Query         psy5031
Match_columns 281
No_of_seqs    137 out of 488
Neff          5.2 
Searched_HMMs 46136
Date          Sat Aug 17 00:00:59 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5031.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5031hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02263 GBP:  Guanylate-bindin 100.0 1.3E-43 2.8E-48  325.1  12.6  149   32-281     1-158 (260)
  2 KOG2037|consensus              100.0 1.6E-36 3.5E-41  302.8   6.8  214   25-281     6-219 (552)
  3 cd01851 GBP Guanylate-binding  100.0 2.3E-30 5.1E-35  232.7  10.9  104  174-281    32-140 (224)
  4 KOG2203|consensus               99.3 2.9E-12 6.3E-17  128.4   7.6  155   20-279     3-181 (772)
  5 KOG2037|consensus               99.3 3.2E-12   7E-17  128.9   5.8  116   17-134    27-144 (552)
  6 PF05879 RHD3:  Root hair defec  98.9 1.4E-09   3E-14  113.7   3.9  117  134-279     1-144 (742)
  7 cd01852 AIG1 AIG1 (avrRpt2-ind  97.7 0.00019 4.2E-09   62.4   8.7   21   59-79      3-23  (196)
  8 PF04548 AIG1:  AIG1 family;  I  97.7 0.00019 4.1E-09   63.9   8.1   60  206-266    49-115 (212)
  9 PF01926 MMR_HSR1:  50S ribosom  97.4  0.0007 1.5E-08   53.6   7.3   20   59-78      2-21  (116)
 10 COG1159 Era GTPase [General fu  97.1   0.001 2.2E-08   63.3   6.6   27   53-79      3-29  (298)
 11 cd01853 Toc34_like Toc34-like   97.0  0.0042 9.1E-08   57.3   9.4   26   54-79     29-54  (249)
 12 PRK00089 era GTPase Era; Revie  97.0  0.0029 6.2E-08   58.4   8.0   26   54-79      3-28  (292)
 13 PF02263 GBP:  Guanylate-bindin  96.7 0.00086 1.9E-08   61.9   2.4   21  103-123    47-67  (260)
 14 KOG4181|consensus               96.5   0.003 6.5E-08   61.8   4.5   49   22-79    163-211 (491)
 15 cd01858 NGP_1 NGP-1.  Autoanti  96.4  0.0051 1.1E-07   51.6   5.0   26   55-80     69-94  (157)
 16 TIGR00436 era GTP-binding prot  96.4  0.0051 1.1E-07   56.5   5.3   22   58-79      2-23  (270)
 17 PF05879 RHD3:  Root hair defec  96.2  0.0018   4E-08   68.3   1.3   38   62-122     1-40  (742)
 18 TIGR03598 GTPase_YsxC ribosome  96.2   0.029 6.2E-07   47.8   8.3   25   54-78     16-40  (179)
 19 cd01849 YlqF_related_GTPase Yl  96.0   0.015 3.1E-07   48.8   5.8   26   55-80     59-84  (155)
 20 TIGR00993 3a0901s04IAP86 chlor  96.0   0.032   7E-07   58.7   9.2   23   57-79    119-141 (763)
 21 TIGR02836 spore_IV_A stage IV   96.0   0.014 3.1E-07   58.5   6.3   22   59-80     20-41  (492)
 22 PF00350 Dynamin_N:  Dynamin fa  96.0  0.0043 9.3E-08   51.7   2.4   21   59-79      1-21  (168)
 23 cd01898 Obg Obg subfamily.  Th  96.0   0.061 1.3E-06   44.3   9.2   20   59-78      3-22  (170)
 24 cd04101 RabL4 RabL4 (Rab-like4  95.9   0.028   6E-07   46.2   7.0   19   59-77      3-21  (164)
 25 PF02421 FeoB_N:  Ferrous iron   95.9   0.011 2.4E-07   51.2   4.6   21   59-79      3-23  (156)
 26 PF03193 DUF258:  Protein of un  95.7  0.0098 2.1E-07   51.9   3.5   22   58-79     37-58  (161)
 27 PF13207 AAA_17:  AAA domain; P  95.7  0.0096 2.1E-07   47.1   3.2   24   58-81      1-24  (121)
 28 cd01890 LepA LepA subfamily.    95.6   0.068 1.5E-06   44.6   8.2   21   59-79      3-23  (179)
 29 cd01850 CDC_Septin CDC/Septin.  95.6   0.036 7.8E-07   51.7   6.9   22   58-79      6-27  (276)
 30 PRK12289 GTPase RsgA; Reviewed  95.5   0.022 4.7E-07   55.3   5.5   21   59-79    175-195 (352)
 31 TIGR00991 3a0901s02IAP34 GTP-b  95.5    0.14 3.1E-06   49.2  10.6   27   53-79     35-61  (313)
 32 cd04142 RRP22 RRP22 subfamily.  95.4    0.11 2.5E-06   45.5   9.1   20   59-78      3-22  (198)
 33 cd01876 YihA_EngB The YihA (En  95.3   0.037   8E-07   44.5   5.4   19   59-77      2-20  (170)
 34 COG1136 SalX ABC-type antimicr  95.2   0.013 2.9E-07   53.8   2.7   21   58-78     33-53  (226)
 35 PRK12288 GTPase RsgA; Reviewed  95.2   0.024 5.2E-07   54.9   4.6   21   59-79    208-228 (347)
 36 PF00485 PRK:  Phosphoribulokin  95.2   0.017 3.7E-07   50.3   3.3   25   58-82      1-25  (194)
 37 PRK12298 obgE GTPase CgtA; Rev  95.0    0.14 3.1E-06   50.2   9.5   24   56-79    159-182 (390)
 38 cd04178 Nucleostemin_like Nucl  94.9   0.049 1.1E-06   47.4   5.3   22   57-78    118-139 (172)
 39 TIGR00157 ribosome small subun  94.8   0.075 1.6E-06   48.7   6.5   22   58-79    122-143 (245)
 40 KOG1423|consensus               94.8    0.06 1.3E-06   52.2   5.9   27   53-79     69-95  (379)
 41 cd04119 RJL RJL (RabJ-Like) su  94.8    0.11 2.4E-06   42.2   6.8   21   59-79      3-23  (168)
 42 cd04113 Rab4 Rab4 subfamily.    94.7     0.1 2.2E-06   42.7   6.5   21   59-79      3-23  (161)
 43 cd04104 p47_IIGP_like p47 (47-  94.7    0.12 2.6E-06   45.2   7.3   21   59-79      4-24  (197)
 44 PRK09563 rbgA GTPase YlqF; Rev  94.7   0.087 1.9E-06   49.2   6.6   27   56-82     81-107 (287)
 45 cd01868 Rab11_like Rab11-like.  94.7    0.11 2.4E-06   42.7   6.6   23   57-79      4-26  (165)
 46 COG3840 ThiQ ABC-type thiamine  94.6   0.025 5.4E-07   51.4   2.7   25   58-82     27-51  (231)
 47 cd01861 Rab6 Rab6 subfamily.    94.6    0.11 2.5E-06   42.3   6.4   21   59-79      3-23  (161)
 48 cd01864 Rab19 Rab19 subfamily.  94.5    0.13 2.7E-06   42.6   6.6   22   57-78      4-25  (165)
 49 cd04106 Rab23_lke Rab23-like s  94.4    0.14 3.1E-06   41.7   6.7   20   59-78      3-22  (162)
 50 TIGR00235 udk uridine kinase.   94.4   0.043 9.4E-07   48.3   3.8   28   54-81      4-31  (207)
 51 PRK15494 era GTPase Era; Provi  94.4    0.09   2E-06   50.4   6.1   27   53-79     49-75  (339)
 52 cd02023 UMPK Uridine monophosp  94.4   0.031 6.7E-07   48.6   2.7   23   58-80      1-23  (198)
 53 cd01866 Rab2 Rab2 subfamily.    94.3    0.18 3.9E-06   42.1   7.1   25   55-79      3-27  (168)
 54 PRK00098 GTPase RsgA; Reviewed  94.2   0.079 1.7E-06   49.8   5.3   22   58-79    166-187 (298)
 55 cd04115 Rab33B_Rab33A Rab33B/R  94.2    0.19 4.1E-06   42.0   7.1   23   56-78      2-24  (170)
 56 PRK05480 uridine/cytidine kina  94.1   0.045 9.7E-07   48.0   3.2   26   55-80      5-30  (209)
 57 cd04171 SelB SelB subfamily.    94.1   0.036 7.8E-07   45.0   2.4   21   58-78      2-22  (164)
 58 TIGR03596 GTPase_YlqF ribosome  94.0    0.26 5.6E-06   45.7   8.2   26   57-82     79-104 (276)
 59 cd02025 PanK Pantothenate kina  94.0   0.038 8.2E-07   49.8   2.6   24   58-81      1-24  (220)
 60 PF13238 AAA_18:  AAA domain; P  93.9    0.05 1.1E-06   42.7   2.9   22   59-80      1-22  (129)
 61 cd01894 EngA1 EngA1 subfamily.  93.9    0.12 2.6E-06   41.5   5.2   20   60-79      1-20  (157)
 62 cd01865 Rab3 Rab3 subfamily.    93.9    0.17 3.7E-06   42.0   6.2   22   58-79      3-24  (165)
 63 PRK08233 hypothetical protein;  93.9   0.052 1.1E-06   45.7   3.0   26   56-81      3-28  (182)
 64 PTZ00301 uridine kinase; Provi  93.9   0.052 1.1E-06   48.9   3.2   27   55-81      2-28  (210)
 65 cd04124 RabL2 RabL2 subfamily.  93.8    0.21 4.6E-06   41.4   6.7   21   59-79      3-23  (161)
 66 cd04122 Rab14 Rab14 subfamily.  93.8    0.18 3.8E-06   41.8   6.1   21   59-79      5-25  (166)
 67 cd04163 Era Era subfamily.  Er  93.8   0.046   1E-06   43.7   2.4   23   57-79      4-26  (168)
 68 PRK06696 uridine kinase; Valid  93.7     0.1 2.2E-06   46.6   4.8   28   55-82     21-48  (223)
 69 cd04116 Rab9 Rab9 subfamily.    93.7    0.22 4.7E-06   41.3   6.5   22   57-78      6-27  (170)
 70 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  93.7    0.22 4.8E-06   41.1   6.5   23   57-79      3-25  (166)
 71 cd04127 Rab27A Rab27a subfamil  93.7    0.32   7E-06   40.6   7.6   24   56-79      4-27  (180)
 72 PF00009 GTP_EFTU:  Elongation   93.7   0.066 1.4E-06   46.1   3.5   27   54-80      1-27  (188)
 73 COG1116 TauB ABC-type nitrate/  93.7   0.046   1E-06   51.0   2.6   26   57-82     30-55  (248)
 74 PRK09270 nucleoside triphospha  93.7   0.098 2.1E-06   46.9   4.6   30   53-82     30-59  (229)
 75 cd01891 TypA_BipA TypA (tyrosi  93.7    0.14 3.1E-06   44.0   5.5   24   56-79      2-25  (194)
 76 PF08477 Miro:  Miro-like prote  93.7   0.061 1.3E-06   42.0   2.9   21   59-79      2-22  (119)
 77 cd04159 Arl10_like Arl10-like   93.6   0.045 9.7E-07   43.6   2.2   21   59-79      2-22  (159)
 78 cd01867 Rab8_Rab10_Rab13_like   93.6    0.23   5E-06   41.3   6.5   23   57-79      4-26  (167)
 79 cd02019 NK Nucleoside/nucleoti  93.6   0.064 1.4E-06   39.6   2.7   23   58-80      1-23  (69)
 80 cd00877 Ran Ran (Ras-related n  93.6    0.26 5.6E-06   41.4   6.7   21   59-79      3-23  (166)
 81 COG1084 Predicted GTPase [Gene  93.4    0.18   4E-06   48.9   6.3   42   35-77    148-189 (346)
 82 cd04146 RERG_RasL11_like RERG/  93.4    0.54 1.2E-05   38.8   8.3   20   59-78      2-21  (165)
 83 PF03205 MobB:  Molybdopterin g  93.4   0.075 1.6E-06   44.8   3.2   25   58-82      2-26  (140)
 84 PRK07667 uridine kinase; Provi  93.3    0.15 3.1E-06   44.8   5.0   30   52-82     14-43  (193)
 85 cd04112 Rab26 Rab26 subfamily.  93.3    0.22 4.7E-06   42.8   6.0   21   59-79      3-23  (191)
 86 PF07693 KAP_NTPase:  KAP famil  93.3    0.12 2.6E-06   47.8   4.7   42   40-83      6-47  (325)
 87 PF00005 ABC_tran:  ABC transpo  93.3   0.055 1.2E-06   43.7   2.1   23   58-80     13-35  (137)
 88 cd01854 YjeQ_engC YjeQ/EngC.    93.3    0.26 5.7E-06   46.1   6.9   23   57-79    162-184 (287)
 89 cd01862 Rab7 Rab7 subfamily.    93.3   0.059 1.3E-06   44.3   2.3   22   58-79      2-23  (172)
 90 PRK00093 GTP-binding protein D  93.2    0.34 7.3E-06   47.2   7.9   19  133-151   178-196 (435)
 91 cd04109 Rab28 Rab28 subfamily.  93.2     0.3 6.6E-06   42.9   6.8   20   59-78      3-22  (215)
 92 PF13173 AAA_14:  AAA domain     93.1   0.092   2E-06   42.7   3.2   24   58-81      4-27  (128)
 93 TIGR01425 SRP54_euk signal rec  93.0    0.34 7.3E-06   48.5   7.7   28   54-81     98-125 (429)
 94 cd00009 AAA The AAA+ (ATPases   93.0    0.11 2.5E-06   40.3   3.6   24   57-80     20-43  (151)
 95 cd01878 HflX HflX subfamily.    93.0   0.062 1.3E-06   46.4   2.2   27   53-79     38-64  (204)
 96 PLN03118 Rab family protein; P  93.0    0.33 7.1E-06   42.5   6.8   22   58-79     16-37  (211)
 97 TIGR00231 small_GTP small GTP-  93.0   0.078 1.7E-06   41.6   2.6   22   58-79      3-24  (161)
 98 TIGR03594 GTPase_EngA ribosome  93.0    0.44 9.5E-06   46.2   8.3   19  133-151   177-195 (429)
 99 PF00735 Septin:  Septin;  Inte  93.0    0.23   5E-06   46.7   6.1   21   59-79      7-27  (281)
100 cd04118 Rab24 Rab24 subfamily.  92.9    0.33 7.1E-06   41.3   6.4   21   59-79      3-23  (193)
101 cd00154 Rab Rab family.  Rab G  92.8    0.09 1.9E-06   41.8   2.7   21   59-79      3-23  (159)
102 COG1120 FepC ABC-type cobalami  92.8   0.076 1.6E-06   49.8   2.5   26   57-82     29-54  (258)
103 PLN02318 phosphoribulokinase/u  92.8    0.13 2.9E-06   53.7   4.5   45   32-80     45-89  (656)
104 cd04110 Rab35 Rab35 subfamily.  92.7     0.3 6.5E-06   42.4   6.0   24   56-79      6-29  (199)
105 PF13191 AAA_16:  AAA ATPase do  92.6    0.14 2.9E-06   42.9   3.7   31   52-82     20-50  (185)
106 TIGR02528 EutP ethanolamine ut  92.6   0.077 1.7E-06   42.8   2.1   21   59-79      3-23  (142)
107 PF13521 AAA_28:  AAA domain; P  92.6   0.078 1.7E-06   44.6   2.2   21   59-79      2-22  (163)
108 COG1126 GlnQ ABC-type polar am  92.6   0.088 1.9E-06   48.7   2.6   22   57-78     29-50  (240)
109 cd03261 ABC_Org_Solvent_Resist  92.6   0.087 1.9E-06   46.9   2.6   24   58-81     28-51  (235)
110 COG1161 Predicted GTPases [Gen  92.6    0.66 1.4E-05   44.4   8.7   21   59-79    135-155 (322)
111 PF01637 Arch_ATPase:  Archaeal  92.5   0.069 1.5E-06   45.9   1.7   27   55-81     19-45  (234)
112 cd00876 Ras Ras family.  The R  92.5     0.1 2.2E-06   42.1   2.6   21   59-79      2-22  (160)
113 smart00382 AAA ATPases associa  92.4    0.11 2.5E-06   39.7   2.8   25   58-82      4-28  (148)
114 cd04107 Rab32_Rab38 Rab38/Rab3  92.4    0.44 9.4E-06   41.3   6.7   21   59-79      3-23  (201)
115 COG3172 NadR Predicted ATPase/  92.4    0.11 2.3E-06   46.3   2.8   31   52-82      4-34  (187)
116 cd01886 EF-G Elongation factor  92.3    0.78 1.7E-05   42.7   8.7   21   59-79      2-22  (270)
117 TIGR00073 hypB hydrogenase acc  92.3    0.14   3E-06   45.2   3.5   28   53-80     19-46  (207)
118 TIGR02322 phosphon_PhnN phosph  92.3    0.13 2.7E-06   43.8   3.1   23   58-80      3-25  (179)
119 cd03263 ABC_subfamily_A The AB  92.3     0.1 2.2E-06   45.9   2.6   23   58-80     30-52  (220)
120 TIGR00960 3a0501s02 Type II (G  92.3     0.1 2.2E-06   45.9   2.6   24   57-80     30-53  (216)
121 cd01131 PilT Pilus retraction   92.3    0.13 2.7E-06   45.4   3.2   24   58-81      3-26  (198)
122 cd03238 ABC_UvrA The excision   92.3    0.11 2.4E-06   45.4   2.8   21   57-77     22-42  (176)
123 cd04138 H_N_K_Ras_like H-Ras/N  92.2    0.12 2.5E-06   41.8   2.7   21   59-79      4-24  (162)
124 PRK10463 hydrogenase nickel in  92.2    0.13 2.9E-06   48.9   3.4   32   51-82     99-130 (290)
125 cd01851 GBP Guanylate-binding   92.2   0.068 1.5E-06   48.3   1.4   52   52-124     3-54  (224)
126 PF13671 AAA_33:  AAA domain; P  92.2    0.13 2.9E-06   41.5   3.0   24   58-81      1-24  (143)
127 PTZ00132 GTP-binding nuclear p  92.2    0.46 9.9E-06   41.6   6.6   24   55-78      8-31  (215)
128 cd00882 Ras_like_GTPase Ras-li  92.2   0.075 1.6E-06   40.8   1.4   19   61-79      1-19  (157)
129 TIGR01166 cbiO cobalt transpor  92.2    0.11 2.3E-06   44.9   2.5   23   58-80     20-42  (190)
130 cd01860 Rab5_related Rab5-rela  92.2    0.11 2.4E-06   42.4   2.6   22   58-79      3-24  (163)
131 cd03225 ABC_cobalt_CbiO_domain  92.2    0.11 2.4E-06   45.4   2.6   24   57-80     28-51  (211)
132 TIGR01360 aden_kin_iso1 adenyl  92.1    0.13 2.8E-06   43.6   2.9   25   56-80      3-27  (188)
133 cd03260 ABC_PstB_phosphate_tra  92.1    0.13 2.7E-06   45.6   3.0   24   57-80     27-50  (227)
134 PRK10751 molybdopterin-guanine  92.1    0.13 2.8E-06   45.3   3.0   27   56-82      6-32  (173)
135 PRK00300 gmk guanylate kinase;  92.1    0.13 2.8E-06   44.6   3.0   25   56-80      5-29  (205)
136 cd03224 ABC_TM1139_LivF_branch  92.1    0.11 2.3E-06   45.8   2.5   24   57-80     27-50  (222)
137 smart00173 RAS Ras subfamily o  92.1    0.12 2.7E-06   42.3   2.7   21   59-79      3-23  (164)
138 cd04111 Rab39 Rab39 subfamily.  92.1    0.47   1E-05   41.9   6.6   22   58-79      4-25  (211)
139 cd04155 Arl3 Arl3 subfamily.    92.0    0.11 2.4E-06   43.1   2.4   24   56-79     14-37  (173)
140 cd03292 ABC_FtsE_transporter F  92.0    0.12 2.6E-06   45.2   2.7   23   58-80     29-51  (214)
141 cd03269 ABC_putative_ATPase Th  92.0    0.12 2.5E-06   45.3   2.6   24   57-80     27-50  (210)
142 CHL00071 tufA elongation facto  92.0    0.78 1.7E-05   45.0   8.6   27   53-79      9-35  (409)
143 cd02028 UMPK_like Uridine mono  92.0    0.12 2.7E-06   44.9   2.8   24   58-81      1-24  (179)
144 PRK05439 pantothenate kinase;   92.0    0.23 5.1E-06   47.6   4.8   40   40-81     72-111 (311)
145 cd00881 GTP_translation_factor  92.0    0.13 2.7E-06   42.8   2.7   21   59-79      2-22  (189)
146 TIGR02211 LolD_lipo_ex lipopro  92.0    0.12 2.6E-06   45.5   2.6   24   57-80     32-55  (221)
147 TIGR00554 panK_bact pantothena  91.9    0.25 5.3E-06   46.9   4.9   28   53-81     60-87  (290)
148 TIGR02673 FtsE cell division A  91.9    0.12 2.6E-06   45.2   2.6   23   58-80     30-52  (214)
149 PRK14241 phosphate transporter  91.9    0.12 2.7E-06   46.8   2.8   24   57-80     31-54  (258)
150 cd00071 GMPK Guanosine monopho  91.9    0.12 2.5E-06   43.1   2.4   23   58-80      1-23  (137)
151 TIGR02315 ABC_phnC phosphonate  91.9    0.12 2.6E-06   46.1   2.6   24   57-80     29-52  (243)
152 cd04167 Snu114p Snu114p subfam  91.9    0.46 9.9E-06   41.8   6.3   21   59-79      3-23  (213)
153 cd03264 ABC_drug_resistance_li  91.8    0.11 2.4E-06   45.5   2.3   23   58-80     27-49  (211)
154 TIGR03594 GTPase_EngA ribosome  91.8    0.52 1.1E-05   45.7   7.1   22   58-79      1-22  (429)
155 cd04123 Rab21 Rab21 subfamily.  91.8    0.14   3E-06   41.4   2.7   21   59-79      3-23  (162)
156 TIGR00176 mobB molybdopterin-g  91.8    0.14   3E-06   43.9   2.8   25   58-82      1-25  (155)
157 cd03265 ABC_DrrA DrrA is the A  91.8    0.13 2.8E-06   45.4   2.6   24   57-80     27-50  (220)
158 TIGR02173 cyt_kin_arch cytidyl  91.8    0.16 3.4E-06   42.3   3.1   23   58-80      2-24  (171)
159 cd03255 ABC_MJ0796_Lo1CDE_FtsE  91.8    0.13 2.8E-06   45.2   2.6   24   57-80     31-54  (218)
160 cd03226 ABC_cobalt_CbiO_domain  91.8    0.13 2.8E-06   44.9   2.6   24   57-80     27-50  (205)
161 PF05970 PIF1:  PIF1-like helic  91.8     0.2 4.4E-06   48.3   4.2   25   58-82     24-48  (364)
162 cd01887 IF2_eIF5B IF2/eIF5B (i  91.8    0.14 3.1E-06   41.9   2.7   22   58-79      2-23  (168)
163 cd04160 Arfrp1 Arfrp1 subfamil  91.7    0.13 2.9E-06   42.2   2.6   21   59-79      2-22  (167)
164 PF13555 AAA_29:  P-loop contai  91.7    0.16 3.4E-06   37.8   2.7   25   58-82     25-49  (62)
165 cd03369 ABCC_NFT1 Domain 2 of   91.7    0.14 2.9E-06   44.8   2.7   24   57-80     35-58  (207)
166 cd03297 ABC_ModC_molybdenum_tr  91.7    0.14 2.9E-06   45.1   2.7   26   54-80     22-47  (214)
167 cd01884 EF_Tu EF-Tu subfamily.  91.7    0.75 1.6E-05   40.6   7.5   23   57-79      3-25  (195)
168 cd01863 Rab18 Rab18 subfamily.  91.7    0.13 2.9E-06   42.0   2.5   21   59-79      3-23  (161)
169 cd03257 ABC_NikE_OppD_transpor  91.7    0.13 2.7E-06   45.4   2.5   24   57-80     32-55  (228)
170 PRK09087 hypothetical protein;  91.7    0.38 8.3E-06   43.6   5.7   54   23-79      5-67  (226)
171 cd03256 ABC_PhnC_transporter A  91.6    0.13 2.9E-06   45.7   2.6   23   58-80     29-51  (241)
172 cd04145 M_R_Ras_like M-Ras/R-R  91.6    0.17 3.6E-06   41.3   3.0   23   57-79      3-25  (164)
173 cd04154 Arl2 Arl2 subfamily.    91.6    0.13 2.8E-06   43.1   2.4   26   53-79     12-37  (173)
174 PF03308 ArgK:  ArgK protein;    91.6    0.22 4.8E-06   46.9   4.1   40   39-82     16-55  (266)
175 TIGR03263 guanyl_kin guanylate  91.6    0.15 3.2E-06   43.3   2.7   23   58-80      3-25  (180)
176 cd01885 EF2 EF2 (for archaea a  91.6     0.7 1.5E-05   41.9   7.3   21   59-79      3-23  (222)
177 cd03258 ABC_MetN_methionine_tr  91.5    0.14   3E-06   45.5   2.6   25   57-81     32-56  (233)
178 cd03235 ABC_Metallic_Cations A  91.5    0.13 2.7E-06   45.2   2.3   23   58-80     27-49  (213)
179 PRK14242 phosphate transporter  91.5    0.15 3.3E-06   45.9   2.9   23   57-79     33-55  (253)
180 COG4240 Predicted kinase [Gene  91.5    0.16 3.5E-06   47.6   3.1   29   56-84     50-78  (300)
181 PRK11629 lolD lipoprotein tran  91.5    0.14 3.1E-06   45.6   2.7   24   57-80     36-59  (233)
182 cd03254 ABCC_Glucan_exporter_l  91.5    0.14 3.1E-06   45.2   2.6   23   58-80     31-53  (229)
183 cd03262 ABC_HisP_GlnQ_permease  91.5    0.14 3.1E-06   44.6   2.6   23   58-80     28-50  (213)
184 PRK13540 cytochrome c biogenes  91.4    0.15 3.2E-06   44.5   2.7   24   57-80     28-51  (200)
185 TIGR03608 L_ocin_972_ABC putat  91.4    0.15 3.3E-06   44.3   2.7   24   57-80     25-48  (206)
186 cd04114 Rab30 Rab30 subfamily.  91.4    0.21 4.5E-06   41.2   3.4   26   54-79      5-30  (169)
187 cd03218 ABC_YhbG The ABC trans  91.4    0.14 3.1E-06   45.3   2.6   24   57-80     27-50  (232)
188 PRK11124 artP arginine transpo  91.4    0.15 3.2E-06   45.7   2.6   24   57-80     29-52  (242)
189 cd03293 ABC_NrtD_SsuB_transpor  91.4    0.15 3.2E-06   45.0   2.6   24   57-80     31-54  (220)
190 PRK14269 phosphate ABC transpo  91.4    0.15 3.3E-06   45.8   2.8   23   57-79     29-51  (246)
191 PRK00454 engB GTP-binding prot  91.4    0.14   3E-06   43.4   2.4   25   55-79     23-47  (196)
192 cd03222 ABC_RNaseL_inhibitor T  91.4    0.14 3.1E-06   44.8   2.5   24   57-80     26-49  (177)
193 cd03268 ABC_BcrA_bacitracin_re  91.4    0.15 3.3E-06   44.5   2.6   24   57-80     27-50  (208)
194 PRK10584 putative ABC transpor  91.3    0.15 3.3E-06   45.1   2.7   24   57-80     37-60  (228)
195 cd03216 ABC_Carb_Monos_I This   91.3    0.16 3.4E-06   43.2   2.6   23   57-79     27-49  (163)
196 cd03259 ABC_Carb_Solutes_like   91.3    0.15 3.3E-06   44.6   2.6   23   58-80     28-50  (213)
197 TIGR01189 ccmA heme ABC export  91.3    0.16 3.4E-06   44.2   2.6   25   56-80     26-50  (198)
198 PF13401 AAA_22:  AAA domain; P  91.3    0.18 3.9E-06   40.0   2.8   25   57-81      5-29  (131)
199 PRK14239 phosphate transporter  91.3    0.15 3.3E-06   45.8   2.6   23   57-79     32-54  (252)
200 cd03219 ABC_Mj1267_LivG_branch  91.2    0.14   3E-06   45.5   2.3   24   57-80     27-50  (236)
201 PRK03003 GTP-binding protein D  91.2     1.2 2.5E-05   44.6   9.0  101   59-261   214-320 (472)
202 TIGR02770 nickel_nikD nickel i  91.2    0.15 3.3E-06   45.4   2.6   24   57-80     13-36  (230)
203 PRK13541 cytochrome c biogenes  91.2    0.16 3.5E-06   44.1   2.7   23   58-80     28-50  (195)
204 cd01130 VirB11-like_ATPase Typ  91.2    0.18 3.9E-06   43.8   2.9   40   37-80     10-49  (186)
205 TIGR01978 sufC FeS assembly AT  91.1    0.15 3.3E-06   45.3   2.5   23   57-79     27-49  (243)
206 cd02020 CMPK Cytidine monophos  91.1    0.18 3.9E-06   40.8   2.7   23   58-80      1-23  (147)
207 PRK14262 phosphate ABC transpo  91.1    0.17 3.6E-06   45.6   2.7   24   57-80     30-53  (250)
208 PRK11248 tauB taurine transpor  91.1    0.16 3.5E-06   46.4   2.6   24   57-80     28-51  (255)
209 cd03221 ABCF_EF-3 ABCF_EF-3  E  91.1    0.16 3.4E-06   42.5   2.4   23   57-79     27-49  (144)
210 cd03246 ABCC_Protease_Secretio  91.1    0.19 4.1E-06   42.9   2.9   23   58-80     30-52  (173)
211 PRK12736 elongation factor Tu;  91.1    0.65 1.4E-05   45.3   7.0   27   53-79      9-35  (394)
212 cd04169 RF3 RF3 subfamily.  Pe  91.1    0.51 1.1E-05   43.8   5.9   23   57-79      3-25  (267)
213 PRK14245 phosphate ABC transpo  91.0    0.18 3.9E-06   45.4   2.9   23   57-79     30-52  (250)
214 cd03266 ABC_NatA_sodium_export  91.0    0.17 3.6E-06   44.5   2.6   24   57-80     32-55  (218)
215 cd04108 Rab36_Rab34 Rab34/Rab3  91.0    0.68 1.5E-05   39.1   6.2   22   58-79      2-23  (170)
216 cd03245 ABCC_bacteriocin_expor  91.0    0.17 3.8E-06   44.4   2.7   23   58-80     32-54  (220)
217 cd03249 ABC_MTABC3_MDL1_MDL2 M  91.0    0.17 3.7E-06   45.1   2.6   24   57-80     30-53  (238)
218 cd03301 ABC_MalK_N The N-termi  90.9    0.18 3.8E-06   44.1   2.6   23   58-80     28-50  (213)
219 cd03244 ABCC_MRP_domain2 Domai  90.9    0.18 3.9E-06   44.3   2.7   24   57-80     31-54  (221)
220 cd04168 TetM_like Tet(M)-like   90.9       1 2.3E-05   40.9   7.8   21   59-79      2-22  (237)
221 PRK14247 phosphate ABC transpo  90.9    0.18 3.9E-06   45.4   2.7   24   57-80     30-53  (250)
222 cd03251 ABCC_MsbA MsbA is an e  90.9    0.18 3.9E-06   44.7   2.7   24   57-80     29-52  (234)
223 cd01120 RecA-like_NTPases RecA  90.9    0.19 4.1E-06   40.5   2.6   23   58-80      1-23  (165)
224 cd03253 ABCC_ATM1_transporter   90.9    0.18 3.9E-06   44.8   2.7   24   57-80     28-51  (236)
225 PRK14270 phosphate ABC transpo  90.9    0.19 4.2E-06   45.2   2.9   24   57-80     31-54  (251)
226 cd03230 ABC_DR_subfamily_A Thi  90.9    0.18 3.9E-06   43.0   2.6   22   58-79     28-49  (173)
227 cd03296 ABC_CysA_sulfate_impor  90.8    0.18 3.8E-06   45.2   2.6   24   57-80     29-52  (239)
228 PLN03110 Rab GTPase; Provision  90.8    0.74 1.6E-05   40.8   6.5   25   55-79     11-35  (216)
229 PRK14248 phosphate ABC transpo  90.8     0.2 4.3E-06   45.8   2.9   22   58-79     49-70  (268)
230 PLN02796 D-glycerate 3-kinase   90.8     0.2 4.4E-06   48.8   3.1   27   55-81     99-125 (347)
231 PRK11264 putative amino-acid A  90.8    0.18   4E-06   45.2   2.7   23   58-80     31-53  (250)
232 cd03229 ABC_Class3 This class   90.7    0.19 4.2E-06   43.1   2.6   23   57-79     27-49  (178)
233 PRK14261 phosphate ABC transpo  90.7    0.18   4E-06   45.4   2.6   22   58-79     34-55  (253)
234 TIGR03864 PQQ_ABC_ATP ABC tran  90.7    0.18   4E-06   45.0   2.6   24   57-80     28-51  (236)
235 PRK14250 phosphate ABC transpo  90.7    0.18   4E-06   45.3   2.6   23   58-80     31-53  (241)
236 cd04136 Rap_like Rap-like subf  90.7    0.21 4.5E-06   40.7   2.7   22   58-79      3-24  (163)
237 cd03231 ABC_CcmA_heme_exporter  90.7    0.19 4.1E-06   43.9   2.6   24   57-80     27-50  (201)
238 PRK14267 phosphate ABC transpo  90.7    0.19 4.1E-06   45.3   2.7   24   57-80     31-54  (253)
239 PRK13539 cytochrome c biogenes  90.6    0.19 4.2E-06   44.1   2.6   24   57-80     29-52  (207)
240 PRK14273 phosphate ABC transpo  90.6     0.2 4.2E-06   45.3   2.7   24   57-80     34-57  (254)
241 smart00175 RAB Rab subfamily o  90.6    0.19 4.2E-06   40.8   2.5   21   59-79      3-23  (164)
242 PRK10744 pstB phosphate transp  90.6    0.19 4.2E-06   45.7   2.7   24   57-80     40-63  (260)
243 PRK09518 bifunctional cytidyla  90.6     1.2 2.7E-05   46.8   9.0  101   59-261   453-559 (712)
244 cd03295 ABC_OpuCA_Osmoprotecti  90.6     0.2 4.2E-06   45.0   2.7   23   58-80     29-51  (242)
245 cd03116 MobB Molybdenum is an   90.6    0.25 5.4E-06   42.7   3.2   26   57-82      2-27  (159)
246 PRK10247 putative ABC transpor  90.6     0.2 4.4E-06   44.5   2.7   24   57-80     34-57  (225)
247 PRK14274 phosphate ABC transpo  90.6    0.22 4.7E-06   45.2   3.0   23   58-80     40-62  (259)
248 PRK10908 cell division protein  90.5     0.2 4.2E-06   44.3   2.6   24   57-80     29-52  (222)
