probab=29.51 E-value=33 Score=23.50 Aligned_cols=13 Identities=31% Similarity=0.961 Sum_probs=10.5
Q ss_pred ccEEEEeCcCCCc
Q psy5023 4 LSYIFWIGDLNFR 16 (82)
Q Consensus 4 ~d~vfw~GDlNyR 16 (82)
--.++|+||-||-
T Consensus 79 iGilV~~GDt~ys 91 (171)
T PF09222_consen 79 IGILVWAGDTNYS 91 (171)
T ss_dssp EEEEEEEESSSGG
T ss_pred eEEEEEeCCcCcc
Confidence 3478999999983
No 38
>cd07400 MPP_YydB Bacillus subtilis YydB and related proteins, metallophosphatase domain. YydB (BSU40220) is an uncharacterized Bacillus subtilis protein that belongs to the following Bacillus subtilis gene cluster yydB-yydC-yydD-yydG-yydH-yydI-yydJ. YydB belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productiv
Probab=29.22 E-value=38 Score=20.97 Aligned_cols=13 Identities=23% Similarity=0.327 Sum_probs=10.7
Q ss_pred CccEEEEeCcCCC
Q psy5023 3 KLSYIFWIGDLNF 15 (82)
Q Consensus 3 ~~d~vfw~GDlNy 15 (82)
..|.|+.+||+=.
T Consensus 35 ~~d~vi~~GDl~~ 47 (144)
T cd07400 35 DPDLVVITGDLTQ 47 (144)
T ss_pred CCCEEEECCCCCC
Confidence 5699999999933
No 39
>cd07404 MPP_MS158 Microscilla MS158 and related proteins, metallophosphatase domain. MS158 is an uncharacterized Microscilla protein with a metallophosphatase domain. Microscilla proteins MS152, and MS153 are also included in this family. The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is t
Probab=29.09 E-value=39 Score=21.63 Aligned_cols=15 Identities=13% Similarity=0.383 Sum_probs=11.8
Q ss_pred CCccEEEEeCcCCCc
Q psy5023 2 DKLSYIFWIGDLNFR 16 (82)
Q Consensus 2 ~~~d~vfw~GDlNyR 16 (82)
.+.|.|+++||+-.+
T Consensus 25 ~~~d~li~~GDi~~~ 39 (166)
T cd07404 25 PDADILVLAGDIGYL 39 (166)
T ss_pred CCCCEEEECCCCCCC
Confidence 357999999999543
No 40
>cd07384 MPP_Cdc1_like Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain. Cdc1 (also known as XlCdc1 in Xenopus laevis) is an endoplasmic reticulum-localized transmembrane lipid phosphatase with a metallophosphatase domain facing the ER lumen. In budding yeast, the gene encoding CDC1 is essential while nonlethal mutations cause defects in Golgi inheritance and actin polarization. Cdc1 mutant cells accumulate an unidentified phospholipid, suggesting that Cdc1 is a lipid phosphatase. Cdc1 mutant cells also have highly elevated intracellular calcium levels suggesting a possible role for Cdc1 in calcium regulation. The 5' flanking region of Cdc1 is a regulatory region with conserved binding site motifs for AP1, AP2, Sp1, NF-1 and CREB. DNA polymerase delta consists of at least four subunits - Pol3, Cdc1, Cdc27, and Cdm1. This group also contains Saccharomyces cerevisiae TED1 (Trafficking of Emp24p/Erv25p-dependent cargo disrupted 1), which acts together wit
Probab=28.01 E-value=40 Score=22.34 Aligned_cols=11 Identities=36% Similarity=0.821 Sum_probs=9.9
Q ss_pred CccEEEEeCcC
Q psy5023 3 KLSYIFWIGDL 13 (82)
Q Consensus 3 ~~d~vfw~GDl 13 (82)
+.|.|+++|||
T Consensus 45 ~pd~vi~lGDl 55 (171)
T cd07384 45 KPDVVLFLGDL 55 (171)
T ss_pred CCCEEEEeccc
Confidence 56899999999
No 41
>KOG2338|consensus
Probab=27.99 E-value=30 Score=27.59 Aligned_cols=13 Identities=38% Similarity=0.547 Sum_probs=10.1
Q ss_pred EEEEeCcCCCccC