249 PRK14256 phosphate ABC transpo  90.5    0.21 4.6E-06   45.0   2.9   23   58-80     32-54  (252)
250 cd04117 Rab15 Rab15 subfamily.  90.5    0.82 1.8E-05   37.9   6.2   20   59-78      3-22  (161)
251 TIGR03740 galliderm_ABC gallid  90.5     0.2 4.3E-06   44.3   2.6   24   57-80     27-50  (223)
252 TIGR00972 3a0107s01c2 phosphat  90.5     0.2 4.3E-06   45.1   2.7   24   57-80     28-51  (247)
253 cd03236 ABC_RNaseL_inhibitor_d  90.5    0.19 4.2E-06   46.2   2.6   26   57-82     27-52  (255)
254 PRK06547 hypothetical protein;  90.5    0.33 7.2E-06   42.2   4.0   27   54-80     13-39  (172)
255 PRK15177 Vi polysaccharide exp  90.5     0.2 4.2E-06   44.5   2.6   24   57-80     14-37  (213)
256 cd03234 ABCG_White The White s  90.5     0.2 4.3E-06   44.4   2.6   24   57-80     34-57  (226)
257 COG3596 Predicted GTPase [Gene  90.5    0.44 9.6E-06   45.5   5.0   25   53-78     37-61  (296)
258 cd03223 ABCD_peroxisomal_ALDP   90.5    0.21 4.6E-06   42.6   2.6   23   58-80     29-51  (166)
259 PRK14240 phosphate transporter  90.4    0.21 4.6E-06   44.9   2.7   22   58-79     31-52  (250)
260 PRK14235 phosphate transporter  90.4    0.23 4.9E-06   45.5   3.0   24   57-80     46-69  (267)
261 cd03233 ABC_PDR_domain1 The pl  90.4    0.19   4E-06   44.2   2.3   24   57-80     34-57  (202)
262 smart00763 AAA_PrkA PrkA AAA d  90.4    0.42 9.1E-06   46.9   4.9   45   38-82     56-104 (361)
263 PRK10895 lipopolysaccharide AB  90.4     0.2 4.4E-06   44.7   2.6   24   57-80     30-53  (241)
264 cd03298 ABC_ThiQ_thiamine_tran  90.4    0.21 4.6E-06   43.7   2.6   24   57-80     25-48  (211)
265 PRK11701 phnK phosphonate C-P   90.3    0.21 4.4E-06   45.4   2.6   24   57-80     33-56  (258)
266 COG0572 Udk Uridine kinase [Nu  90.3     0.3 6.4E-06   44.8   3.6   29   54-82      6-34  (218)
267 PRK15056 manganese/iron transp  90.3     0.2 4.4E-06   46.0   2.6   23   58-80     35-57  (272)
268 PRK14251 phosphate ABC transpo  90.3    0.23 4.9E-06   44.7   2.9   24   57-80     31-54  (251)
269 cd01895 EngA2 EngA2 subfamily.  90.3     0.2 4.4E-06   40.5   2.3   21   59-79      5-25  (174)
270 cd03215 ABC_Carb_Monos_II This  90.3    0.21 4.6E-06   43.0   2.5   23   58-80     28-50  (182)
271 PRK14268 phosphate ABC transpo  90.2    0.22 4.7E-06   45.3   2.7   24   57-80     39-62  (258)
272 TIGR03410 urea_trans_UrtE urea  90.2    0.21 4.5E-06   44.3   2.5   25   57-81     27-51  (230)
273 PRK13648 cbiO cobalt transport  90.2    0.21 4.7E-06   45.7   2.6   24   57-80     36-59  (269)
274 TIGR01184 ntrCD nitrate transp  90.2    0.22 4.7E-06   44.6   2.6   24   57-80     12-35  (230)
275 cd04140 ARHI_like ARHI subfami  90.2    0.23 5.1E-06   41.2   2.7   21   59-79      4-24  (165)
276 PRK13538 cytochrome c biogenes  90.2    0.22 4.7E-06   43.6   2.6   24   57-80     28-51  (204)
277 PRK14272 phosphate ABC transpo  90.2    0.22 4.8E-06   44.7   2.7   23   58-80     32-54  (252)
278 PRK13649 cbiO cobalt transport  90.2    0.21 4.5E-06   45.9   2.5   24   57-80     34-57  (280)
279 PF00004 AAA:  ATPase family as  90.2     0.3 6.4E-06   38.4   3.1   23   59-81      1-23  (132)
280 cd04156 ARLTS1 ARLTS1 subfamil  90.1    0.22 4.8E-06   40.6   2.4   21   59-79      2-22  (160)
281 PRK10078 ribose 1,5-bisphospho  90.1    0.24 5.1E-06   42.9   2.7   23   58-80      4-26  (186)
282 TIGR02324 CP_lyasePhnL phospho  90.1    0.23 4.9E-06   43.9   2.6   24   57-80     35-58  (224)
283 cd04139 RalA_RalB RalA/RalB su  90.1    0.24 5.3E-06   40.1   2.6   22   58-79      2-23  (164)
284 PRK13645 cbiO cobalt transport  90.1    0.22 4.8E-06   46.1   2.6   25   57-81     38-62  (289)
285 PRK14253 phosphate ABC transpo  90.0    0.26 5.5E-06   44.3   2.9   23   58-80     31-53  (249)
286 cd02024 NRK1 Nicotinamide ribo  90.0    0.23 4.9E-06   44.2   2.5   23   58-80      1-23  (187)
287 cd02026 PRK Phosphoribulokinas  90.0    0.22 4.8E-06   46.5   2.6   24   58-81      1-24  (273)
288 TIGR03005 ectoine_ehuA ectoine  90.0    0.23 4.9E-06   44.8   2.6   23   58-80     28-50  (252)
289 cd00820 PEPCK_HprK Phosphoenol  90.0    0.26 5.6E-06   40.4   2.6   21   57-77     16-36  (107)
290 PRK14255 phosphate ABC transpo  90.0    0.24 5.1E-06   44.6   2.7   22   58-79     33-54  (252)
291 PRK11247 ssuB aliphatic sulfon  90.0    0.23   5E-06   45.6   2.7   23   58-80     40-62  (257)
292 PF13604 AAA_30:  AAA domain; P  90.0    0.52 1.1E-05   41.6   4.8   37   40-82      8-44  (196)
293 cd03214 ABC_Iron-Siderophores_  90.0    0.24 5.3E-06   42.5   2.6   23   57-79     26-48  (180)
294 PRK07261 topology modulation p  90.0    0.27 5.8E-06   42.4   2.9   22   59-80      3-24  (171)
295 PRK10575 iron-hydroxamate tran  89.9    0.21 4.6E-06   45.6   2.3   24   57-80     38-61  (265)
296 cd03252 ABCC_Hemolysin The ABC  89.9    0.24 5.2E-06   44.1   2.6   24   57-80     29-52  (237)
297 PRK09493 glnQ glutamine ABC tr  89.9    0.24 5.2E-06   44.3   2.6   24   57-80     28-51  (240)
298 PRK14249 phosphate ABC transpo  89.9    0.24 5.3E-06   44.6   2.7   23   58-80     32-54  (251)
299 PRK13632 cbiO cobalt transport  89.9    0.24 5.2E-06   45.5   2.7   24   57-80     36-59  (271)
300 PF09547 Spore_IV_A:  Stage IV   89.9    0.23 4.9E-06   50.1   2.6   26   55-81     17-42  (492)
301 PRK09825 idnK D-gluconate kina  89.9     0.3 6.4E-06   42.5   3.1   24   58-81      5-28  (176)
302 PRK11300 livG leucine/isoleuci  89.9    0.23 4.9E-06   44.7   2.5   24   57-80     32-55  (255)
303 PRK12735 elongation factor Tu;  89.8       1 2.3E-05   43.9   7.2   27   53-79      9-35  (396)
304 cd03294 ABC_Pro_Gly_Bertaine T  89.8    0.24 5.2E-06   45.5   2.6   24   57-80     51-74  (269)
305 TIGR00101 ureG urease accessor  89.8     0.3 6.4E-06   43.4   3.1   24   58-81      3-26  (199)
306 cd03217 ABC_FeS_Assembly ABC-t  89.8    0.24 5.2E-06   43.4   2.5   23   57-79     27-49  (200)
307 TIGR01393 lepA GTP-binding pro  89.8     1.6 3.5E-05   45.2   8.9   24   56-79      3-26  (595)
308 PRK15112 antimicrobial peptide  89.8    0.24 5.2E-06   45.4   2.6   24   57-80     40-63  (267)
309 PRK14259 phosphate ABC transpo  89.8    0.25 5.3E-06   45.4   2.7   24   57-80     40-63  (269)
310 cd03232 ABC_PDR_domain2 The pl  89.8    0.25 5.4E-06   43.0   2.6   23   57-79     34-56  (192)
311 PRK13548 hmuV hemin importer A  89.8    0.24 5.1E-06   45.2   2.5   23   58-80     30-52  (258)
312 PRK13651 cobalt transporter AT  89.8    0.24 5.1E-06   46.8   2.6   25   57-81     34-58  (305)
313 KOG1547|consensus               89.7     1.1 2.3E-05   42.6   6.8   20  202-221   100-119 (336)
314 PF00448 SRP54:  SRP54-type pro  89.7     1.4   3E-05   39.2   7.3   26   57-82      2-27  (196)
315 cd03237 ABC_RNaseL_inhibitor_d  89.7    0.24 5.3E-06   45.2   2.6   24   57-80     26-49  (246)
316 PRK09984 phosphonate/organopho  89.7    0.25 5.3E-06   44.9   2.6   24   57-80     31-54  (262)
317 PRK00698 tmk thymidylate kinas  89.7    0.33 7.2E-06   41.7   3.3   26   57-82      4-29  (205)
318 PRK09544 znuC high-affinity zi  89.7    0.25 5.4E-06   45.1   2.6   24   57-80     31-54  (251)
319 TIGR02524 dot_icm_DotB Dot/Icm  89.7    0.29 6.3E-06   47.6   3.2   26   56-81    134-159 (358)
320 cd00157 Rho Rho (Ras homology)  89.7    0.28   6E-06   40.3   2.7   21   59-79      3-23  (171)
321 TIGR02323 CP_lyasePhnK phospho  89.7    0.25 5.4E-06   44.5   2.6   24   57-80     30-53  (253)
322 PRK11231 fecE iron-dicitrate t  89.7    0.24 5.3E-06   44.8   2.5   23   58-80     30-52  (255)
323 PRK11831 putative ABC transpor  89.7    0.24 5.2E-06   45.4   2.5   23   58-80     35-57  (269)
324 TIGR02769 nickel_nikE nickel i  89.7    0.24 5.3E-06   45.2   2.6   24   57-80     38-61  (265)
325 TIGR01277 thiQ thiamine ABC tr  89.7    0.26 5.7E-06   43.3   2.6   25   57-81     25-49  (213)
326 CHL00131 ycf16 sulfate ABC tra  89.6    0.23 4.9E-06   44.7   2.3   23   57-79     34-56  (252)
327 cd00879 Sar1 Sar1 subfamily.    89.6    0.26 5.6E-06   41.8   2.5   21   58-78     21-41  (190)
328 PRK10771 thiQ thiamine transpo  89.6    0.25 5.4E-06   44.0   2.5   24   57-80     26-49  (232)
329 PRK09580 sufC cysteine desulfu  89.6    0.23 4.9E-06   44.5   2.3   23   57-79     28-50  (248)
330 cd03248 ABCC_TAP TAP, the Tran  89.6    0.28   6E-06   43.4   2.8   24   57-80     41-64  (226)
331 COG4559 ABC-type hemin transpo  89.6    0.23   5E-06   46.2   2.3   29   54-82     25-53  (259)
332 PRK14237 phosphate transporter  89.6    0.29 6.2E-06   44.9   2.9   24   57-80     47-70  (267)
333 PRK11614 livF leucine/isoleuci  89.6    0.23 5.1E-06   44.2   2.3   23   58-80     33-55  (237)
334 PRK13638 cbiO cobalt transport  89.5    0.24 5.2E-06   45.4   2.4   23   58-80     29-51  (271)
335 PRK14244 phosphate ABC transpo  89.5    0.29 6.4E-06   44.1   2.9   23   58-80     33-55  (251)
336 PRK06762 hypothetical protein;  89.5    0.35 7.5E-06   40.6   3.2   23   58-80      4-26  (166)
337 cd01896 DRG The developmentall  89.5    0.24 5.2E-06   44.9   2.3   23   57-79      1-23  (233)
338 cd01672 TMPK Thymidine monopho  89.5    0.35 7.6E-06   40.8   3.2   25   58-82      2-26  (200)
339 PF06309 Torsin:  Torsin;  Inte  89.5    0.71 1.5E-05   39.0   5.0   42   40-83     39-80  (127)
340 PLN02348 phosphoribulokinase    89.5    0.33 7.2E-06   48.2   3.4   28   55-82     48-75  (395)
341 COG4136 ABC-type uncharacteriz  89.4    0.31 6.8E-06   43.4   2.9   26   57-82     29-54  (213)
342 PRK14238 phosphate transporter  89.4     0.3 6.4E-06   44.9   2.9   24   57-80     51-74  (271)
343 PRK13646 cbiO cobalt transport  89.4    0.27 5.8E-06   45.6   2.7   25   57-81     34-58  (286)
344 TIGR01313 therm_gnt_kin carboh  89.4    0.26 5.6E-06   41.3   2.3   23   59-81      1-23  (163)
345 PF13086 AAA_11:  AAA domain; P  89.4    0.43 9.4E-06   40.8   3.8   23   58-80     19-41  (236)
346 PRK14243 phosphate transporter  89.4     0.3 6.6E-06   44.6   2.9   23   57-79     37-59  (264)
347 cd03290 ABCC_SUR1_N The SUR do  89.4    0.28 6.1E-06   43.2   2.6   24   57-80     28-51  (218)
348 cd03247 ABCC_cytochrome_bd The  89.4    0.29 6.4E-06   41.8   2.7   22   58-79     30-51  (178)
349 cd03300 ABC_PotA_N PotA is an   89.3    0.29 6.2E-06   43.7   2.7   25   56-80     26-50  (232)
350 PRK07429 phosphoribulokinase;   89.3    0.34 7.4E-06   46.6   3.3   28   54-81      6-33  (327)
351 cd03220 ABC_KpsT_Wzt ABC_KpsT_  89.3    0.27 5.8E-06   43.9   2.5   24   57-80     49-72  (224)
352 PRK14266 phosphate ABC transpo  89.3    0.31 6.7E-06   43.8   2.9   23   57-79     30-52  (250)
353 cd03228 ABCC_MRP_Like The MRP   89.3    0.31 6.6E-06   41.5   2.7   24   57-80     29-52  (171)
354 PRK13640 cbiO cobalt transport  89.3    0.28 6.1E-06   45.4   2.7   24   57-80     34-57  (282)
355 cd00878 Arf_Arl Arf (ADP-ribos  89.3    0.27 5.9E-06   40.1   2.3   21   59-79      2-22  (158)
356 cd01897 NOG NOG1 is a nucleola  89.3     0.3 6.4E-06   40.2   2.6   22   58-79      2-23  (168)
357 PRK10619 histidine/lysine/argi  89.3    0.28 6.1E-06   44.4   2.6   24   57-80     32-55  (257)
358 KOG2485|consensus               89.3    0.84 1.8E-05   44.3   5.9   25   57-81    144-168 (335)
359 PRK13644 cbiO cobalt transport  89.3    0.28 6.1E-06   45.2   2.7   24   57-80     29-52  (274)
360 PRK13641 cbiO cobalt transport  89.3    0.28 6.1E-06   45.5   2.7   25   57-81     34-58  (287)
361 PLN03046 D-glycerate 3-kinase;  89.3    0.33 7.3E-06   48.9   3.3   26   56-81    212-237 (460)
362 cd03250 ABCC_MRP_domain1 Domai  89.2    0.29 6.3E-06   42.6   2.6   23   58-80     33-55  (204)
363 cd03267 ABC_NatA_like Similar   89.2    0.28 6.1E-06   44.0   2.6   24   57-80     48-71  (236)
364 TIGR03771 anch_rpt_ABC anchore  89.2    0.29 6.2E-06   43.6   2.6   24   57-80      7-30  (223)
365 PRK13543 cytochrome c biogenes  89.2    0.29 6.2E-06   43.2   2.5   23   58-80     39-61  (214)
366 TIGR00017 cmk cytidylate kinas  89.2    0.35 7.7E-06   43.6   3.2   24   58-81      4-27  (217)
367 cd01857 HSR1_MMR1 HSR1/MMR1.    89.2    0.28 6.1E-06   40.4   2.4   22   58-79     85-106 (141)
368 TIGR01188 drrA daunorubicin re  89.2    0.28   6E-06   45.9   2.6   25   57-81     20-44  (302)
369 PRK13643 cbiO cobalt transport  89.0    0.29 6.3E-06   45.5   2.6   23   58-80     34-56  (288)
370 PRK14265 phosphate ABC transpo  89.0    0.31 6.6E-06   45.0   2.7   23   58-80     48-70  (274)
371 PRK14260 phosphate ABC transpo  89.0    0.34 7.3E-06   44.0   2.9   24   57-80     34-57  (259)
372 TIGR02868 CydC thiol reductant  89.0    0.28 6.1E-06   49.0   2.6   24   57-80    362-385 (529)
373 PRK10253 iron-enterobactin tra  88.9    0.28   6E-06   44.8   2.3   24   57-80     34-57  (265)
374 PRK13547 hmuV hemin importer A  88.9    0.29 6.3E-06   45.3   2.5   23   58-80     29-51  (272)
375 PRK14731 coaE dephospho-CoA ki  88.9    0.36 7.8E-06   42.9   3.0   23   57-79      6-28  (208)
376 PRK13635 cbiO cobalt transport  88.9    0.31 6.7E-06   45.1   2.6   24   58-81     35-58  (279)
377 cd03274 ABC_SMC4_euk Eukaryoti  88.9    0.34 7.4E-06   43.3   2.8   22   57-78     26-47  (212)
378 COG5019 CDC3 Septin family pro  88.9     1.2 2.6E-05   43.9   6.7   26   53-79     21-46  (373)
379 cd00880 Era_like Era (E. coli   88.8     0.2 4.4E-06   39.1   1.2   19   61-79      1-19  (163)
380 PRK09435 membrane ATPase/prote  88.8    0.62 1.4E-05   45.0   4.8   29   54-82     54-82  (332)
381 PRK14258 phosphate ABC transpo  88.8    0.32   7E-06   44.3   2.7   24   57-80     34-57  (261)
382 PRK13652 cbiO cobalt transport  88.8    0.32 6.8E-06   44.9   2.6   24   57-80     31-54  (277)
383 PRK13650 cbiO cobalt transport  88.8    0.32 6.9E-06   45.0   2.7   25   57-81     34-58  (279)
384 PRK14252 phosphate ABC transpo  88.8    0.33 7.2E-06   44.2   2.8   24   57-80     43-66  (265)
385 PRK04182 cytidylate kinase; Pr  88.7    0.41 8.9E-06   40.1   3.1   23   58-80      2-24  (180)
386 TIGR03411 urea_trans_UrtD urea  88.7    0.32   7E-06   43.4   2.5   24   57-80     29-52  (242)
387 smart00174 RHO Rho (Ras homolo  88.6    0.29 6.3E-06   40.5   2.1   21   59-79      1-21  (174)
388 cd04137 RheB Rheb (Ras Homolog  88.6    0.35 7.7E-06   40.5   2.6   21   59-79      4-24  (180)
389 TIGR01288 nodI ATP-binding ABC  88.6    0.32   7E-06   45.5   2.6   24   57-80     31-54  (303)
390 PF00910 RNA_helicase:  RNA hel  88.6    0.35 7.6E-06   38.4   2.5   24   59-82      1-24  (107)
391 PF00071 Ras:  Ras family;  Int  88.6    0.38 8.2E-06   39.3   2.7   21   59-79      2-22  (162)
392 COG1763 MobB Molybdopterin-gua  88.6    0.41 8.9E-06   41.8   3.1   28   56-83      2-29  (161)
393 PRK14271 phosphate ABC transpo  88.6    0.34 7.3E-06   44.8   2.7   24   57-80     48-71  (276)
394 TIGR02982 heterocyst_DevA ABC   88.6    0.35 7.5E-06   42.7   2.6   24   57-80     32-55  (220)
395 PRK08118 topology modulation p  88.5     0.4 8.7E-06   41.3   2.9   24   59-82      4-27  (167)
396 PF05729 NACHT:  NACHT domain    88.5    0.46   1E-05   38.6   3.2   25   58-82      2-26  (166)
397 PRK14275 phosphate ABC transpo  88.5    0.35 7.5E-06   45.0   2.7   23   57-79     66-88  (286)
398 PRK13631 cbiO cobalt transport  88.5    0.33 7.2E-06   46.2   2.6   24   57-80     53-76  (320)
399 cd04135 Tc10 TC10 subfamily.    88.5    0.37   8E-06   39.9   2.6   21   59-79      3-23  (174)
400 cd04157 Arl6 Arl6 subfamily.    88.5    0.32 6.9E-06   39.6   2.2   20   59-78      2-21  (162)
401 cd03213 ABCG_EPDR ABCG transpo  88.5    0.34 7.4E-06   42.3   2.5   24   57-80     36-59  (194)
402 PRK14254 phosphate ABC transpo  88.5    0.35 7.6E-06   45.0   2.7   24   57-80     66-89  (285)
403 PRK11153 metN DL-methionine tr  88.4    0.33 7.1E-06   46.5   2.6   24   57-80     32-55  (343)
404 PRK13647 cbiO cobalt transport  88.4    0.34 7.4E-06   44.6   2.6   25   57-81     32-56  (274)
405 PRK10418 nikD nickel transport  88.4    0.35 7.6E-06   43.8   2.6   24   57-80     30-53  (254)
406 PRK03695 vitamin B12-transport  88.4    0.31 6.7E-06   44.2   2.2   23   57-79     23-45  (248)
407 TIGR03873 F420-0_ABC_ATP propo  88.3    0.33 7.2E-06   43.9   2.4   24   57-80     28-51  (256)
408 PRK04213 GTP-binding protein;   88.3    0.33 7.1E-06   41.7   2.3   23   56-78      9-31  (201)
409 PRK13637 cbiO cobalt transport  88.3    0.35 7.6E-06   45.0   2.6   24   58-81     35-58  (287)
410 PRK14236 phosphate transporter  88.3    0.39 8.5E-06   44.1   2.9   24   57-80     52-75  (272)
411 PRK14246 phosphate ABC transpo  88.2    0.36 7.8E-06   44.1   2.6   23   58-80     38-60  (257)
412 PRK13642 cbiO cobalt transport  88.2    0.37   8E-06   44.4   2.7   24   58-81     35-58  (277)
413 cd04166 CysN_ATPS CysN_ATPS su  88.2    0.36 7.8E-06   42.5   2.5   21   59-79      2-22  (208)
414 cd03288 ABCC_SUR2 The SUR doma  88.1     0.4 8.6E-06   43.6   2.8   23   58-80     49-71  (257)
415 TIGR03015 pepcterm_ATPase puta  88.1    0.44 9.5E-06   42.8   3.0   25   57-81     44-68  (269)
416 cd04164 trmE TrmE (MnmE, ThdF,  88.1    0.38 8.2E-06   38.5   2.3   22   58-79      3-24  (157)
417 cd04132 Rho4_like Rho4-like su  88.0    0.42   9E-06   40.4   2.6   21   59-79      3-23  (187)
418 KOG0410|consensus               87.9    0.32   7E-06   47.6   2.2   27   52-78    174-200 (410)
419 cd01870 RhoA_like RhoA-like su  87.9    0.41 8.8E-06   39.7   2.5   21   59-79      4-24  (175)
420 PRK04040 adenylate kinase; Pro  87.9    0.49 1.1E-05   41.7   3.1   23   58-80      4-26  (188)
421 cd02027 APSK Adenosine 5'-phos  87.8    0.44 9.4E-06   40.1   2.7   24   58-81      1-24  (149)
422 TIGR01359 UMP_CMP_kin_fam UMP-  87.8    0.42 9.1E-06   40.6   2.6   23   58-80      1-23  (183)
423 cd04175 Rap1 Rap1 subgroup.  T  87.8    0.44 9.6E-06   39.2   2.7   22   58-79      3-24  (164)
424 cd04125 RabA_like RabA-like su  87.8    0.42 9.1E-06   40.7   2.6   21   59-79      3-23  (188)
425 TIGR03269 met_CoM_red_A2 methy  87.8     0.4 8.8E-06   48.0   2.9   24   57-80     27-50  (520)
426 PRK14263 phosphate ABC transpo  87.7    0.43 9.3E-06   43.7   2.8   24   57-80     35-58  (261)
427 COG1132 MdlB ABC-type multidru  87.7    0.37 8.1E-06   48.7   2.6   25   58-82    357-381 (567)
428 PRK05541 adenylylsulfate kinas  87.7    0.53 1.2E-05   40.0   3.2   25   57-81      8-32  (176)
429 cd01889 SelB_euk SelB subfamil  87.7    0.42 9.1E-06   41.1   2.6   21   59-79      3-23  (192)
430 PRK13634 cbiO cobalt transport  87.7     0.4 8.7E-06   44.6   2.6   25   57-81     34-58  (290)
431 PRK10218 GTP-binding protein;   87.7     2.5 5.5E-05   44.1   8.6   24   56-79      5-28  (607)
432 PRK14257 phosphate ABC transpo  87.7    0.41 8.8E-06   45.8   2.7   24   57-80    109-132 (329)
433 PRK10938 putative molybdenum t  87.7    0.38 8.3E-06   47.7   2.6   25   57-81     30-54  (490)
434 COG1100 GTPase SAR1 and relate  87.6    0.38 8.3E-06   41.6   2.3   25   57-81      6-30  (219)
435 PRK14264 phosphate ABC transpo  87.6    0.42 9.2E-06   44.8   2.7   23   58-80     73-95  (305)
436 PRK05433 GTP-binding protein L  87.6     1.9 4.2E-05   44.7   7.7   24   56-79      7-30  (600)
437 cd03289 ABCC_CFTR2 The CFTR su  87.6    0.45 9.8E-06   44.4   2.8   23   58-80     32-54  (275)
438 cd04129 Rho2 Rho2 subfamily.    87.5    0.45 9.7E-06   40.7   2.6   21   58-78      3-23  (187)
439 PLN03108 Rab family protein; P  87.5    0.45 9.8E-06   41.8   2.7   23   57-79      7-29  (210)
440 PRK15093 antimicrobial peptide  87.5    0.43 9.3E-06   45.4   2.7   23   58-80     35-57  (330)
441 PF00437 T2SE:  Type II/IV secr  87.5    0.54 1.2E-05   42.8   3.2   26   57-82    128-153 (270)
442 PRK11022 dppD dipeptide transp  87.4    0.42 9.1E-06   45.5   2.6   24   57-80     34-57  (326)
443 PRK00049 elongation factor Tu;  87.4     1.8 3.9E-05   42.4   7.0   27   53-79      9-35  (396)
444 PRK13546 teichoic acids export  87.4    0.42 9.1E-06   44.1   2.5   23   58-80     52-74  (264)
445 cd01892 Miro2 Miro2 subfamily.  87.4    0.61 1.3E-05   39.3   3.3   26   54-79      2-27  (169)
446 PLN03127 Elongation factor Tu;  87.4     2.7 5.9E-05   42.0   8.4   29   52-80     57-85  (447)
447 COG1121 ZnuC ABC-type Mn/Zn tr  87.4    0.44 9.4E-06   44.7   2.6   44   34-81     11-55  (254)
448 cd01673 dNK Deoxyribonucleosid  87.4    0.47   1E-05   40.8   2.6   23   58-80      1-23  (193)
449 TIGR00968 3a0106s01 sulfate AB  87.3    0.46 9.9E-06   42.6   2.7   24   57-80     27-50  (237)
450 cd03291 ABCC_CFTR1 The CFTR su  87.2    0.45 9.7E-06   44.5   2.6   24   57-80     64-87  (282)
451 cd01129 PulE-GspE PulE/GspE Th  87.2    0.47   1E-05   44.1   2.7   45   34-81     61-105 (264)
452 PRK11000 maltose/maltodextrin   87.2    0.43 9.4E-06   46.3   2.6   24   57-80     30-53  (369)
453 PRK15467 ethanolamine utilizat  87.2    0.39 8.4E-06   40.5   2.0   20   59-78      4-23  (158)
454 cd01855 YqeH YqeH.  YqeH is an  87.1     0.5 1.1E-05   40.7   2.7   22   58-79    129-150 (190)
455 PRK13633 cobalt transporter AT  87.1    0.45 9.8E-06   43.9   2.6   24   58-81     38-61  (280)
456 cd04177 RSR1 RSR1 subgroup.  R  87.1    0.52 1.1E-05   39.2   2.7   21   59-79      4-24  (168)
457 cd03272 ABC_SMC3_euk Eukaryoti  87.0    0.48   1E-05   42.2   2.6   20   58-77     25-44  (243)
458 PRK13639 cbiO cobalt transport  87.0    0.46   1E-05   43.7   2.6   23   58-80     30-52  (275)
459 KOG2655|consensus               87.0     1.6 3.4E-05   43.0   6.3   21   59-79     24-44  (366)
460 cd03283 ABC_MutS-like MutS-lik  86.9    0.52 1.1E-05   41.8   2.7   23   57-79     26-48  (199)
461 COG4107 PhnK ABC-type phosphon  86.9    0.46   1E-05   43.3   2.4   29   54-82     30-58  (258)
462 cd04128 Spg1 Spg1p.  Spg1p (se  86.8     2.2 4.8E-05   36.7   6.6   21   59-79      3-23  (182)
463 PRK14737 gmk guanylate kinase;  86.8    0.94   2E-05   39.8   4.3   22   58-79      6-27  (186)
464 PRK13900 type IV secretion sys  86.8     0.5 1.1E-05   45.5   2.8   24   58-81    162-185 (332)
465 TIGR02142 modC_ABC molybdenum   86.8    0.48   1E-05   45.5   2.6   25   57-81     24-48  (354)
466 cd00267 ABC_ATPase ABC (ATP-bi  86.7    0.53 1.2E-05   39.3   2.6   24   57-80     26-49  (157)
467 PRK13636 cbiO cobalt transport  86.7     0.5 1.1E-05   43.8   2.6   24   58-81     34-57  (283)
468 smart00053 DYNc Dynamin, GTPas  86.7    0.44 9.6E-06   44.0   2.3   22   58-79     28-49  (240)
469 PRK14738 gmk guanylate kinase;  86.7    0.87 1.9E-05   40.3   4.1   23   57-79     14-36  (206)
470 TIGR00041 DTMP_kinase thymidyl  86.7    0.68 1.5E-05   39.7   3.3   25   58-82      5-29  (195)
471 cd04170 EF-G_bact Elongation f  86.7    0.54 1.2E-05   43.0   2.8   21   59-79      2-22  (268)
472 PLN03071 GTP-binding nuclear p  86.7     2.3 4.9E-05   37.8   6.7   26   54-79     11-36  (219)
473 COG1124 DppF ABC-type dipeptid  86.6    0.51 1.1E-05   44.2   2.6   26   57-82     34-59  (252)
474 PRK10851 sulfate/thiosulfate t  86.6     0.5 1.1E-05   45.7   2.6   24   57-80     29-52  (353)
475 TIGR03522 GldA_ABC_ATP gliding  86.6    0.51 1.1E-05   44.2   2.6   24   57-80     29-52  (301)
476 TIGR01186 proV glycine betaine  86.6    0.47   1E-05   46.2   2.5   24   58-81     21-44  (363)
477 PRK09554 feoB ferrous iron tra  86.6       1 2.2E-05   48.2   5.1   21   58-78      5-25  (772)
478 cd03279 ABC_sbcCD SbcCD and ot  86.5    0.54 1.2E-05   41.6   2.6   22   58-79     30-51  (213)
479 PRK10762 D-ribose transporter   86.5    0.47   1E-05   47.4   2.5   25   57-81     31-55  (501)
480 cd01881 Obg_like The Obg-like   86.4    0.34 7.5E-06   39.8   1.3   19   61-79      1-19  (176)
481 COG0486 ThdF Predicted GTPase   86.4    0.44 9.6E-06   48.0   2.3   24   59-82    220-243 (454)
482 PRK13549 xylose transporter AT  86.4    0.48   1E-05   47.4   2.5   24   57-80     32-55  (506)
483 COG0396 sufC Cysteine desulfur  86.4    0.49 1.1E-05   44.2   2.3   24   57-80     31-54  (251)
484 PRK00889 adenylylsulfate kinas  86.4    0.75 1.6E-05   39.0   3.4   28   55-82      3-30  (175)
485 PRK15134 microcin C ABC transp  86.3    0.51 1.1E-05   47.4   2.6   24   58-81     37-60  (529)
486 PRK11174 cysteine/glutathione   86.3     0.5 1.1E-05   47.9   2.5   24   57-80    377-400 (588)
487 TIGR03420 DnaA_homol_Hda DnaA   86.2     0.8 1.7E-05   40.0   3.6   43   37-81     21-63  (226)
488 PRK11144 modC molybdate transp  86.2    0.53 1.1E-05   45.3   2.6   23   58-80     26-48  (352)
489 PRK14730 coaE dephospho-CoA ki  86.2    0.68 1.5E-05   40.9   3.1   22   58-79      3-24  (195)
490 cd04158 ARD1 ARD1 subfamily.    86.1    0.55 1.2E-05   39.3   2.4   20   59-78      2-21  (169)
491 cd01893 Miro1 Miro1 subfamily.  86.1    0.63 1.4E-05   38.7   2.7   21   59-79      3-23  (166)
492 cd02022 DPCK Dephospho-coenzym  86.1    0.56 1.2E-05   40.4   2.5   21   58-78      1-21  (179)
493 PF07724 AAA_2:  AAA domain (Cd  86.1    0.72 1.6E-05   40.1   3.1   28   54-81      1-28  (171)
494 PRK15439 autoinducer 2 ABC tra  86.0    0.53 1.1E-05   47.2   2.6   25   57-81     38-62  (510)
495 PRK10261 glutathione transport  86.0     0.5 1.1E-05   48.8   2.5   25   57-81     43-67  (623)
496 PRK08356 hypothetical protein;  86.0    0.62 1.3E-05   40.6   2.7   21   58-78      7-27  (195)
497 TIGR00750 lao LAO/AO transport  86.0     1.1 2.3E-05   42.1   4.5   30   53-82     31-60  (300)
498 cd03273 ABC_SMC2_euk Eukaryoti  85.9    0.64 1.4E-05   42.1   2.8   25   57-81     26-50  (251)
499 TIGR02633 xylG D-xylose ABC tr  85.9    0.52 1.1E-05   46.9   2.5   24   57-80     28-51  (500)
500 PRK13549 xylose transporter AT  85.8    0.53 1.2E-05   47.0   2.5   23   58-80    290-312 (506)