Q psy5023 6 YIFWIGDLNFRLN 18 (82)
Q Consensus 6 ~vfw~GDlNyRi~ 18 (82)
.||++||||=-=+
T Consensus 294 pi~l~GDfNt~p~ 306 (495)
T KOG2338|consen 294 PIFLCGDFNTEPD 306 (495)
T ss_pred CeEEecCCCCCCC
Confidence 7999999995433
No 42
>COG3021 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.97 E-value=31 Score=25.88 Aligned_cols=9 Identities=33% Similarity=0.645 Sum_probs=8.0
Q ss_pred EEEeCcCCC
Q psy5023 7 IFWIGDLNF 15 (82)
Q Consensus 7 vfw~GDlNy 15 (82)
|++.||||=
T Consensus 225 vIlaGDfNa 233 (309)
T COG3021 225 VILAGDFNA 233 (309)
T ss_pred eEEeecCCC
Confidence 789999986
No 43
>COG4531 ZnuA ABC-type Zn2+ transport system, periplasmic component/surface adhesin [Inorganic ion transport and metabolism]
Probab=27.18 E-value=35 Score=25.59 Aligned_cols=11 Identities=18% Similarity=0.915 Sum_probs=7.7
Q ss_pred CCCccEEEEeC
Q psy5023 1 MDKLSYIFWIG 11 (82)
Q Consensus 1 ~~~~d~vfw~G 11 (82)
|..+|.|||+|
T Consensus 73 lq~Adlv~WvG 83 (318)
T COG4531 73 LQSADLVVWVG 83 (318)
T ss_pred hhcCCEEEEEC
Confidence 34567788877
No 44
>cd07393 MPP_DR1119 Deinococcus radiodurans DR1119 and related proteins, metallophosphatase domain. DR1119 is an uncharacterized Deinococcus radiodurans protein with a metallophosphatase domain. The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordinat
Probab=25.58 E-value=50 Score=22.74 Aligned_cols=15 Identities=13% Similarity=0.330 Sum_probs=12.1
Q ss_pred CCccEEEEeCcCCCc
Q psy5023 2 DKLSYIFWIGDLNFR 16 (82)
Q Consensus 2 ~~~d~vfw~GDlNyR 16 (82)
.+.|.|++.|||-.+
T Consensus 40 ~~~D~viiaGDl~~~ 54 (232)
T cd07393 40 APEDIVLIPGDISWA 54 (232)
T ss_pred CCCCEEEEcCCCccC
Confidence 367999999999643
No 45
>cd07395 MPP_CSTP1 Homo sapiens CSTP1 and related proteins, metallophosphatase domain. CSTP1 (complete S-transactivated protein 1) is an uncharacterized Homo sapiens protein with a metallophosphatase domain, that is transactivated by the complete S protein of hepatitis B virus. CSTP1 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is th
Probab=24.96 E-value=52 Score=22.77 Aligned_cols=11 Identities=36% Similarity=0.634 Sum_probs=9.9
Q ss_pred CccEEEEeCcC
Q psy5023 3 KLSYIFWIGDL 13 (82)
Q Consensus 3 ~~d~vfw~GDl 13 (82)
+.|.|++.|||
T Consensus 49 ~pd~ii~~GDl 59 (262)
T cd07395 49 KPKFVVVCGDL 59 (262)
T ss_pred CCCEEEEeCCc
Confidence 56999999999
No 46
>cd00841 MPP_YfcE Escherichia coli YfcE and related proteins, metallophosphatase domain. YfcE is a manganase-dependent metallophosphatase, found in bacteria and archaea, that cleaves bis-p-nitrophenyl phosphate, thymidine 5'-monophosphate-p-nitrophenyl ester, and p-nitrophenyl phosphorylcholine, but is unable to hydrolyze 2',3 ' or 3',5' cyclic nucleic phosphodiesters, and various phosphomonoesters, including p-nitrophenyl phosphate. This family also includes the Bacilus subtilis YsnB and Methanococcus jannaschii MJ0936 proteins. This domain family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid ph
Probab=24.70 E-value=49 Score=20.79 Aligned_cols=16 Identities=19% Similarity=0.318 Sum_probs=12.0
Q ss_pred CccEEEEeCcCCCccC
Q psy5023 3 KLSYIFWIGDLNFRLN 18 (82)
Q Consensus 3 ~~d~vfw~GDlNyRi~ 18 (82)
+.|.|+.+||+-.+-.