No 1  
>PF02263 GBP:  Guanylate-binding protein, N-terminal domain;  InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma. GTPases induced by IFN-gamma are key to the protective immunity against microbial and viral pathogens. These GTPases are classified into three groups: the small 47-kd GTPases, the Mx proteins, and the large 65- to 67-kd GTPases. Guanylate-binding proteins (GBP) fall into the last class. In humans, there are seven GBPs (hGBP1-7) []. Structurally, hGBP1 consists of two domains: a compact globular N-terminal domain harbouring the GTPase function, and an alpha-helical finger-like C-terminal domain (IPR003191 from INTERPRO). Human GBP1 is secreted from cells without the need of a leader peptide, and has been shown to exhibit antiviral activity against Vesicular stomatitis virus and Encephalomyocarditis virus, as well as being able to regulate the inhibition of proliferation and invasion of endothelial cells in response to IFN-gamma [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3QOF_A 3Q5E_C 3QNU_A 3Q5D_A 1DG3_A 2D4H_A 2B8W_B 2B92_A 2BC9_A 1F5N_A.
Probab=100.00  E-value=1.3e-43  Score=325.13  Aligned_cols=149  Identities=50%  Similarity=0.725  Sum_probs=130.1

Q ss_pred             CceEEeCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhhhcccccCCCCCCCCCCCCCCCCcccCCCCc
Q psy5031          32 KHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSE  111 (281)
Q Consensus        32 ~~~l~ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~e  111 (281)
                      +++|++|+||++.| .   ..++||+||||+|+||||||||||+|++                                 
T Consensus         1 ~~~~~~~~~al~~l-~---~~~~~v~vvsi~G~~rtGKSfLln~l~~---------------------------------   43 (260)
T PF02263_consen    1 DNKLELNEEALEIL-Q---QIDQPVAVVSIVGPYRTGKSFLLNQLLG---------------------------------   43 (260)
T ss_dssp             TTEEEE-HHHHHHH-C---TTTSBEEEEEEEEETTSSHHHHHHHHCC---------------------------------
T ss_pred             CCeEEECHHHHHHH-h---cCCCCEEEEEeecCCccchHHHHHHHhc---------------------------------
Confidence            58999999999966 2   3689999999999999999999999942                                 


Q ss_pred             ccccceeeeeceEEeecCCcccchhhccCchhHHHHHHhhhcccccccCCCCCCCCCCCCCCCCcccCCCCCCcccceEe
Q psy5031         112 RDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILM  191 (281)
Q Consensus       112 ~~t~gi~~~s~~~~~~~~~~~~~~~~r~gkS~Lln~l~~~~~~~~~~~~~~~~~~~~~~~~~~gF~~~~~~~~~TkGIWm  191 (281)
                                                                                  ...||+|+++.++||+||||
T Consensus        44 ------------------------------------------------------------~~~gF~~~~~~~~~T~Giw~   63 (260)
T PF02263_consen   44 ------------------------------------------------------------PQSGFSWGPTVEPCTKGIWM   63 (260)
T ss_dssp             ------------------------------------------------------------BSSSSESSSCSSST-SCEEE
T ss_pred             ------------------------------------------------------------ccccccccCCCCCCCcceee
Confidence                                                                        13799999999999999999


Q ss_pred             eecceeecCCCCCceEEEEEecCCCCC-CCcCcccchhhHHHHHhhhhhhhhccCCCCChhhhhHhHHHHHHHHHHh---
Q psy5031         192 WSHVYIATLPTGEKAAVILLDTQGTFD-SESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGRLAL---  267 (281)
Q Consensus       192 Ws~P~~~~~~~g~~v~VlLlDTEG~~d-~~~s~~~d~~IFaLs~LLSS~~IYNs~~~Ide~~L~~L~l~t~~a~~i~---  267 (281)
                      |++|    .+.+++++|+||||||++| ...+..+|++||+|++||||++|||+++.|++++|++|++++++|++|+   
T Consensus        64 w~~~----~~~~~~~~v~llDteG~~~~~~~~~~~d~~if~Ls~LLSS~~IyN~~~~i~~~~l~~L~~~~~l~~~i~~~~  139 (260)
T PF02263_consen   64 WSEP----LPDGEKVAVVLLDTEGLGDVEQSDEKYDAKIFALSMLLSSVLIYNSMGNIDEDDLDQLELFTELAKHIRVKY  139 (260)
T ss_dssp             ECCE-----TTSTCEEEEEEEEECBTTTTCCCCHHCHHHHHHHHHH-SEEEEEECSSSSHHHHHCCHHHHHHHHHHHHTH
T ss_pred             eecc----cccccceeEEEecchhccccccCcccccHHHHHHHHHHhCceeeCCCCccchhHHHHHHHHHHHHHHHHHhc
Confidence            9999    3688899999999999999 4556788999999999999999999999999999999999999998764   


Q ss_pred             -----hccCCCCCcccccC
Q psy5031         268 -----ADTGTKPFQRLQFL  281 (281)
Q Consensus       268 -----~~~~~~pfq~L~fl  281 (281)
                           .+....|||+|.||
T Consensus       140 ~~~~~~~~~~~~fp~l~wl  158 (260)
T PF02263_consen  140 GDSADSEDLGKPFPSLVWL  158 (260)
T ss_dssp             HHHHHHHCTTTTCEEEEEE
T ss_pred             ccccchhhhcccchHHHHH
Confidence                 34468999999886


No 2  
>KOG2037|consensus
Probab=100.00  E-value=1.6e-36  Score=302.75  Aligned_cols=214  Identities=46%  Similarity=0.666  Sum_probs=192.3

Q ss_pred             EEEEeCCCceEEeCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhhhcccccCCCCCCCCCCCCCCCCc
Q psy5031          25 QIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGF  104 (281)
Q Consensus        25 qLV~~~~~~~l~ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~~~~~~~~~~~~~~~~~~~~~~f  104 (281)
                      +.+..|..+++.+|| |++.+ +   ...+||+||+|+|.||+||||+||.++..                     ..+|
T Consensus         6 ~~~~~~~~~~l~~~p-a~~~l-~---~~~~p~~Vv~i~g~~~~gksfiln~la~~---------------------~~gf   59 (552)
T KOG2037|consen    6 MLLYENENGQLKVNP-ALEIL-Q---AIKQPVAVVAIVGLYRTGKSFILNQLAGK---------------------RIGF   59 (552)
T ss_pred             hhhhhccccccccCc-chhHH-h---hccCCceEEEEEEEEcCCCceehhhhHhh---------------------hcCC
Confidence            344446789999999 99844 3   24689999999999999999999999754                     3689


Q ss_pred             ccCCCCcccccceeeeeceEEeecCCcccchhhccCchhHHHHHHhhhcccccccCCCCCCCCCCCCCCCCcccCCCCCC
Q psy5031         105 SWRGGSERDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSER  184 (281)
Q Consensus       105 ~~~~~~e~~t~gi~~~s~~~~~~~~~~~~~~~~r~gkS~Lln~l~~~~~~~~~~~~~~~~~~~~~~~~~~gF~~~~~~~~  184 (281)
                      .+..++.|+|.|||||+.|               .||||++|++|.++.-.++ +..+.+|.. ...++.+|.|+.++++
T Consensus        60 ~~~s~~~~~~~~~w~w~~p---------------~~k~~~~~l~Lld~eg~~~-~~~~~~w~~-~~~~l~~~~~~~~s~~  122 (552)
T KOG2037|consen   60 SVASTDKPVTKGIWMWCVP---------------HGKSFLLNLVLLDTEGLKG-DNENDDWIF-ALAPLLSSTWVYGSEG  122 (552)
T ss_pred             CcccccccceeeEEEEEee---------------cCCccchhhhhhccccccC-Cccchhhhh-ccchhhcceeeccCCc
Confidence            9999999999999999755               6899999999999731111 255789998 6788999999999999


Q ss_pred             cccceEeeecceeecCCCCCceEEEEEecCCCCCCCcCcccchhhHHHHHhhhhhhhhccCCCCChhhhhHhHHHHHHHH
Q psy5031         185 DTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSESTVRDCATVFALSTMLSSIQIYNLSQNIQEDDLQHLQLFTEYGR  264 (281)
Q Consensus       185 ~TkGIWmWs~P~~~~~~~g~~v~VlLlDTEG~~d~~~s~~~d~~IFaLs~LLSS~~IYNs~~~Ide~~L~~L~l~t~~a~  264 (281)
                      .|.|||||+.||+.+.++|.++++.++||+|.++...+...+...|++++++||+.|||....|+++++++|++++++++
T Consensus       123 ~~~~~~~~~~~~~~~~~e~~k~~~~l~~~~~a~~~~~~~~~~~p~fa~tt~~~slqi~~~~q~i~ed~l~~l~l~~~~g~  202 (552)
T KOG2037|consen  123 TINGIAMWQLPFVTELTEGIKVASSLMDTQGAFDDQSTFRSCFPDFALTTMDSSLQIYNDSQNIQEDDLQHLSLFTEYGR  202 (552)
T ss_pred             ccchheecccceeeecCCcceeccccccccccccccccHHHhcchhhceeeeeehhhhcccCcCCHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHhhccCCCCCcccccC
Q psy5031         265 LALADTGTKPFQRLQFL  281 (281)
Q Consensus       265 ~i~~~~~~~pfq~L~fl  281 (281)
                      .+..+...+|||+|+||
T Consensus       203 ~~l~~~~~kp~q~L~~~  219 (552)
T KOG2037|consen  203 LALAHLFKKPFQDLKFL  219 (552)
T ss_pred             HHHHHhccCcHHHHHHH
Confidence            99999999999999985


No 3  
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons.  The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins.  They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase.  In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins.  The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein
Probab=99.97  E-value=2.3e-30  Score=232.66  Aligned_cols=104  Identities=40%  Similarity=0.496  Sum_probs=93.6

Q ss_pred             CCcccCCCCCCcccceEeeecceeecCCCCCceEEEEEecCCCCCCCcCc-ccchhhHHHHHhhhhhhhhccCCCCChhh
Q psy5031         174 EGFSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSESTV-RDCATVFALSTMLSSIQIYNLSQNIQEDD  252 (281)
Q Consensus       174 ~gF~~~~~~~~~TkGIWmWs~P~~~~~~~g~~v~VlLlDTEG~~d~~~s~-~~d~~IFaLs~LLSS~~IYNs~~~Ide~~  252 (281)
                      .+|+++++..+||+|||||..|+..    +++.+|+||||||+.+.+++. .++++||+|++|+||++|||+.+.+++.+
T Consensus        32 ~~f~~~~~~~~~T~gi~~~~~~~~~----~~~~~v~~lDteG~~~~~~~~~~~~~~~~~l~~llss~~i~n~~~~~~~~~  107 (224)
T cd01851          32 SGFDVMDTSQQTTKGIWMWSVPFKL----GKEHAVLLLDTEGTDGRERGEFEDDARLFALATLLSSVLIYNSWETILGDD  107 (224)
T ss_pred             CCeEecCCCCCCccceEEEeccccC----CCcceEEEEecCCcCccccCchhhhhHHHHHHHHHhCEEEEeccCcccHHH
Confidence            5899999999999999999999964    566889999999999999988 89999999999999999999999999999


Q ss_pred             hhHhHHHHHHH----HHHhhccCCCCCcccccC
Q psy5031         253 LQHLQLFTEYG----RLALADTGTKPFQRLQFL  281 (281)
Q Consensus       253 L~~L~l~t~~a----~~i~~~~~~~pfq~L~fl  281 (281)
                      +++|+.+++.+    +.+......+||++|.|+
T Consensus       108 ~~~l~~~~~~~~~~~~~~~~~~~~~~~p~ll~v  140 (224)
T cd01851         108 LAALMGLLKTTLEVLGLAGLTEFEKPKPLLLFV  140 (224)
T ss_pred             HHHHHHHHHHHHHhhhhhhhhhcccCCCceEEE
Confidence            99999999975    344556789999999874


No 4  
>KOG2203|consensus
Probab=99.31  E-value=2.9e-12  Score=128.40  Aligned_cols=155  Identities=23%  Similarity=0.386  Sum_probs=105.0