T Consensus 24 ~~d~ii~~GD~~~~~~ 39 (155)
T cd00841 24 DVDLIIHAGDVLYPGP 39 (155)
T ss_pred CCCEEEECCccccccc
Confidence 4799999999855443
No 47
>cd07952 ED_3B_like Uncharacterized class III extradiol dioxygenases. This subfamily is composed of proteins of unknown function with similarity to the catalytic B subunit of class III extradiol dioxygenases. Class III extradiol dioxygenases use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. They play key roles in the degradation of aromatic compounds.
Probab=24.30 E-value=1.2e+02 Score=21.37 Aligned_cols=42 Identities=19% Similarity=0.230 Sum_probs=29.5
Q ss_pred EEEEeCcCCCccCCCCC-----CC---HHHHHHHHhccChHHHHHhHHHH
Q psy5023 6 YIFWIGDLNFRLNNPET-----YT---QDIITDRIRDGQFNDLLEQDQLR 47 (82)
Q Consensus 6 ~vfw~GDlNyRi~~~~~-----l~---~~~v~~~i~~~~~~~Ll~~DQL~ 47 (82)
.|+-.|||+-++....+ .. .+.+++.|..+++..|++.++..
T Consensus 163 liIaSGdlSH~l~~~~p~~~~~~a~~fD~~~~~~l~~~d~~~l~~~~~~~ 212 (256)
T cd07952 163 AVIISADHAHTHDPDGPYGYSPDAAEYDAAIVEAIENNDFEALLELDDEL 212 (256)
T ss_pred EEEEecCccccCCCCCCCCCCcchHHHHHHHHHHHHcCCHHHHHhCCHHH
Confidence 57789999999872211 11 13566778999999999886643
No 48
>PF12850 Metallophos_2: Calcineurin-like phosphoesterase superfamily domain; InterPro: IPR024654 Domains in this entry are members of the calcineurin-like phosphoesterase domain superfamily [].; PDB: 2GJU_A 1Z2W_A 1Z2X_B 3PSO_B 3PSN_B 1W24_A 2R17_B 3QFN_B 3QFO_A 3QFM_A ....
Probab=22.83 E-value=65 Score=19.81 Aligned_cols=12 Identities=17% Similarity=0.720 Sum_probs=9.2
Q ss_pred CCccEEEEeCcC
Q psy5023 2 DKLSYIFWIGDL 13 (82)
Q Consensus 2 ~~~d~vfw~GDl 13 (82)
.+.|.|+.+||+
T Consensus 24 ~~~d~vi~~GDi 35 (156)
T PF12850_consen 24 NEPDFVIILGDI 35 (156)
T ss_dssp TTESEEEEES-S
T ss_pred cCCCEEEECCCc
Confidence 357999999997
No 49
>cd07413 MPP_PA3087 Pseudomonas aeruginosa PA3087 and related proteins, metallophosphatase domain. PA3087 is an uncharacterized protein from Pseudomonas aeruginosa with a metallophosphatase domain that belongs to the phosphoprotein phosphatase (PPP) family. The PPP family also includes: PP1, PP2A, PP2B (calcineurin), PP4, PP5, PP6, PP7, Bsu1, RdgC, PrpE, PrpA/PrpB, and ApA4 hydrolase. The PPP catalytic domain is defined by three conserved motifs (-GDXHG-, -GDXVDRG- and -GNHE-). The PPP enzyme family is ancient with members found in all eukaryotes, and in most bacterial and archeal genomes. Dephosphorylation of phosphoserines and phosphothreonines on target proteins plays a central role in the regulation of many cellular processes. PPPs belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of
Probab=21.97 E-value=1.5e+02 Score=20.43 Aligned_cols=25 Identities=12% Similarity=0.304 Sum_probs=16.1
Q ss_pred CccEEEEeCcCCCccCCCCCCCHHHHHHHH
Q psy5023 3 KLSYIFWIGDLNFRLNNPETYTQDIITDRI 32 (82)
Q Consensus 3 ~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i 32 (82)
..|.++++||+ |+-.+ ...+|++.+
T Consensus 33 ~~d~lvflGD~---IDRGp--~S~~vl~~l 57 (222)
T cd07413 33 PERQVVFLGDL---IDRGP--EIRELLEIV 57 (222)
T ss_pred CCCEEEEeCcc---cCCCC--CHHHHHHHH
Confidence 36899999999 77432 334455544
No 50
>cd07392 MPP_PAE1087 Pyrobaculum aerophilum PAE1087 and related proteins, metallophosphatase domain. PAE1087 is an uncharacterized Pyrobaculum aerophilum protein with a metallophosphatase domain. The domain present in members of this family belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to allow for productive metal coordina