Q ss_pred             CCCeeEEEEeCCCceEEeCHHHHHHHHcccCCC--CceEEEEEEecccccChhHHHHHHHHhhhhcccccCCCCCCCCCC
Q psy5031          20 QYGAIQIVKSEEKHKFILDYEALERILLQDHVK--DKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPD   97 (281)
Q Consensus        20 ~~~pvqLV~~~~~~~l~ln~eal~~il~~~~~~--~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~~~~~~~~~~~~~~~~   97 (281)
                      ...+.|||  +++++  +|..+|..+.+...+.  +-.++||||.|++.||||+|||+|.+-                  
T Consensus         3 dr~stQlI--De~ke--Fn~s~l~~F~q~vgl~d~Gl~YhVVavmG~QSSGKSTLLN~LFgT------------------   60 (772)
T KOG2203|consen    3 DRCSTQLI--DEEKE--FNVSGLDYFQQCVGLRDCGLSYHVVAVMGSQSSGKSTLLNHLFGT------------------   60 (772)
T ss_pred             Ccccceee--ccccc--cchhhHHHHHHHhcccccCcceeEEEEecCcccchHHHHHHHhcc------------------
Confidence            45678999  45555  7777887765532222  678999999999999999999999532                  


Q ss_pred             CCCCCCcccCCCCcccccceeeeeceEEeecCCcccchhhccCchhHHHHHHhhhcccccccCCCCCCCCCCCCCCCCcc
Q psy5031          98 DVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFS  177 (281)
Q Consensus        98 ~~~~~~f~~~~~~e~~t~gi~~~s~~~~~~~~~~~~~~~~r~gkS~Lln~l~~~~~~~~~~~~~~~~~~~~~~~~~~gF~  177 (281)
                           +|.                           +++||+                                       
T Consensus        61 -----nF~---------------------------~MDA~~---------------------------------------   69 (772)
T KOG2203|consen   61 -----NFR---------------------------EMDAFK---------------------------------------   69 (772)
T ss_pred             -----ChH---------------------------HHHhhh---------------------------------------
Confidence                 111                           233332                                       


Q ss_pred             cCCCCCCcccceEeeecceeecCCCCCceEEEEEecCCCCCCCc----CcccchhhHHHHHhhhhhhhhccC----CCCC
Q psy5031         178 WRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFDSES----TVRDCATVFALSTMLSSIQIYNLS----QNIQ  249 (281)
Q Consensus       178 ~~~~~~~~TkGIWmWs~P~~~~~~~g~~v~VlLlDTEG~~d~~~----s~~~d~~IFaLs~LLSS~~IYNs~----~~Id  249 (281)
                         |++..|+|||+-.       ..|-+..+++||.||..+.++    +++..+.|||++  .|-++|.|..    |.-+
T Consensus        70 ---gRqQTTKGIWlar-------~~~i~p~i~vmDvEGTDGrERGEDqdFErksALFaia--vSevvivNMW~~qIG~~Q  137 (772)
T KOG2203|consen   70 ---GRQQTTKGIWLAR-------CAGIEPCILVMDVEGTDGRERGEDQDFERKSALFAIA--VSEVVIVNMWEHQIGLYQ  137 (772)
T ss_pred             ---ccccccchhhHHh-------hcCCCCceEEEecccCCcccccccccHHHHhHHHHHh--hhheehhhHHHHHhhHhh
Confidence               3456899999842       134445699999999988866    556689999988  5999999973    3444


Q ss_pred             hhhhhHhH----HHHHH----HH------HHhhccCCCCCcccc
Q psy5031         250 EDDLQHLQ----LFTEY----GR------LALADTGTKPFQRLQ  279 (281)
Q Consensus       250 e~~L~~L~----l~t~~----a~------~i~~~~~~~pfq~L~  279 (281)
                      .+..--|.    ++.++    -+      .|+++-+.+|.-+|.
T Consensus       138 ~aN~~LLKTVfeV~lrLF~~rk~k~~LlFVIRD~~~~TplenLe  181 (772)
T KOG2203|consen  138 GANMALLKTVFEVNLRLFSPRKNKTLLLFVIRDKTGVTPLENLE  181 (772)
T ss_pred             ccCcHHHHHHHHHHHHHhCCCCCceEEEEEEecccCCCchHHhh
Confidence            44444333    22332    11      357777888887763


No 5  
>KOG2037|consensus
Probab=99.28  E-value=3.2e-12  Score=128.85  Aligned_cols=116  Identities=29%  Similarity=0.368  Sum_probs=99.7

Q ss_pred             cCCCCCeeEEEEe--CCCceEEeCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhhhcccccCCCCCCC
Q psy5031          17 SLPQYGAIQIVKS--EEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWM   94 (281)
Q Consensus        17 ~~~~~~pvqLV~~--~~~~~l~ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~~~~~~~~~~~~~   94 (281)
                      ....|.||+.|-.  +.++.|.+|+.|++.|+.+....++|+++++++|.+|.||||++|++|+++.... -+..+.+|.
T Consensus        27 ~~~~p~~Vv~i~g~~~~gksfiln~la~~~~gf~~~s~~~~~~~~~w~w~~p~~k~~~~~l~Lld~eg~~-~~~~~~~w~  105 (552)
T KOG2037|consen   27 AIKQPVAVVAIVGLYRTGKSFILNQLAGKRIGFSVASTDKPVTKGIWMWCVPHGKSFLLNLVLLDTEGLK-GDNENDDWI  105 (552)
T ss_pred             hccCCceEEEEEEEEcCCCceehhhhHhhhcCCCcccccccceeeEEEEEeecCCccchhhhhhcccccc-CCccchhhh
Confidence            3567888888877  6788999999999999998888899999999999999999999999999987642 223456888


Q ss_pred             CCCCCCCCCcccCCCCcccccceeeeeceEEeecCCcccc
Q psy5031          95 GPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKV  134 (281)
Q Consensus        95 ~~~~~~~~~f~~~~~~e~~t~gi~~~s~~~~~~~~~~~~~  134 (281)
                      . .-.+.-+|.|+.+.++.|.|||||++++++....|.++
T Consensus       106 ~-~~~~l~~~~~~~~s~~~~~~~~~~~~~~~~~~~e~~k~  144 (552)
T KOG2037|consen  106 F-ALAPLLSSTWVYGSEGTINGIAMWQLPFVTELTEGIKV  144 (552)
T ss_pred             h-ccchhhcceeeccCCcccchheecccceeeecCCccee
Confidence            7 56788899999999999999999999999976666653


No 6  
>PF05879 RHD3:  Root hair defective 3 GTP-binding protein (RHD3);  InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins. It has been speculated that the RHD3 protein is a member of a novel class of GTP-binding proteins that is widespread in eukaryotes and required for regulated cell enlargement []. The family also contains the homologous Saccharomyces cerevisiae synthetic construct enhancement of YOP1 (SEY1) protein which is involved in membrane trafficking [].; GO: 0016817 hydrolase activity, acting on acid anhydrides
Probab=98.86  E-value=1.4e-09  Score=113.73  Aligned_cols=117  Identities=27%  Similarity=0.424  Sum_probs=81.2

Q ss_pred             chhhccCchhHHHHHHhhhcccccccCCCCCCCCCCCCCCCCcccCC--CCCCcccceEeeecceeecCCCCCceEEEEE
Q psy5031         134 VSAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRG--GSERDTTGILMWSHVYIATLPTGEKAAVILL  211 (281)
Q Consensus       134 ~~~~r~gkS~Lln~l~~~~~~~~~~~~~~~~~~~~~~~~~~gF~~~~--~~~~~TkGIWmWs~P~~~~~~~g~~v~VlLl  211 (281)
                      +|++.+|||+|||.|.+.                       .|.+..  ++.+||+||||-.-+...    .....+++|
T Consensus         1 ~g~qssgkstlln~lf~t-----------------------~f~~m~~~~r~qtt~gi~~~~~~~~~----~~~~~~~v~   53 (742)
T PF05879_consen    1 FGSQSSGKSTLLNHLFGT-----------------------QFDVMDESGRQQTTKGIWMAKAKEVE----SSESNILVL   53 (742)
T ss_pred             CCCCCCcHHHHHHHHHCC-----------------------CccccccccccccchhhHHHhccccc----cCCCceEEE
Confidence            478899999999999884                       466544  567899999995433321    223569999


Q ss_pred             ecCCCCCCCc----CcccchhhHHHHHhhhhhhhhcc----CCCCChhhhhHh--------HHHHHHH----H-----HH
Q psy5031         212 DTQGTFDSES----TVRDCATVFALSTMLSSIQIYNL----SQNIQEDDLQHL--------QLFTEYG----R-----LA  266 (281)
Q Consensus       212 DTEG~~d~~~----s~~~d~~IFaLs~LLSS~~IYNs----~~~Ide~~L~~L--------~l~t~~a----~-----~i  266 (281)
                      |+||..+.++    ++++.+.||||+  +|.++|.|.    .|..+.+.+.-|        ++|..-.    +     .|
T Consensus        54 d~eg~d~~er~~~~~fe~~~alf~la--~s~~~iiN~w~~~iG~~~~an~~lLktvfevnl~lf~~~~~~~~k~~llfvi  131 (742)
T PF05879_consen   54 DVEGTDGRERGEDQDFERKSALFALA--VSDVLIINMWEHDIGRYQGANMGLLKTVFEVNLQLFGKSKSNDRKTLLLFVI  131 (742)
T ss_pred             eCCCCCchhhccccchHHHHHHHHHH--hhhheeeehhhhhhhhhcccchHHHHHHHHHHHHHHhhcccCCCCceEEEEE
Confidence            9999988866    455678899887  599999999    355555555444        4442211    0     24


Q ss_pred             hhccCCCCCcccc
Q psy5031         267 LADTGTKPFQRLQ  279 (281)
Q Consensus       267 ~~~~~~~pfq~L~  279 (281)
                      +|+.+.+|+.+|.
T Consensus       132 RD~~~~tp~e~l~  144 (742)
T PF05879_consen  132 RDHTGVTPLENLE  144 (742)
T ss_pred             eeCCCCCcHHHHH
Confidence            7777778887663


No 7  
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1).  This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria.  The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2.  AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family.  The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections.  The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).
Probab=97.70  E-value=0.00019  Score=62.41  Aligned_cols=21  Identities=24%  Similarity=0.213  Sum_probs=18.5

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+++|..++|||.|+|.|++.
T Consensus         3 i~lvG~~g~GKSsl~N~ilg~   23 (196)
T cd01852           3 LVLVGKTGAGKSATGNTILGR   23 (196)
T ss_pred             EEEECCCCCCHHHHHHHhhCC
Confidence            678999999999999999743


No 8  
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=97.65  E-value=0.00019  Score=63.91  Aligned_cols=60  Identities=25%  Similarity=0.354  Sum_probs=30.4

Q ss_pred             eEEEEEecCCCCCCCcCcccc-hhhHHHHHhhhh----hhhhcc-CCCCChhhhhHhHHHHHH-HHHH
Q psy5031         206 AAVILLDTQGTFDSESTVRDC-ATVFALSTMLSS----IQIYNL-SQNIQEDDLQHLQLFTEY-GRLA  266 (281)
Q Consensus       206 v~VlLlDTEG~~d~~~s~~~d-~~IFaLs~LLSS----~~IYNs-~~~Ide~~L~~L~l~t~~-a~~i  266 (281)
                      ..|.++||+|+++...+...- ..|.. +..++.    .+||=+ .+.+++.+...++.+.++ +..+
T Consensus        49 ~~v~VIDTPGl~d~~~~~~~~~~~i~~-~l~~~~~g~ha~llVi~~~r~t~~~~~~l~~l~~~FG~~~  115 (212)
T PF04548_consen   49 RQVTVIDTPGLFDSDGSDEEIIREIKR-CLSLCSPGPHAFLLVIPLGRFTEEDREVLELLQEIFGEEI  115 (212)
T ss_dssp             EEEEEEE--SSEETTEEHHHHHHHHHH-HHHHTTT-ESEEEEEEETTB-SHHHHHHHHHHHHHHCGGG
T ss_pred             eEEEEEeCCCCCCCcccHHHHHHHHHH-HHHhccCCCeEEEEEEecCcchHHHHHHHHHHHHHccHHH
Confidence            568999999998886642211 11211 112222    222222 237888888888777763 4433


No 9  
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=97.39  E-value=0.0007  Score=53.65  Aligned_cols=20  Identities=35%  Similarity=0.431  Sum_probs=18.3

Q ss_pred             EEEecccccChhHHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~   78 (281)
                      |+|+|+.++|||+|+|.|++
T Consensus         2 V~iiG~~~~GKSTlin~l~~   21 (116)
T PF01926_consen    2 VAIIGRPNVGKSTLINALTG   21 (116)
T ss_dssp             EEEEESTTSSHHHHHHHHHT
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            68999999999999999974


No 10 
>COG1159 Era GTPase [General function prediction only]
Probab=97.14  E-value=0.001  Score=63.33  Aligned_cols=27  Identities=30%  Similarity=0.273  Sum_probs=24.1

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      ..+...|||+|...+|||+|||+|+++
T Consensus         3 ~~ksGfVaIiGrPNvGKSTLlN~l~G~   29 (298)
T COG1159           3 KFKSGFVAIIGRPNVGKSTLLNALVGQ   29 (298)
T ss_pred             CceEEEEEEEcCCCCcHHHHHHHHhcC
Confidence            356789999999999999999999865


No 11 
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=97.02  E-value=0.0042  Score=57.30  Aligned_cols=26  Identities=19%  Similarity=0.218  Sum_probs=21.9

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+-.-|.++|..++|||.|+|.|++.
T Consensus        29 ~~~~~IllvG~tGvGKSSliNaLlg~   54 (249)
T cd01853          29 DFSLTILVLGKTGVGKSSTINSIFGE   54 (249)
T ss_pred             cCCeEEEEECCCCCcHHHHHHHHhCC
Confidence            45567889999999999999999753


No 12 
>PRK00089 era GTPase Era; Reviewed
Probab=96.98  E-value=0.0029  Score=58.38  Aligned_cols=26  Identities=31%  Similarity=0.289  Sum_probs=22.9

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+-.+|+|+|+.++|||+|+|.|++.
T Consensus         3 ~~~g~V~iiG~pn~GKSTLin~L~g~   28 (292)
T PRK00089          3 FKSGFVAIVGRPNVGKSTLLNALVGQ   28 (292)
T ss_pred             ceeEEEEEECCCCCCHHHHHHHHhCC
Confidence            45788999999999999999999754


No 13 
>PF02263 GBP:  Guanylate-binding protein, N-terminal domain;  InterPro: IPR015894 Guanylate-binding protein is a GTPase that is induced by interferon (IFN)-gamma. GTPases induced by IFN-gamma are key to the protective immunity against microbial and viral pathogens. These GTPases are classified into three groups: the small 47-kd GTPases, the Mx proteins, and the large 65- to 67-kd GTPases. Guanylate-binding proteins (GBP) fall into the last class. In humans, there are seven GBPs (hGBP1-7) []. Structurally, hGBP1 consists of two domains: a compact globular N-terminal domain harbouring the GTPase function, and an alpha-helical finger-like C-terminal domain (IPR003191 from INTERPRO). Human GBP1 is secreted from cells without the need of a leader peptide, and has been shown to exhibit antiviral activity against Vesicular stomatitis virus and Encephalomyocarditis virus, as well as being able to regulate the inhibition of proliferation and invasion of endothelial cells in response to IFN-gamma [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3QOF_A 3Q5E_C 3QNU_A 3Q5D_A 1DG3_A 2D4H_A 2B8W_B 2B92_A 2BC9_A 1F5N_A.
Probab=96.73  E-value=0.00086  Score=61.94  Aligned_cols=21  Identities=52%  Similarity=0.898  Sum_probs=18.9

Q ss_pred             CcccCCCCcccccceeeeece
Q psy5031         103 GFSWRGGSERDTTGILMWSHV  123 (281)
Q Consensus       103 ~f~~~~~~e~~t~gi~~~s~~  123 (281)
                      +|+|+++.+|+|.|||||+.|
T Consensus        47 gF~~~~~~~~~T~Giw~w~~~   67 (260)
T PF02263_consen   47 GFSWGPTVEPCTKGIWMWSEP   67 (260)
T ss_dssp             SSESSSCSSST-SCEEEECCE
T ss_pred             cccccCCCCCCCcceeeeecc
Confidence            489999999999999999988


No 14 
>KOG4181|consensus
Probab=96.50  E-value=0.003  Score=61.83  Aligned_cols=49  Identities=20%  Similarity=0.260  Sum_probs=36.5

Q ss_pred             CeeEEEEeCCCceEEeCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHh
Q psy5031          22 GAIQIVKSEEKHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        22 ~pvqLV~~~~~~~l~ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      ++++||  ++.|.  +|..|.+.+..     ...+-||||.|+++||||+|||.|..+
T Consensus       163 ~s~~li--~d~g~--~~d~a~~ll~~-----~tdf~VIgvlG~QgsGKStllslLaan  211 (491)
T KOG4181|consen  163 RSTPLI--VDNGI--FNDNARKLLHK-----TTDFTVIGVLGGQGSGKSTLLSLLAAN  211 (491)
T ss_pred             CCccee--ecccc--hhhHHHHHhhc-----CCCeeEEEeecCCCccHHHHHHHHhcc
Confidence            355666  33343  67778875443     356999999999999999999999754


No 15 
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=96.43  E-value=0.0051  Score=51.64  Aligned_cols=26  Identities=15%  Similarity=0.197  Sum_probs=18.7

Q ss_pred             eEEEEEEecccccChhHHHHHHHHhh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      ++.++.+....+.|..-|++.+..++
T Consensus        69 ~~~~~~iSa~~~~~~~~L~~~l~~~~   94 (157)
T cd01858          69 PTIAFHASINNPFGKGSLIQLLRQFS   94 (157)
T ss_pred             cEEEEEeeccccccHHHHHHHHHHHH
Confidence            44456666777788888888887654


No 16 
>TIGR00436 era GTP-binding protein Era. Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein.
Probab=96.42  E-value=0.0051  Score=56.55  Aligned_cols=22  Identities=36%  Similarity=0.366  Sum_probs=19.8

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .|+++|+..+|||+|+|+|++.
T Consensus         2 ~V~liG~pnvGKSTLln~L~~~   23 (270)
T TIGR00436         2 FVAILGRPNVGKSTLLNQLHGQ   23 (270)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5889999999999999999754


No 17 
>PF05879 RHD3:  Root hair defective 3 GTP-binding protein (RHD3);  InterPro: IPR008803 This family consists of several eukaryotic root hair defective 3 like GTP-binding proteins. It has been speculated that the RHD3 protein is a member of a novel class of GTP-binding proteins that is widespread in eukaryotes and required for regulated cell enlargement []. The family also contains the homologous Saccharomyces cerevisiae synthetic construct enhancement of YOP1 (SEY1) protein which is involved in membrane trafficking [].; GO: 0016817 hydrolase activity, acting on acid anhydrides
Probab=96.21  E-value=0.0018  Score=68.34  Aligned_cols=38  Identities=34%  Similarity=0.441  Sum_probs=28.3

Q ss_pred             ecccccChhHHHHHHHHhhhhcccccCCCCCCCCCCCCCCCCcccCC--CCcccccceeeeec
Q psy5031          62 AGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRG--GSERDTTGILMWSH  122 (281)
Q Consensus        62 ~G~~RtGKSfLLN~Ll~~l~~~~~~~~~~~~~~~~~~~~~~~f~~~~--~~e~~t~gi~~~s~  122 (281)
                      .|++.||||+|||+|.+-                       .|++-+  +.+.+|+||||-..
T Consensus         1 ~g~qssgkstlln~lf~t-----------------------~f~~m~~~~r~qtt~gi~~~~~   40 (742)
T PF05879_consen    1 FGSQSSGKSTLLNHLFGT-----------------------QFDVMDESGRQQTTKGIWMAKA   40 (742)
T ss_pred             CCCCCCcHHHHHHHHHCC-----------------------CccccccccccccchhhHHHhc
Confidence            499999999999999642                       244433  35579999999653


No 18 
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=96.18  E-value=0.029  Score=47.81  Aligned_cols=25  Identities=28%  Similarity=0.286  Sum_probs=20.8

Q ss_pred             ceEEEEEEecccccChhHHHHHHHH
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      ....-|.|+|+.++|||+|+|+|.+
T Consensus        16 ~~~~~i~ivG~~~~GKStlin~l~~   40 (179)
T TIGR03598        16 DDGPEIAFAGRSNVGKSSLINALTN   40 (179)
T ss_pred             CCCCEEEEEcCCCCCHHHHHHHHhC
Confidence            3445678999999999999999964


No 19 
>cd01849 YlqF_related_GTPase YlqF-related GTPases.  These proteins are found in bacteria, eukaryotes, and archaea.  They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=96.04  E-value=0.015  Score=48.84  Aligned_cols=26  Identities=4%  Similarity=-0.012  Sum_probs=20.2

Q ss_pred             eEEEEEEecccccChhHHHHHHHHhh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +..++.+....+.|-..|++.++...
T Consensus        59 ~~~ii~vSa~~~~gi~~L~~~i~~~~   84 (155)
T cd01849          59 PTIPFKISATNGQGIEKKESAFTKQT   84 (155)
T ss_pred             CceEEEEeccCCcChhhHHHHHHHHh
Confidence            34567777778889999999988764


No 20 
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains. The long precursor of the 86K protein originally described is proposed to have three domains. The N-terminal A-domain is acidic, repetitive, weakly conserved, readily removed by proteolysis during chloroplast isolation, and not required for protein translocation. The other domains are designated G (GTPase) and M (membrane anchor); this family includes most of the G domain and all of M.
Probab=96.01  E-value=0.032  Score=58.71  Aligned_cols=23  Identities=22%  Similarity=0.222  Sum_probs=19.9

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .-|.++|..+.|||.|+|.|++.
T Consensus       119 lrIvLVGKTGVGKSSLINSILGe  141 (763)
T TIGR00993       119 LNILVLGKSGVGKSATINSIFGE  141 (763)
T ss_pred             eEEEEECCCCCCHHHHHHHHhcc
Confidence            35889999999999999999754


No 21 
>TIGR02836 spore_IV_A stage IV sporulation protein A. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage IV sporulation protein A. It acts in the mother cell compartment and plays a role in spore coat morphogenesis.
Probab=96.01  E-value=0.014  Score=58.53  Aligned_cols=22  Identities=27%  Similarity=0.585  Sum_probs=20.2

Q ss_pred             EEEecccccChhHHHHHHHHhh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      |+|+||-|||||+|+|+|.+.+
T Consensus        20 IGvvGpvrtGKSTfIn~fm~q~   41 (492)
T TIGR02836        20 IGVVGPVRTGKSTFIKKFMELL   41 (492)
T ss_pred             EEEEcCCCCChHHHHHHHHhhh
Confidence            6889999999999999999874


No 22 
>PF00350 Dynamin_N:  Dynamin family;  InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another. Dynamins are large GTPases that belong to a protein superfamily [] that, in eukaryotic cells, includes classical dynamins, dynamin-like proteins, OPA1, Mx proteins, mitofusins and guanylate-binding proteins/atlastins [, , , ], and are involved in the scission of a wide range of vesicles and organelles. They play a role in many processes including budding of transport vesicles, division of organelles, cytokinesis and pathogen resistance.   The minimal distinguishing architectural features that are common to all dynamins and are distinct from other GTPases are the structure of the large GTPase domain (300 amino acids) and the presence of two additional domains; the middle domain and the GTPase effector domain (GED), which are involved in oligomerization and regulation of the GTPase activity. This entry represents the GTPase domain, containing the GTP-binding motifs that are needed for guanine-nucleotide binding and hydrolysis. The conservation of these motifs is absolute except for the the final motif in guanylate-binding proteins. The GTPase catalytic activity can be stimulated by oligomerisation of the protein, which is mediated by interactions between the GTPase domain, the middle domain and the GED.; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 1JWY_B 1JX2_B 3ZVR_A 2AKA_B 3L43_B 2X2F_D 2X2E_D 3SNH_A 3ZYS_D 3ZYC_D ....
Probab=96.01  E-value=0.0043  Score=51.71  Aligned_cols=21  Identities=48%  Similarity=0.683  Sum_probs=19.5

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|.+.+|||+|+|.|++.
T Consensus         1 V~v~G~~ssGKSTliNaLlG~   21 (168)
T PF00350_consen    1 VAVVGQFSSGKSTLINALLGR   21 (168)
T ss_dssp             EEEEEBTTSSHHHHHHHHHTS
T ss_pred             CEEEcCCCCCHHHHHHHHHhc
Confidence            789999999999999999875


No 23 
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=95.98  E-value=0.061  Score=44.28  Aligned_cols=20  Identities=35%  Similarity=0.404  Sum_probs=18.2

Q ss_pred             EEEecccccChhHHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~   78 (281)
                      |+|+|...+|||+|+|+|.+
T Consensus         3 v~ivG~~~~GKStl~~~l~~   22 (170)
T cd01898           3 VGLVGLPNAGKSTLLSAISN   22 (170)
T ss_pred             eEEECCCCCCHHHHHHHHhc
Confidence            78999999999999999964


No 24 
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=95.94  E-value=0.028  Score=46.17  Aligned_cols=19  Identities=21%  Similarity=0.356  Sum_probs=17.5

Q ss_pred             EEEecccccChhHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLL   77 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll   77 (281)
                      |.|+|+.++|||.|+++|.
T Consensus         3 i~vvG~~~~GKtsl~~~l~   21 (164)
T cd04101           3 CAVVGDPAVGKTAFVQMFH   21 (164)
T ss_pred             EEEECCCCCCHHHHHHHHh
Confidence            6789999999999999986


No 25 
>PF02421 FeoB_N:  Ferrous iron transport protein B;  InterPro: IPR011619  Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent [].; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0016021 integral to membrane; PDB: 3TAH_B 3B1X_A 3SS8_A 3B1W_C 3B1V_A 3LX5_A 3B1Y_A 3LX8_A 3B1Z_A 3K53_B ....
Probab=95.92  E-value=0.011  Score=51.21  Aligned_cols=21  Identities=29%  Similarity=0.357  Sum_probs=18.9

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+++|...+|||+|.|+|.+.
T Consensus         3 ialvG~PNvGKStLfN~Ltg~   23 (156)
T PF02421_consen    3 IALVGNPNVGKSTLFNALTGA   23 (156)
T ss_dssp             EEEEESTTSSHHHHHHHHHTT
T ss_pred             EEEECCCCCCHHHHHHHHHCC
Confidence            789999999999999999654


No 26 
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=95.74  E-value=0.0098  Score=51.93  Aligned_cols=22  Identities=32%  Similarity=0.302  Sum_probs=19.0

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      ++.++|+.+.|||+|+|.|+..
T Consensus        37 ~~vl~G~SGvGKSSLiN~L~~~   58 (161)
T PF03193_consen   37 TSVLLGQSGVGKSSLINALLPE   58 (161)
T ss_dssp             EEEEECSTTSSHHHHHHHHHTS
T ss_pred             EEEEECCCCCCHHHHHHHHHhh
Confidence            5667899999999999999755


No 27 
>PF13207 AAA_17:  AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A ....
Probab=95.72  E-value=0.0096  Score=47.11  Aligned_cols=24  Identities=29%  Similarity=0.347  Sum_probs=21.9

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ||.|+|+.+||||++++.|.+.+.
T Consensus         1 vI~I~G~~gsGKST~a~~La~~~~   24 (121)
T PF13207_consen    1 VIIISGPPGSGKSTLAKELAERLG   24 (121)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHHT
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHC
Confidence            789999999999999999998753


No 28 
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=95.63  E-value=0.068  Score=44.60  Aligned_cols=21  Identities=38%  Similarity=0.447  Sum_probs=19.3

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+++|...+|||+|+|+|+..
T Consensus         3 i~~vG~~~~GKssL~~~l~~~   23 (179)
T cd01890           3 FSIIAHIDHGKSTLADRLLEL   23 (179)
T ss_pred             EEEEeecCCCHHHHHHHHHHH
Confidence            789999999999999999865


No 29 
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=95.56  E-value=0.036  Score=51.68  Aligned_cols=22  Identities=27%  Similarity=0.345  Sum_probs=18.8

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -|.|+|+.++|||+|+|.|+..
T Consensus         6 ~I~vvG~sg~GKSTliN~L~~~   27 (276)
T cd01850           6 NIMVVGESGLGKSTFINTLFNT   27 (276)
T ss_pred             EEEEEcCCCCCHHHHHHHHHcC
Confidence            4678999999999999999643


No 30 
>PRK12289 GTPase RsgA; Reviewed
Probab=95.54  E-value=0.022  Score=55.33  Aligned_cols=21  Identities=38%  Similarity=0.387  Sum_probs=16.1

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +.|+|+.+.|||+|+|.|+..
T Consensus       175 ~v~iG~SgVGKSSLIN~L~~~  195 (352)
T PRK12289        175 TVVAGPSGVGKSSLINRLIPD  195 (352)
T ss_pred             EEEEeCCCCCHHHHHHHHcCc
Confidence            677788888888888888643


No 31 
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase).
Probab=95.45  E-value=0.14  Score=49.18  Aligned_cols=27  Identities=22%  Similarity=0.207  Sum_probs=23.0

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +.+-.-|.|+|..+.|||.++|.|++.
T Consensus        35 ~~~~~rIllvGktGVGKSSliNsIlG~   61 (313)
T TIGR00991        35 DVSSLTILVMGKGGVGKSSTVNSIIGE   61 (313)
T ss_pred             cccceEEEEECCCCCCHHHHHHHHhCC
Confidence            456667889999999999999999754


No 32 
>cd04142 RRP22 RRP22 subfamily.  RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death.  Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation.  RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Like most Ras family proteins, RRP22 is farnesylated.
Probab=95.38  E-value=0.11  Score=45.52  Aligned_cols=20  Identities=35%  Similarity=0.423  Sum_probs=18.1

Q ss_pred             EEEecccccChhHHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~   78 (281)
                      |+|+|..++|||.|+|+++.
T Consensus         3 I~ivG~~~vGKTsLi~~~~~   22 (198)
T cd04142           3 VAVLGAPGVGKTAIVRQFLA   22 (198)
T ss_pred             EEEECCCCCcHHHHHHHHHc
Confidence            68899999999999999864


No 33 
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=95.35  E-value=0.037  Score=44.51  Aligned_cols=19  Identities=37%  Similarity=0.476  Sum_probs=17.7

Q ss_pred             EEEecccccChhHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLL   77 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll   77 (281)
                      |+++|+.++|||+|+|.|.
T Consensus         2 i~l~G~~g~GKTtL~~~l~   20 (170)
T cd01876           2 IAFAGRSNVGKSSLINALT   20 (170)
T ss_pred             EEEEcCCCCCHHHHHHHHh
Confidence            6889999999999999997


No 34 
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]
Probab=95.22  E-value=0.013  Score=53.78  Aligned_cols=21  Identities=38%  Similarity=0.502  Sum_probs=19.1

Q ss_pred             EEEEecccccChhHHHHHHHH
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      +|+|+||.+||||+|||.+-.
T Consensus        33 ~vaI~GpSGSGKSTLLniig~   53 (226)
T COG1136          33 FVAIVGPSGSGKSTLLNLLGG   53 (226)
T ss_pred             EEEEECCCCCCHHHHHHHHhc
Confidence            789999999999999999943


No 35 
>PRK12288 GTPase RsgA; Reviewed
Probab=95.21  E-value=0.024  Score=54.87  Aligned_cols=21  Identities=33%  Similarity=0.297  Sum_probs=16.4

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +.++|+.+.|||+|+|.|+..
T Consensus       208 ~~~vG~sgVGKSTLiN~Ll~~  228 (347)
T PRK12288        208 SIFVGQSGVGKSSLINALLPE  228 (347)
T ss_pred             EEEECCCCCCHHHHHHHhccc
Confidence            567888888888888888644


No 36 
>PF00485 PRK:  Phosphoribulokinase / Uridine kinase family;  InterPro: IPR006083 Phosphoribulokinase (PRK) 2.7.1.19 from EC catalyses the ATP-dependent phosphorylation of ribulose-5-phosphate to ribulose-1,5-phosphate, a key step in the pentose phosphate pathway where carbon dioxide is assimilated by autotrophic organisms []. In general, plant enzymes are light-activated by the thioredoxin/ferredoxin system, while those from photosynthetic bacteria are regulated by a system that has an absolute requirement for NADH. Thioredoxin/ferredoxin regulation is mediated by the reversible oxidation/reduction of sulphydryl and disulphide groups.  Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway. It catalyzes the following reaction:  ATP + Uridine = ADP + UMP   Pantothenate kinase (2.7.1.33 from EC) catalyzes the rate-limiting step in the biosynthesis of coenzyme A, the conversion of pantothenate to D-4'-phosphopantothenate in the presence of ATP. ; GO: 0005524 ATP binding, 0016301 kinase activity, 0008152 metabolic process; PDB: 2ZSE_A 2ZS7_A 3AF0_A 3AVP_A 2ZS9_A 2ZS8_A 3AEZ_A 2ZSB_A 2ZSD_A 2GEV_A ....
Probab=95.21  E-value=0.017  Score=50.34  Aligned_cols=25  Identities=28%  Similarity=0.420  Sum_probs=23.2

Q ss_pred             EEEEecccccChhHHHHHHHHhhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      ||+|+|+.+||||+|++.|...+..
T Consensus         1 IIgI~G~sgSGKTTla~~L~~~L~~   25 (194)
T PF00485_consen    1 IIGIAGPSGSGKTTLAKRLAQILNK   25 (194)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHHTT
T ss_pred             CEEEECCCCCCHHHHHHHHHHHhCc
Confidence            7999999999999999999998764


No 37 
>PRK12298 obgE GTPase CgtA; Reviewed
Probab=95.05  E-value=0.14  Score=50.23  Aligned_cols=24  Identities=21%  Similarity=0.193  Sum_probs=21.6

Q ss_pred             EEEEEEecccccChhHHHHHHHHh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +|=|+++|...+|||+|+|.|.+.
T Consensus       159 iadValVG~PNaGKSTLln~Lt~~  182 (390)
T PRK12298        159 LADVGLLGLPNAGKSTFIRAVSAA  182 (390)
T ss_pred             cccEEEEcCCCCCHHHHHHHHhCC
Confidence            777999999999999999999643


No 38 
>cd04178 Nucleostemin_like Nucleostemin-like.  Nucleostemin (NS) is a nucleolar protein that functions as a regulator of cell growth and proliferation in stem cells and in several types of cancer cells, but is not expressed in the differentiated cells of most mammalian adult tissues.  NS shuttles between the nucleolus and nucleoplasm bidirectionally at a rate that is fast and independent of cell type.  Lowering GTP levels decreases the nucleolar retention of NS, and expression of NS is abruptly down-regulated during differentiation prior to terminal cell division.  Found only in eukaryotes, NS consists of an N-terminal basic domain, a coiled-coil domain, a GTP-binding domain, an intermediate domain, and a C-terminal acidic domain.  Experimental evidence indicates that NS uses its GTP-binding property as a molecular switch to control the transition between the nucleolus and nucleoplasm, and this process involves interaction between the basic, GTP-binding, and intermediate domains of the 
Probab=94.93  E-value=0.049  Score=47.44  Aligned_cols=22  Identities=41%  Similarity=0.478  Sum_probs=17.2

Q ss_pred             EEEEEecccccChhHHHHHHHH
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      ..|+++|...+|||+|+|.|.+
T Consensus       118 ~~~~~vG~pnvGKSslin~l~~  139 (172)
T cd04178         118 ITVGVVGFPNVGKSSLINSLKR  139 (172)
T ss_pred             cEEEEEcCCCCCHHHHHHHHhC
Confidence            4577888888888888888864


No 39 
>TIGR00157 ribosome small subunit-dependent GTPase A. The Aquifex aeolicus ortholog is split into consecutive open reading frames. Consequently, this model was build in fragment mode (-f option).
Probab=94.84  E-value=0.075  Score=48.68  Aligned_cols=22  Identities=32%  Similarity=0.268  Sum_probs=17.7

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      ++.++|+.+.|||+|+|.|+..
T Consensus       122 ~~~~~G~sgvGKStLiN~L~~~  143 (245)
T TIGR00157       122 ISVFAGQSGVGKSSLINALDPS  143 (245)
T ss_pred             EEEEECCCCCCHHHHHHHHhhh
Confidence            5567888888999999998755


No 40 
>KOG1423|consensus
Probab=94.81  E-value=0.06  Score=52.17  Aligned_cols=27  Identities=30%  Similarity=0.340  Sum_probs=23.8

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      ++++-=|+|+|+...|||+|-|++++.
T Consensus        69 ~~k~L~vavIG~PNvGKStLtN~mig~   95 (379)
T KOG1423|consen   69 AQKSLYVAVIGAPNVGKSTLTNQMIGQ   95 (379)
T ss_pred             cceEEEEEEEcCCCcchhhhhhHhhCC
Confidence            567777899999999999999999865


No 41 
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=94.79  E-value=0.11  Score=42.25  Aligned_cols=21  Identities=24%  Similarity=0.156  Sum_probs=18.5

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.++|+.++|||.|+|++...
T Consensus         3 i~~vG~~~vGKTsli~~l~~~   23 (168)
T cd04119           3 VISMGNSGVGKSCIIKRYCEG   23 (168)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678999999999999999754


No 42 
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=94.74  E-value=0.1  Score=42.74  Aligned_cols=21  Identities=29%  Similarity=0.379  Sum_probs=18.6

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||.|+|+|+..
T Consensus         3 i~v~G~~~vGKTsli~~l~~~   23 (161)
T cd04113           3 FIIIGSSGTGKSCLLHRFVEN   23 (161)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678999999999999999743


No 43 
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=94.73  E-value=0.12  Score=45.15  Aligned_cols=21  Identities=29%  Similarity=0.385  Sum_probs=18.8

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|+.++|||+|+|.|++.
T Consensus         4 I~i~G~~g~GKSSLin~L~g~   24 (197)
T cd04104           4 IAVTGESGAGKSSFINALRGV   24 (197)
T ss_pred             EEEECCCCCCHHHHHHHHhcc
Confidence            679999999999999999753


No 44 
>PRK09563 rbgA GTPase YlqF; Reviewed
Probab=94.68  E-value=0.087  Score=49.17  Aligned_cols=27  Identities=7%  Similarity=0.129  Sum_probs=21.2

Q ss_pred             EEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      ..++.|....+.|..-|++.+...+..
T Consensus        81 ~~vi~vSa~~~~gi~~L~~~l~~~l~~  107 (287)
T PRK09563         81 IKALAINAKKGQGVKKILKAAKKLLKE  107 (287)
T ss_pred             CeEEEEECCCcccHHHHHHHHHHHHHH
Confidence            445677778889999999999887654


No 45 
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=94.67  E-value=0.11  Score=42.73  Aligned_cols=23  Identities=30%  Similarity=0.299  Sum_probs=19.6

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .=|.|+|+.++|||+|+|++...
T Consensus         4 ~ki~vvG~~~~GKSsli~~l~~~   26 (165)
T cd01868           4 FKIVLIGDSGVGKSNLLSRFTRN   26 (165)
T ss_pred             eEEEEECCCCCCHHHHHHHHhcC
Confidence            34779999999999999999643


No 46 
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]
Probab=94.64  E-value=0.025  Score=51.45  Aligned_cols=25  Identities=28%  Similarity=0.462  Sum_probs=21.8

Q ss_pred             EEEEecccccChhHHHHHHHHhhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      +|+|+||.++|||+|||.+......
T Consensus        27 ~vAi~GpSGaGKSTLLnLIAGF~~P   51 (231)
T COG3840          27 IVAILGPSGAGKSTLLNLIAGFETP   51 (231)
T ss_pred             EEEEECCCCccHHHHHHHHHhccCC
Confidence            6889999999999999999887543


No 47 
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=94.60  E-value=0.11  Score=42.28  Aligned_cols=21  Identities=14%  Similarity=0.202  Sum_probs=18.5

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.++|+..+|||.|+|+|+..
T Consensus         3 i~liG~~~~GKSsli~~l~~~   23 (161)
T cd01861           3 LVFLGDQSVGKTSIITRFMYD   23 (161)
T ss_pred             EEEECCCCCCHHHHHHHHHcC
Confidence            678999999999999999643


No 48 
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=94.54  E-value=0.13  Score=42.59  Aligned_cols=22  Identities=14%  Similarity=0.218  Sum_probs=18.8

Q ss_pred             EEEEEecccccChhHHHHHHHH
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      .-|.|+|+.++|||+|++++..
T Consensus         4 ~kv~vvG~~~~GKTsli~~l~~   25 (165)
T cd01864           4 FKIILIGDSNVGKTCVVQRFKS   25 (165)
T ss_pred             eEEEEECCCCCCHHHHHHHHhh
Confidence            4577889999999999999854


No 49 
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=94.45  E-value=0.14  Score=41.69  Aligned_cols=20  Identities=30%  Similarity=0.398  Sum_probs=18.1

Q ss_pred             EEEecccccChhHHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~   78 (281)
                      |.++|..++|||.|+|++..
T Consensus         3 v~~vG~~~~GKTsl~~~~~~   22 (162)
T cd04106           3 VIVVGNGNVGKSSMIQRFVK   22 (162)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            78999999999999999964


No 50 
>TIGR00235 udk uridine kinase. Model contains a number of longer eukaryotic proteins and starts bringing in phosphoribulokinase hits at scores of 160 and below
Probab=94.41  E-value=0.043  Score=48.30  Aligned_cols=28  Identities=11%  Similarity=0.290  Sum_probs=24.3

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ++-.||+|+|+.++|||+|++.|.+.+.
T Consensus         4 ~~g~vi~I~G~sGsGKSTl~~~l~~~l~   31 (207)
T TIGR00235         4 PKGIIIGIGGGSGSGKTTVARKIYEQLG   31 (207)
T ss_pred             CCeEEEEEECCCCCCHHHHHHHHHHHhc
Confidence            3457899999999999999999998754