Probab=21.82 E-value=61 Score=20.64 Aligned_cols=14 Identities=14% Similarity=0.176 Sum_probs=11.3
Q ss_pred CccEEEEeCcCCCc
Q psy5023 3 KLSYIFWIGDLNFR 16 (82)
Q Consensus 3 ~~d~vfw~GDlNyR 16 (82)
+.|.|+..|||-.+
T Consensus 23 ~~D~vv~~GDl~~~ 36 (188)
T cd07392 23 EADAVIVAGDITNF 36 (188)
T ss_pred CCCEEEECCCccCc
Confidence 57999999999543
No 51
>cd07402 MPP_GpdQ Enterobacter aerogenes GpdQ and related proteins, metallophosphatase domain. GpdQ (glycerophosphodiesterase Q, also known as Rv0805 in Mycobacterium tuberculosis) is a binuclear metallophosphoesterase from Enterobacter aerogenes that catalyzes the hydrolysis of mono-, di-, and triester substrates, including some organophosphate pesticides and products of the degradation of nerve agents. The GpdQ homolog, Rv0805, has 2',3'-cyclic nucleotide phosphodiesterase activity. GpdQ and Rv0805 belong to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosa
Probab=21.13 E-value=61 Score=21.80 Aligned_cols=11 Identities=27% Similarity=0.549 Sum_probs=10.1
Q ss_pred CccEEEEeCcC
Q psy5023 3 KLSYIFWIGDL 13 (82)
Q Consensus 3 ~~d~vfw~GDl 13 (82)
+.|.|++.||+
T Consensus 40 ~~d~vi~~GDl 50 (240)
T cd07402 40 RPDLVLVTGDL 50 (240)
T ss_pred CCCEEEECccC
Confidence 67999999998
No 52
>cd08165 MPP_MPPE1 human MPPE1 and related proteins, metallophosphatase domain. MPPE1 is a functionally uncharacterized metallophosphatase domain-containing protein. The MPPE1 gene is located on chromosome 18 and is a candidate susceptibility gene for Bipolar disorder. MPPE1 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzymes, YfcE-like phosphodiesterases, purple acid phosphatases (PAPs), YbbF-like UDP-2,3-diacylglucosamine hydrolases, and acid sphingomyelinases (ASMases). The conserved domain is a double beta-sheet sandwich with a di-metal active site made up of residues located at the C-terminal side of the sheets. This domain is thought to
Probab=20.50 E-value=66 Score=20.93 Aligned_cols=11 Identities=36% Similarity=0.733 Sum_probs=9.9
Q ss_pred CccEEEEeCcC
Q psy5023 3 KLSYIFWIGDL 13 (82)
Q Consensus 3 ~~d~vfw~GDl 13 (82)
+.|.|++.|||
T Consensus 38 ~pd~vv~~GDl 48 (156)
T cd08165 38 QPDVVFVLGDL 48 (156)
T ss_pred CCCEEEECCCC
Confidence 46899999999
No 53
>cd07422 MPP_ApaH Escherichia coli ApaH and related proteins, metallophosphatase domain. ApaH (also known as symmetrically cleaving Ap4A hydrolase and bis(5'nucleosyl)-tetraphosphatase) is a bacterial member of the PPP (phosphoprotein phosphatase) family of serine/threonine phosphatases that hydrolyzes the nucleotide-signaling molecule diadenosine tetraphosphate (Ap(4)A) into two ADP and also hydrolyzes Ap(5)A, Gp(4)G, and other extending compounds. Null mutations in apaH result in high intracellular levels of Ap(4)A which correlate with multiple phenotypes, including a decreased expression of catabolite-repressible genes, a reduction in the expression of flagellar operons, and an increased sensitivity to UV and heat. Ap4A hydrolase is important in responding to heat shock and oxidative stress via regulating the concentration of Ap4A in bacteria. Ap4A hydrolase is also thought to play a role in siderophore production, but the mechanism by which ApaH interacts with siderophore pathwa
Probab=20.50 E-value=1.7e+02 Score=21.04 Aligned_cols=26 Identities=15% Similarity=0.232 Sum_probs=16.9
Q ss_pred CccEEEEeCcCCCccCCCCCCCHHHHHHHHh
Q psy5023 3 KLSYIFWIGDLNFRLNNPETYTQDIITDRIR 33 (82)
Q Consensus 3 ~~d~vfw~GDlNyRi~~~~~l~~~~v~~~i~ 33 (82)
..|.++++||+ ++-.. ...+|++.+.
T Consensus 26 ~~D~Li~lGDl---VdRGp--~s~evl~~l~ 51 (257)
T cd07422 26 AKDRLWLVGDL---VNRGP--DSLETLRFVK 51 (257)
T ss_pred CCCEEEEecCc---CCCCc--CHHHHHHHHH
Confidence 46999999999 66332 3344555544
No 54
>cd08163 MPP_Cdc1 Saccharomyces cerevisiae CDC1 and related proteins, metallophosphatase domain. Cdc1 (also known as XlCdc1 in Xenopus laevis) is an endoplasmic reticulum-localized transmembrane lipid phosphatase with a metallophosphatase domain facing the ER lumen. In budding yeast, the gene encoding CDC1 is essential while nonlethal mutations cause defects in Golgi inheritance and actin polarization. Cdc1 mutant cells accumulate an unidentified phospholipid, suggesting that Cdc1 is a lipid phosphatase. Cdc1 mutant cells also have highly elevated intracellular calcium levels suggesting a possible role for Cdc1 in calcium regulation. The 5' flanking region of Cdc1 is a regulatory region with conserved binding site motifs for AP1, AP2, Sp1, NF-1 and CREB. DNA polymerase delta consists of at least four subunits - Pol3, Cdc1, Cdc27, and Cdm1. Cdc1 belongs to the metallophosphatase (MPP) superfamily. MPPs are functionally diverse, but all share a conserved domain with an active site
Probab=20.17 E-value=62 Score=23.03 Aligned_cols=14 Identities=29% Similarity=0.624 Sum_probs=11.5
Q ss_pred CccEEEEeCcCCCccCC
Q psy5023 3 KLSYIFWIGDLNFRLNN 19 (82)
Q Consensus 3 ~~d~vfw~GDlNyRi~~ 19 (82)
+-|.||++||| ++.
T Consensus 45 ~PD~vv~lGDL---~d~ 58 (257)
T cd08163 45 KPDSTIFLGDL---FDG 58 (257)
T ss_pred CCCEEEEeccc---ccC
Confidence 46899999999 554
No 55
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices. It has a role in DNA binding, contacting DNA target sites similar to c-Myb (IPR014778 from INTERPRO) repeats or homeodomains []. ; GO: 0003676 nucleic acid binding, 0005524 ATP binding, 0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides, 0006338 chromatin remodeling, 0005634 nucleus; PDB: 2NOG_A 2Y9Y_A 2Y9Z_A 1OFC_X.
Probab=20.10 E-value=1.8e+02 Score=18.62 Aligned_cols=50 Identities=22% Similarity=0.288 Sum_probs=23.1
Q ss_pred HHHHHHhccChHHHHHhHHHHHHHhhCcccCC-cccCCCCCCCCCCCcCCC
Q psy5023 27 IITDRIRDGQFNDLLEQDQLRAVMQSGEAFSE-FNETTPTFQPTFKYQFNS 76 (82)
Q Consensus 27 ~v~~~i~~~~~~~Ll~~DQL~~~~~~~~~f~~-f~E~~I~F~PTYK~~~~s 76 (82)
.+...|+.|.=...-...|...-++.-..+.. +.|-.|+++|+.+-...|
T Consensus 3 k~i~~IE~gE~k~~k~~~~~~~l~~Kv~~~~~P~~~L~i~y~~~~~~k~ys 53 (118)
T PF09111_consen 3 KIIKRIEKGEKKIEKRKEQQEALRKKVEQYKNPWQELKINYPPNNKKKVYS 53 (118)
T ss_dssp HHHHHHHHHHHHHHHHHHHHHHHHHHHCC-SSHHHH---SSTSTSS-SSS-
T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHccCCHHHCeeccCCCCCCCCcC
Confidence 45556665542222223333333333445555 888999999977655444
Done!