No 51 
>PRK15494 era GTPase Era; Provisional
Probab=94.37  E-value=0.09  Score=50.38  Aligned_cols=27  Identities=30%  Similarity=0.418  Sum_probs=22.7

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +++..-|+|+|...+|||+|+|+|+..
T Consensus        49 ~~k~~kV~ivG~~nvGKSTLin~l~~~   75 (339)
T PRK15494         49 NQKTVSVCIIGRPNSGKSTLLNRIIGE   75 (339)
T ss_pred             ccceeEEEEEcCCCCCHHHHHHHHhCC
Confidence            345667899999999999999999743


No 52 
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK), catalyzes the reversible phosphoryl transfer from ATP to uridine or cytidine to yield UMP or CMP. In the primidine nucleotide-salvage pathway, this enzyme combined with nucleoside diphosphate kinases further phosphorylates UMP and CMP to form UTP and CTP. This kinase also catalyzes the phosphorylation of several cytotoxic ribonucleoside analogs such as 5-flurrouridine and cyclopentenyl-cytidine.
Probab=94.36  E-value=0.031  Score=48.56  Aligned_cols=23  Identities=17%  Similarity=0.452  Sum_probs=21.5

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      ||+|+|+.++|||+|++.|.+.+
T Consensus         1 iigi~G~~GsGKSTl~~~l~~~l   23 (198)
T cd02023           1 IIGIAGGSGSGKTTVAEEIIEQL   23 (198)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHh
Confidence            68999999999999999998876


No 53 
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=94.30  E-value=0.18  Score=42.09  Aligned_cols=25  Identities=24%  Similarity=0.131  Sum_probs=21.2

Q ss_pred             eEEEEEEecccccChhHHHHHHHHh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+.=|.|+|+.++|||.|+|++++.
T Consensus         3 ~~~ki~vvG~~~vGKSsLl~~l~~~   27 (168)
T cd01866           3 YLFKYIIIGDTGVGKSCLLLQFTDK   27 (168)
T ss_pred             cceEEEEECCCCCCHHHHHHHHHcC
Confidence            3566899999999999999999643


No 54 
>PRK00098 GTPase RsgA; Reviewed
Probab=94.20  E-value=0.079  Score=49.83  Aligned_cols=22  Identities=41%  Similarity=0.369  Sum_probs=16.2

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      ++.++|+.+.|||+|+|.|++.
T Consensus       166 ~~~~~G~sgvGKStlin~l~~~  187 (298)
T PRK00098        166 VTVLAGQSGVGKSTLLNALAPD  187 (298)
T ss_pred             eEEEECCCCCCHHHHHHHHhCC
Confidence            4557788888888888888643


No 55 
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=94.20  E-value=0.19  Score=42.01  Aligned_cols=23  Identities=22%  Similarity=0.213  Sum_probs=20.0

Q ss_pred             EEEEEEecccccChhHHHHHHHH
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      +.-|.++|+..+|||.|+|+++.
T Consensus         2 ~~ki~vvG~~~vGKTsli~~~~~   24 (170)
T cd04115           2 IFKIIVIGDSNVGKTCLTYRFCA   24 (170)
T ss_pred             ceEEEEECCCCCCHHHHHHHHHh
Confidence            35688999999999999999964


No 56 
>PRK05480 uridine/cytidine kinase; Provisional
Probab=94.10  E-value=0.045  Score=48.03  Aligned_cols=26  Identities=15%  Similarity=0.369  Sum_probs=23.5

Q ss_pred             eEEEEEEecccccChhHHHHHHHHhh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +--+|+|+|+.+||||+|++.|.+.+
T Consensus         5 ~~~iI~I~G~sGsGKTTl~~~l~~~l   30 (209)
T PRK05480          5 KPIIIGIAGGSGSGKTTVASTIYEEL   30 (209)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHh
Confidence            34589999999999999999999886


No 57 
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=94.09  E-value=0.036  Score=45.03  Aligned_cols=21  Identities=29%  Similarity=0.507  Sum_probs=19.6

Q ss_pred             EEEEecccccChhHHHHHHHH
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      +|+|+|...+|||+|+|+|.+
T Consensus         2 ~i~i~G~~~~GKssl~~~l~~   22 (164)
T cd04171           2 IIGTAGHIDHGKTTLIKALTG   22 (164)
T ss_pred             EEEEEecCCCCHHHHHHHHhC
Confidence            789999999999999999974


No 58 
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF. Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members.
Probab=94.04  E-value=0.26  Score=45.71  Aligned_cols=26  Identities=8%  Similarity=0.101  Sum_probs=20.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .++.|....+.|-.-|++.+...+..
T Consensus        79 ~vi~iSa~~~~gi~~L~~~i~~~~~~  104 (276)
T TIGR03596        79 KALAINAKKGKGVKKIIKAAKKLLKE  104 (276)
T ss_pred             eEEEEECCCcccHHHHHHHHHHHHHH
Confidence            45666677888999999999988643


No 59 
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway. The reaction carried out by this enzyme is a key regulatory point in CoA biosynthesis.
Probab=94.00  E-value=0.038  Score=49.83  Aligned_cols=24  Identities=25%  Similarity=0.421  Sum_probs=22.1

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ||+|+|+.++|||+|++.|...+.
T Consensus         1 IigI~G~sGSGKTTla~~L~~~l~   24 (220)
T cd02025           1 IIGIAGSVAVGKSTTARVLQALLS   24 (220)
T ss_pred             CEEeeCCCCCCHHHHHHHHHHHHh
Confidence            689999999999999999998874


No 60 
>PF13238 AAA_18:  AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C ....
Probab=93.95  E-value=0.05  Score=42.70  Aligned_cols=22  Identities=18%  Similarity=0.309  Sum_probs=20.4

Q ss_pred             EEEecccccChhHHHHHHHHhh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      |.|.|+.+||||+|++.|...+
T Consensus         1 I~i~G~~GsGKtTia~~L~~~~   22 (129)
T PF13238_consen    1 IGISGIPGSGKTTIAKELAERL   22 (129)
T ss_dssp             EEEEESTTSSHHHHHHHHHHHH
T ss_pred             CEEECCCCCCHHHHHHHHHHHH
Confidence            7899999999999999999884


No 61 
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=93.94  E-value=0.12  Score=41.49  Aligned_cols=20  Identities=30%  Similarity=0.331  Sum_probs=17.0

Q ss_pred             EEecccccChhHHHHHHHHh
Q psy5031          60 SVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        60 sI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +++|..++|||.|+|+|++.
T Consensus         1 ~l~G~~~~GKssl~~~l~~~   20 (157)
T cd01894           1 AIVGRPNVGKSTLFNRLTGR   20 (157)
T ss_pred             CccCCCCCCHHHHHHHHhCC
Confidence            47899999999999999643


No 62 
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=93.89  E-value=0.17  Score=41.99  Aligned_cols=22  Identities=18%  Similarity=0.069  Sum_probs=19.0

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      =|.|+|+.++|||.|+|++...
T Consensus         3 ki~i~G~~~~GKSsli~~l~~~   24 (165)
T cd01865           3 KLLIIGNSSVGKTSFLFRYADD   24 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            3789999999999999999643


No 63 
>PRK08233 hypothetical protein; Provisional
Probab=93.86  E-value=0.052  Score=45.75  Aligned_cols=26  Identities=19%  Similarity=0.300  Sum_probs=23.3

Q ss_pred             EEEEEEecccccChhHHHHHHHHhhh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .-||+|.|+.+||||+|+++|...+.
T Consensus         3 ~~iI~I~G~~GsGKtTla~~L~~~l~   28 (182)
T PRK08233          3 TKIITIAAVSGGGKTTLTERLTHKLK   28 (182)
T ss_pred             ceEEEEECCCCCCHHHHHHHHHhhCC
Confidence            36899999999999999999998763


No 64 
>PTZ00301 uridine kinase; Provisional
Probab=93.85  E-value=0.052  Score=48.95  Aligned_cols=27  Identities=26%  Similarity=0.318  Sum_probs=23.3

Q ss_pred             eEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      |.-||+|+|+.+||||+|.+.|.+.+.
T Consensus         2 ~~~iIgIaG~SgSGKTTla~~l~~~l~   28 (210)
T PTZ00301          2 PCTVIGISGASGSGKSSLSTNIVSELM   28 (210)
T ss_pred             CCEEEEEECCCcCCHHHHHHHHHHHHH
Confidence            346899999999999999999887653


No 65 
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=93.84  E-value=0.21  Score=41.42  Aligned_cols=21  Identities=29%  Similarity=0.297  Sum_probs=18.3

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.++|..++|||+|+++++..
T Consensus         3 i~vvG~~~vGKTsli~~~~~~   23 (161)
T cd04124           3 IILLGDSAVGKSKLVERFLMD   23 (161)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678899999999999999753


No 66 
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=93.83  E-value=0.18  Score=41.85  Aligned_cols=21  Identities=29%  Similarity=0.328  Sum_probs=18.2

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||.|+|++...
T Consensus         5 i~iiG~~~vGKTsli~~~~~~   25 (166)
T cd04122           5 YIIIGDMGVGKSCLLHQFTEK   25 (166)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            678899999999999999643


No 67 
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=93.77  E-value=0.046  Score=43.74  Aligned_cols=23  Identities=35%  Similarity=0.379  Sum_probs=20.3

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -+|+++|+.++|||+|+|+|++.
T Consensus         4 ~~i~~~G~~g~GKttl~~~l~~~   26 (168)
T cd04163           4 GFVAIVGRPNVGKSTLLNALVGQ   26 (168)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCC
Confidence            36899999999999999999754


No 68 
>PRK06696 uridine kinase; Validated
Probab=93.75  E-value=0.1  Score=46.63  Aligned_cols=28  Identities=21%  Similarity=0.242  Sum_probs=25.0

Q ss_pred             eEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      ...+|+|.|+.+||||+|++.|.+.+..
T Consensus        21 ~~~iI~I~G~sgsGKSTlA~~L~~~l~~   48 (223)
T PRK06696         21 RPLRVAIDGITASGKTTFADELAEEIKK   48 (223)
T ss_pred             CceEEEEECCCCCCHHHHHHHHHHHHHH
Confidence            4579999999999999999999998753


No 69 
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=93.73  E-value=0.22  Score=41.27  Aligned_cols=22  Identities=27%  Similarity=0.264  Sum_probs=19.0

Q ss_pred             EEEEEecccccChhHHHHHHHH
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      .-|.|+|+.++|||.|+|++++
T Consensus         6 ~ki~vvG~~~~GKTsli~~~~~   27 (170)
T cd04116           6 LKVILLGDGGVGKSSLMNRYVT   27 (170)
T ss_pred             EEEEEECCCCCCHHHHHHHHHc
Confidence            4577889999999999999964


No 70 
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=93.73  E-value=0.22  Score=41.07  Aligned_cols=23  Identities=26%  Similarity=0.141  Sum_probs=19.5

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .=|.|+|+.++|||.|+|++...
T Consensus         3 ~ki~i~G~~~vGKSsli~~~~~~   25 (166)
T cd01869           3 FKLLLIGDSGVGKSCLLLRFADD   25 (166)
T ss_pred             EEEEEECCCCCCHHHHHHHHhcC
Confidence            44788999999999999999643


No 71 
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=93.73  E-value=0.32  Score=40.60  Aligned_cols=24  Identities=17%  Similarity=0.099  Sum_probs=20.1

Q ss_pred             EEEEEEecccccChhHHHHHHHHh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +.-|.++|+.++|||.|+|++...
T Consensus         4 ~~ki~ivG~~~vGKTsli~~~~~~   27 (180)
T cd04127           4 LIKFLALGDSGVGKTSFLYQYTDN   27 (180)
T ss_pred             eEEEEEECCCCCCHHHHHHHHhcC
Confidence            445679999999999999999654


No 72 
>PF00009 GTP_EFTU:  Elongation factor Tu GTP binding domain;  InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site. The proteins are all relatively similar in the vicinity of their C-termini, and are also highly similar to a range of proteins that includes the nodulation Q protein from Rhizobium meliloti (Sinorhizobium meliloti), bacterial tetracycline resistance proteins [] and the omnipotent suppressor protein 2 from yeast. In both prokaryotes and eukaryotes, there are three distinct types of elongation factors, EF-1alpha (EF-Tu), which binds GTP and an aminoacyl-tRNAand delivers the latter to the A site of ribosomes; EF-1beta (EF-Ts), which interacts with EF-1a/EF-Tu to displace GDP and thus allows the regeneration of GTP-EF-1a; and EF-2 (EF-G), which binds GTP and peptidyl-tRNA and translocates the latter from the A site to the P site. In EF-1-alpha, a specific region has been shown [] to be involved in a conformational change mediated by the hydrolysis of GTP to GDP. This region is conserved in both EF-1alpha/EF-Tu as well as EF-2/EF-G and thus seems typical for GTP-dependent proteins which bind non-initiator tRNAs to the ribosome. The GTP-binding protein synthesis factor family also includes the eukaryotic peptide chain release factor GTP-binding subunits [] and prokaryotic peptide chain release factor 3 (RF-3) []; the prokaryotic GTP-binding protein lepA and its homologue in yeast (GUF1) and Caenorhabditis elegans (ZK1236.1); yeast HBS1 []; rat statin S1 []; and the prokaryotic selenocysteine-specific elongation factor selB [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3IZW_C 1DG1_G 2BVN_B 3IZV_C 3MMP_C 1OB2_A 1EFU_A 3FIH_Z 3TR5_A 1TUI_C ....
Probab=93.70  E-value=0.066  Score=46.08  Aligned_cols=27  Identities=30%  Similarity=0.428  Sum_probs=24.4

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHhh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      |++-.|+|+|...+|||+|++.|+.+.
T Consensus         1 k~~~~I~i~G~~~sGKTTL~~~L~~~~   27 (188)
T PF00009_consen    1 KNIRNIAIIGHVDSGKTTLLGALLGKA   27 (188)
T ss_dssp             STEEEEEEEESTTSSHHHHHHHHHHHH
T ss_pred             CCEEEEEEECCCCCCcEeechhhhhhc
Confidence            468899999999999999999999774


No 73 
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=93.69  E-value=0.046  Score=50.97  Aligned_cols=26  Identities=27%  Similarity=0.258  Sum_probs=22.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      -+|||+||.++|||+|||.+.+-...
T Consensus        30 EfvsilGpSGcGKSTLLriiAGL~~p   55 (248)
T COG1116          30 EFVAILGPSGCGKSTLLRLIAGLEKP   55 (248)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCCCC
Confidence            37899999999999999999876544


No 74 
>PRK09270 nucleoside triphosphate hydrolase domain-containing protein; Reviewed
Probab=93.68  E-value=0.098  Score=46.91  Aligned_cols=30  Identities=30%  Similarity=0.416  Sum_probs=26.6

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      +.+..+|+|+|+.++|||+|++.|.+.+..
T Consensus        30 ~~~~~iigi~G~~GsGKTTl~~~L~~~l~~   59 (229)
T PRK09270         30 PQRRTIVGIAGPPGAGKSTLAEFLEALLQQ   59 (229)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHHhhh
Confidence            456799999999999999999999988754


No 75 
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily.  BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants.  BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well.  The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli.  It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes.  It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes.  In addition, BipA from enteropathogenic E. co
Probab=93.68  E-value=0.14  Score=44.05  Aligned_cols=24  Identities=25%  Similarity=0.443  Sum_probs=20.4

Q ss_pred             EEEEEEecccccChhHHHHHHHHh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +.-|+++|...+|||+|+|+|+..
T Consensus         2 ~r~i~ivG~~~~GKTsL~~~l~~~   25 (194)
T cd01891           2 IRNIAIIAHVDHGKTTLVDALLKQ   25 (194)
T ss_pred             ccEEEEEecCCCCHHHHHHHHHHH
Confidence            345888999999999999999863


No 76 
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=93.66  E-value=0.061  Score=42.04  Aligned_cols=21  Identities=29%  Similarity=0.230  Sum_probs=19.1

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||+|+++|++.
T Consensus         2 I~V~G~~g~GKTsLi~~l~~~   22 (119)
T PF08477_consen    2 IVVLGDSGVGKTSLIRRLCGG   22 (119)
T ss_dssp             EEEECSTTSSHHHHHHHHHHS
T ss_pred             EEEECcCCCCHHHHHHHHhcC
Confidence            678999999999999999865


No 77 
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=93.65  E-value=0.045  Score=43.64  Aligned_cols=21  Identities=19%  Similarity=0.374  Sum_probs=18.8

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|+.++|||.|+|+|.+.
T Consensus         2 i~i~G~~~~GKssl~~~l~~~   22 (159)
T cd04159           2 ITLVGLQNSGKTTLVNVIAGG   22 (159)
T ss_pred             EEEEcCCCCCHHHHHHHHccC
Confidence            689999999999999999654


No 78 
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=93.61  E-value=0.23  Score=41.26  Aligned_cols=23  Identities=26%  Similarity=0.138  Sum_probs=19.7

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .=|.++|+.++|||.|+|++...
T Consensus         4 ~ki~vvG~~~~GKSsl~~~~~~~   26 (167)
T cd01867           4 FKLLLIGDSGVGKSCLLLRFSED   26 (167)
T ss_pred             eEEEEECCCCCCHHHHHHHHhhC
Confidence            45789999999999999999743


No 79 
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars. Members of this family play a wide variety of essential roles in nucleotide metabolism, the biosynthesis of coenzymes and aromatic compounds, as well as the metabolism of sugar and sulfate.
Probab=93.56  E-value=0.064  Score=39.56  Aligned_cols=23  Identities=22%  Similarity=0.382  Sum_probs=21.0

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +|.|+|+..+|||++++.|.+.+
T Consensus         1 ~i~i~G~~gsGKst~~~~l~~~l   23 (69)
T cd02019           1 IIAITGGSGSGKSTVAKKLAEQL   23 (69)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHh
Confidence            57899999999999999998875


No 80 
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=93.56  E-value=0.26  Score=41.40  Aligned_cols=21  Identities=19%  Similarity=0.176  Sum_probs=18.7

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||.|+|++++.
T Consensus         3 i~vvG~~~vGKTsli~~~~~~   23 (166)
T cd00877           3 LVLVGDGGTGKTTFVKRHLTG   23 (166)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            788999999999999999754


No 81 
>COG1084 Predicted GTPase [General function prediction only]
Probab=93.43  E-value=0.18  Score=48.93  Aligned_cols=42  Identities=24%  Similarity=0.196  Sum_probs=27.3

Q ss_pred             EEeCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHH
Q psy5031          35 FILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLL   77 (281)
Q Consensus        35 l~ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll   77 (281)
                      |..-.+|-+.+..-+.+ |--.-=|-|+|+...|||+|++.+-
T Consensus       148 L~fL~~~r~~l~~LP~I-dp~~pTivVaG~PNVGKSSlv~~lT  189 (346)
T COG1084         148 LEFLRKARDHLKKLPAI-DPDLPTIVVAGYPNVGKSSLVRKLT  189 (346)
T ss_pred             HHHHHHHHHHHhcCCCC-CCCCCeEEEecCCCCcHHHHHHHHh
Confidence            33444555555444443 3234456689999999999999994


No 82 
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=93.39  E-value=0.54  Score=38.78  Aligned_cols=20  Identities=40%  Similarity=0.419  Sum_probs=18.0

Q ss_pred             EEEecccccChhHHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~   78 (281)
                      |.|+|+..+|||.|+++++.
T Consensus         2 i~vvG~~~~GKtsli~~~~~   21 (165)
T cd04146           2 IAVLGASGVGKSALVVRFLT   21 (165)
T ss_pred             EEEECCCCCcHHHHHHHHHh
Confidence            67899999999999999864


No 83 
>PF03205 MobB:  Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A.
Probab=93.37  E-value=0.075  Score=44.80  Aligned_cols=25  Identities=32%  Similarity=0.422  Sum_probs=23.3

Q ss_pred             EEEEecccccChhHHHHHHHHhhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      ||+|+|+..||||+|+..|++++..
T Consensus         2 vv~VvG~~~sGKTTl~~~Li~~l~~   26 (140)
T PF03205_consen    2 VVQVVGPKNSGKTTLIRKLINELKR   26 (140)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHHHH
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHhH
Confidence            7999999999999999999999864


No 84 
>PRK07667 uridine kinase; Provisional
Probab=93.34  E-value=0.15  Score=44.76  Aligned_cols=30  Identities=23%  Similarity=0.399  Sum_probs=25.7

Q ss_pred             CCceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          52 KDKHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        52 ~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .+++ .||+|.|+.+||||+|.+.|...+..
T Consensus        14 ~~~~-~iIgI~G~~gsGKStla~~L~~~l~~   43 (193)
T PRK07667         14 KENR-FILGIDGLSRSGKTTFVANLKENMKQ   43 (193)
T ss_pred             CCCC-EEEEEECCCCCCHHHHHHHHHHHHHh
Confidence            3445 89999999999999999999988753


No 85 
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=93.30  E-value=0.22  Score=42.81  Aligned_cols=21  Identities=29%  Similarity=0.183  Sum_probs=18.5

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||.|+|++...
T Consensus         3 i~vvG~~~vGKTSli~~~~~~   23 (191)
T cd04112           3 VMLLGDSGVGKTCLLVRFKDG   23 (191)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            678899999999999999643


No 86 
>PF07693 KAP_NTPase:  KAP family P-loop domain;  InterPro: IPR011646 The KAP (after Kidins220/ARMS and PifA) family of predicted NTPases are sporadically distributed across a wide phylogenetic range in bacteria and in animals. Many of the prokaryotic KAP NTPases are encoded in plasmids and tend to undergo disruption to form pseudogenes. A unique feature of all eukaryotic and certain bacterial KAP NTPases is the presence of two or four transmembrane helices inserted into the P-loop NTPase domain. These transmembrane helices anchor KAP NTPases in the membrane such that the P-loop domain is located on the intracellular side [].
Probab=93.30  E-value=0.12  Score=47.81  Aligned_cols=42  Identities=24%  Similarity=0.374  Sum_probs=32.1

Q ss_pred             HHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhhhc
Q psy5031          40 EALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFT   83 (281)
Q Consensus        40 eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~~   83 (281)
                      ++|..++.+.  ...+-.+|++.|+-++|||++||.+.+++...
T Consensus         6 ~~la~~I~~~--~~~~~~~IgL~G~WGsGKSs~l~~l~~~L~~~   47 (325)
T PF07693_consen    6 KALAEIIKNP--DSDDPFVIGLYGEWGSGKSSFLNMLKEELKED   47 (325)
T ss_pred             HHHHHHHhcc--CCCCCeEEEEECCCCCCHHHHHHHHHHHHhcc
Confidence            4555566532  22567889999999999999999999887653


No 87 
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=93.29  E-value=0.055  Score=43.68  Aligned_cols=23  Identities=35%  Similarity=0.498  Sum_probs=20.2

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+..
T Consensus        13 ~~~i~G~nGsGKStLl~~l~g~~   35 (137)
T PF00005_consen   13 IVAIVGPNGSGKSTLLKALAGLL   35 (137)
T ss_dssp             EEEEEESTTSSHHHHHHHHTTSS
T ss_pred             EEEEEccCCCccccceeeecccc
Confidence            67889999999999999997654


No 88 
>cd01854 YjeQ_engC YjeQ/EngC.  YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.
Probab=93.27  E-value=0.26  Score=46.09  Aligned_cols=23  Identities=30%  Similarity=0.290  Sum_probs=17.6

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++++|+.+.|||+|+|.|+..
T Consensus       162 k~~~~~G~sg~GKSTlin~l~~~  184 (287)
T cd01854         162 KTSVLVGQSGVGKSTLINALLPD  184 (287)
T ss_pred             ceEEEECCCCCCHHHHHHHHhch
Confidence            35677888888888888888654


No 89 
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=93.25  E-value=0.059  Score=44.34  Aligned_cols=22  Identities=23%  Similarity=0.267  Sum_probs=19.6

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -|+|+|+.++|||+|+|++.+.
T Consensus         2 ki~viG~~~~GKSsl~~~l~~~   23 (172)
T cd01862           2 KVIILGDSGVGKTSLMNQYVNK   23 (172)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            3789999999999999999765


No 90 
>PRK00093 GTP-binding protein Der; Reviewed
Probab=93.21  E-value=0.34  Score=47.22  Aligned_cols=19  Identities=32%  Similarity=0.279  Sum_probs=13.0

Q ss_pred             cchhhccCchhHHHHHHhh
Q psy5031         133 KVSAFRKGKSFLLDFLLRY  151 (281)
Q Consensus       133 ~~~~~r~gkS~Lln~l~~~  151 (281)
                      .+|.-..|||.|+|.|++.
T Consensus       178 ivG~~n~GKStlin~ll~~  196 (435)
T PRK00093        178 IIGRPNVGKSSLINALLGE  196 (435)
T ss_pred             EECCCCCCHHHHHHHHhCC
Confidence            4566677777777777653


No 91 
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=93.16  E-value=0.3  Score=42.94  Aligned_cols=20  Identities=25%  Similarity=0.237  Sum_probs=18.1

Q ss_pred             EEEecccccChhHHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~   78 (281)
                      |.|+|+.++|||+|+|+|..
T Consensus         3 i~ivG~~~vGKSsLi~~l~~   22 (215)
T cd04109           3 IVVLGDGAVGKTSLCRRFAK   22 (215)
T ss_pred             EEEECcCCCCHHHHHHHHhc
Confidence            67899999999999999964


No 92 
>PF13173 AAA_14:  AAA domain
Probab=93.07  E-value=0.092  Score=42.73  Aligned_cols=24  Identities=25%  Similarity=0.353  Sum_probs=21.4

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ++.|.|+-|+|||+|+.++++++.
T Consensus         4 ~~~l~G~R~vGKTtll~~~~~~~~   27 (128)
T PF13173_consen    4 IIILTGPRGVGKTTLLKQLAKDLL   27 (128)
T ss_pred             eEEEECCCCCCHHHHHHHHHHHhc
Confidence            578899999999999999998754


No 93 
>TIGR01425 SRP54_euk signal recognition particle protein SRP54. This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model.
Probab=93.04  E-value=0.34  Score=48.53  Aligned_cols=28  Identities=21%  Similarity=0.184  Sum_probs=24.5

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ++-.||.++|++++|||+++..|..++.
T Consensus        98 ~~~~vi~lvG~~GvGKTTtaaKLA~~l~  125 (429)
T TIGR01425        98 GKQNVIMFVGLQGSGKTTTCTKLAYYYQ  125 (429)
T ss_pred             CCCeEEEEECCCCCCHHHHHHHHHHHHH
Confidence            3457999999999999999999998764


No 94 
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=93.03  E-value=0.11  Score=40.28  Aligned_cols=24  Identities=17%  Similarity=0.126  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      ..+-|.|+.++|||+|++.+.+.+
T Consensus        20 ~~v~i~G~~G~GKT~l~~~i~~~~   43 (151)
T cd00009          20 KNLLLYGPPGTGKTTLARAIANEL   43 (151)
T ss_pred             CeEEEECCCCCCHHHHHHHHHHHh
Confidence            456689999999999999999875


No 95 
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=93.02  E-value=0.062  Score=46.41  Aligned_cols=27  Identities=26%  Similarity=0.290  Sum_probs=23.8

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      ..++..|+|+|+.++|||+|+|++.+.
T Consensus        38 ~~~~~~I~iiG~~g~GKStLl~~l~~~   64 (204)
T cd01878          38 RSGIPTVALVGYTNAGKSTLFNALTGA   64 (204)
T ss_pred             hcCCCeEEEECCCCCCHHHHHHHHhcc
Confidence            356789999999999999999999764


No 96 
>PLN03118 Rab family protein; Provisional
Probab=93.01  E-value=0.33  Score=42.47  Aligned_cols=22  Identities=27%  Similarity=0.233  Sum_probs=18.7

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -|.|+|+..+|||.|+|+|+..
T Consensus        16 kv~ivG~~~vGKTsli~~l~~~   37 (211)
T PLN03118         16 KILLIGDSGVGKSSLLVSFISS   37 (211)
T ss_pred             EEEEECcCCCCHHHHHHHHHhC
Confidence            3668899999999999999743


No 97 
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=93.01  E-value=0.078  Score=41.59  Aligned_cols=22  Identities=36%  Similarity=0.412  Sum_probs=19.1

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -|+++|..++|||+|+|+++..
T Consensus         3 ki~~~G~~~~GKstl~~~l~~~   24 (161)
T TIGR00231         3 KIVIVGDPNVGKSTLLNRLLGN   24 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            3788999999999999999754


No 98 
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=93.00  E-value=0.44  Score=46.21  Aligned_cols=19  Identities=32%  Similarity=0.272  Sum_probs=14.6

Q ss_pred             cchhhccCchhHHHHHHhh
Q psy5031         133 KVSAFRKGKSFLLDFLLRY  151 (281)
Q Consensus       133 ~~~~~r~gkS~Lln~l~~~  151 (281)
                      .+|.-..|||.|+|.|++.
T Consensus       177 ivG~~~~GKSsLin~l~~~  195 (429)
T TIGR03594       177 IIGRPNVGKSTLVNALLGE  195 (429)
T ss_pred             EECCCCCCHHHHHHHHHCC
Confidence            4577788888888888763


No 99 
>PF00735 Septin:  Septin;  InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []. Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.
Probab=92.99  E-value=0.23  Score=46.70  Aligned_cols=21  Identities=24%  Similarity=0.385  Sum_probs=18.0

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |=|+|+.++|||+|+|-|++.
T Consensus         7 ImVvG~sG~GKTTFIntL~~~   27 (281)
T PF00735_consen    7 IMVVGESGLGKTTFINTLFNS   27 (281)
T ss_dssp             EEEEECTTSSHHHHHHHHHTS
T ss_pred             EEEECCCCCCHHHHHHHHHhc
Confidence            447899999999999999764


No 100
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=92.89  E-value=0.33  Score=41.35  Aligned_cols=21  Identities=24%  Similarity=0.275  Sum_probs=18.7

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||.|+|+++..
T Consensus         3 i~vvG~~~vGKSsLi~~~~~~   23 (193)
T cd04118           3 VVMLGKESVGKTSLVERYVHH   23 (193)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678999999999999999753


No 101
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=92.79  E-value=0.09  Score=41.77  Aligned_cols=21  Identities=24%  Similarity=0.203  Sum_probs=18.7

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.++|+.++|||+|+|++...
T Consensus         3 i~~~G~~~~GKStl~~~l~~~   23 (159)
T cd00154           3 IVLIGDSGVGKTSLLLRFVDG   23 (159)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678999999999999999754


No 102
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]
Probab=92.77  E-value=0.076  Score=49.76  Aligned_cols=26  Identities=27%  Similarity=0.328  Sum_probs=23.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .+++|+||.++|||+||..|++.+..
T Consensus        29 ~i~~iiGpNG~GKSTLLk~l~g~l~p   54 (258)
T COG1120          29 EITGILGPNGSGKSTLLKCLAGLLKP   54 (258)
T ss_pred             cEEEEECCCCCCHHHHHHHHhccCCC
Confidence            47899999999999999999998754


No 103
>PLN02318 phosphoribulokinase/uridine kinase
Probab=92.77  E-value=0.13  Score=53.69  Aligned_cols=45  Identities=24%  Similarity=0.442  Sum_probs=36.1

Q ss_pred             CceEEeCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhh
Q psy5031          32 KHKFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        32 ~~~l~ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      |..|-+--.|++.+..    .+....||+|+|+.++|||+|++.|.+.+
T Consensus        45 d~g~~~~ira~qlL~~----~~~~riIIGIaGpSGSGKTTLAk~LaglL   89 (656)
T PLN02318         45 EKGFFVVIRACQLLAQ----KNDGIILVGVAGPSGAGKTVFTEKVLNFM   89 (656)
T ss_pred             ccchhhhhHHHHHHHh----cCCCeEEEEEECCCCCcHHHHHHHHHhhC
Confidence            4567777788885543    34467899999999999999999998765


No 104
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=92.66  E-value=0.3  Score=42.36  Aligned_cols=24  Identities=25%  Similarity=0.170  Sum_probs=20.6

Q ss_pred             EEEEEEecccccChhHHHHHHHHh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +.=|.|+|+.++|||.|++++++.
T Consensus         6 ~~kivvvG~~~vGKTsli~~l~~~   29 (199)
T cd04110           6 LFKLLIIGDSGVGKSSLLLRFADN   29 (199)
T ss_pred             eeEEEEECCCCCCHHHHHHHHhcC
Confidence            456889999999999999999754


No 105
>PF13191 AAA_16:  AAA ATPase domain; PDB: 2V1U_A.
Probab=92.64  E-value=0.14  Score=42.90  Aligned_cols=31  Identities=23%  Similarity=0.196  Sum_probs=20.9

Q ss_pred             CCceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          52 KDKHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        52 ~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      ....-.++-|.|+.++|||+|++.++.++..
T Consensus        20 ~~~~~~~~ll~G~~G~GKT~ll~~~~~~~~~   50 (185)
T PF13191_consen   20 QSGSPRNLLLTGESGSGKTSLLRALLDRLAE   50 (185)
T ss_dssp             SS-----EEE-B-TTSSHHHHHHHHHHHHHH
T ss_pred             HcCCCcEEEEECCCCCCHHHHHHHHHHHHHh
Confidence            3555688999999999999999999988654


No 106
>TIGR02528 EutP ethanolamine utilization protein, EutP. This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site.
Probab=92.64  E-value=0.077  Score=42.78  Aligned_cols=21  Identities=24%  Similarity=0.226  Sum_probs=18.5

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.++|..++|||.|+|+|.+.
T Consensus         3 v~liG~~~vGKSsL~~~l~~~   23 (142)
T TIGR02528         3 IMFIGSVGCGKTTLTQALQGE   23 (142)
T ss_pred             EEEECCCCCCHHHHHHHHcCC
Confidence            679999999999999999643


No 107
>PF13521 AAA_28:  AAA domain; PDB: 1LW7_A.
Probab=92.63  E-value=0.078  Score=44.60  Aligned_cols=21  Identities=24%  Similarity=0.409  Sum_probs=17.7

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|.|...||||+|++.|..+
T Consensus         2 I~i~G~~stGKTTL~~~L~~~   22 (163)
T PF13521_consen    2 IVITGGPSTGKTTLIEALAAR   22 (163)
T ss_dssp             EEEE--TTSHHHHHHHHHHHH
T ss_pred             EEEECCCCCCHHHHHHHHHHc
Confidence            789999999999999999876


No 108
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]
Probab=92.59  E-value=0.088  Score=48.71  Aligned_cols=22  Identities=41%  Similarity=0.397  Sum_probs=19.1

Q ss_pred             EEEEEecccccChhHHHHHHHH
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      -||+|+||.+||||+||.-|++
T Consensus        29 evv~iiGpSGSGKSTlLRclN~   50 (240)
T COG1126          29 EVVVIIGPSGSGKSTLLRCLNG   50 (240)
T ss_pred             CEEEEECCCCCCHHHHHHHHHC
Confidence            4788999999999999988753


No 109
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.57  E-value=0.087  Score=46.95  Aligned_cols=24  Identities=25%  Similarity=0.524  Sum_probs=21.3

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +++|+|+.++|||+||+.|.+.+.
T Consensus        28 ~~~l~G~nGsGKSTLl~~l~G~~~   51 (235)
T cd03261          28 ILAIIGPSGSGKSTLLRLIVGLLR   51 (235)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCC
Confidence            689999999999999999987643


No 110
>COG1161 Predicted GTPases [General function prediction only]
Probab=92.56  E-value=0.66  Score=44.35  Aligned_cols=21  Identities=43%  Similarity=0.430  Sum_probs=17.5

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|...+|||+|+|.|+..
T Consensus       135 v~vvG~PNVGKSslIN~L~~k  155 (322)
T COG1161         135 VGVVGYPNVGKSTLINRLLGK  155 (322)
T ss_pred             EEEEcCCCCcHHHHHHHHhcc
Confidence            888888899999999988643


No 111
>PF01637 Arch_ATPase:  Archaeal ATPase;  InterPro: IPR011579  This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP.; GO: 0005524 ATP binding; PDB: 2FNA_A 2QEN_A.
Probab=92.49  E-value=0.069  Score=45.87  Aligned_cols=27  Identities=19%  Similarity=0.210  Sum_probs=22.6

Q ss_pred             eEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +-.++.|+||-|+|||+|++.+++.+.
T Consensus        19 ~~~~~~l~G~rg~GKTsLl~~~~~~~~   45 (234)
T PF01637_consen   19 PSQHILLYGPRGSGKTSLLKEFINELK   45 (234)
T ss_dssp             -SSEEEEEESTTSSHHHHHHHHHHHCT
T ss_pred             cCcEEEEEcCCcCCHHHHHHHHHHHhh
Confidence            455677899999999999999998863


No 112
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=92.48  E-value=0.1  Score=42.11  Aligned_cols=21  Identities=33%  Similarity=0.208  Sum_probs=18.9

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||.|+|+++..
T Consensus         2 i~i~G~~~~GKTsli~~l~~~   22 (160)
T cd00876           2 VVVLGAGGVGKSAITIQFVKG   22 (160)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            689999999999999999754


No 113
>smart00382 AAA ATPases associated with a variety of cellular activities. AAA - ATPases associated with a variety of cellular activities. This profile/alignment only detects a fraction of this vast family. The poorly conserved N-terminal helix is missing from the alignment.
Probab=92.45  E-value=0.11  Score=39.65  Aligned_cols=25  Identities=28%  Similarity=0.312  Sum_probs=21.7

Q ss_pred             EEEEecccccChhHHHHHHHHhhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .+.|+||.+||||+|+..++..+..
T Consensus         4 ~~~l~G~~G~GKTtl~~~l~~~~~~   28 (148)
T smart00382        4 VILIVGPPGSGKTTLARALARELGP   28 (148)
T ss_pred             EEEEECCCCCcHHHHHHHHHhccCC
Confidence            5789999999999999999887543


No 114
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=92.44  E-value=0.44  Score=41.27  Aligned_cols=21  Identities=24%  Similarity=0.308  Sum_probs=18.4

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||+|+|+++..
T Consensus         3 ivivG~~~vGKTsli~~l~~~   23 (201)
T cd04107           3 VLVIGDLGVGKTSIIKRYVHG   23 (201)
T ss_pred             EEEECCCCCCHHHHHHHHHcC
Confidence            678999999999999999743


No 115
>COG3172 NadR Predicted ATPase/kinase involved in NAD metabolism [Coenzyme metabolism]
Probab=92.41  E-value=0.11  Score=46.29  Aligned_cols=31  Identities=29%  Similarity=0.323  Sum_probs=26.0

Q ss_pred             CCceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          52 KDKHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        52 ~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      +.--+-+|+|.|+-.||||+|.|+|.+.++.
T Consensus         4 rp~F~K~VailG~ESsGKStLv~kLA~~fnt   34 (187)
T COG3172           4 RPFFVKTVAILGGESSGKSTLVNKLANIFNT   34 (187)
T ss_pred             chhhheeeeeecCcccChHHHHHHHHHHhCC
Confidence            3445778999999999999999999987543


No 116
>cd01886 EF-G Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group conta
Probab=92.34  E-value=0.78  Score=42.70  Aligned_cols=21  Identities=19%  Similarity=0.392  Sum_probs=19.1

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|...+|||+|.|+|+..
T Consensus         2 v~ivGh~~~GKTtL~~~Ll~~   22 (270)
T cd01886           2 IGIIAHIDAGKTTTTERILYY   22 (270)
T ss_pred             EEEEcCCCCCHHHHHHHHHHH
Confidence            789999999999999999864


No 117
>TIGR00073 hypB hydrogenase accessory protein HypB. HypB is implicated in insertion of nickel into the large subunit of NiFe hydrogenases.
Probab=92.33  E-value=0.14  Score=45.19  Aligned_cols=28  Identities=21%  Similarity=0.363  Sum_probs=25.5

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHhh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+-+-+|+++|+.++|||+|++++++.+
T Consensus        19 ~~~~~~i~~~G~~gsGKTTli~~l~~~~   46 (207)
T TIGR00073        19 KHGLVVLNFMSSPGSGKTTLIEKLIDNL   46 (207)
T ss_pred             hcCcEEEEEECCCCCCHHHHHHHHHHHH
Confidence            5569999999999999999999999874


No 118
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN. Members of this family resemble PhnN of phosphonate utilization operons, where different such operons confer the ability to use somewhat different profiles of C-P bond-containing compounds (see PubMed:15231805), including phosphites as well as phosphonates. PhnN in E. coli shows considerable homology to guanylate kinases (EC 2.7.4.8), and has actually been shown to act as a ribose 1,5-bisphosphokinase (PRPP forming). This suggests an analogous kinase reaction for phosphonate metabolism, converting 5-phosphoalpha-1-(methylphosphono)ribose to methylphosphono-PRPP.
Probab=92.30  E-value=0.13  Score=43.84  Aligned_cols=23  Identities=30%  Similarity=0.466  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +|.|+|+.++|||+|++.|...+
T Consensus         3 ~~~i~G~sGsGKttl~~~l~~~~   25 (179)
T TIGR02322         3 LIYVVGPSGAGKDTLLDYARARL   25 (179)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHc
Confidence            68899999999999999998764


No 119
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds.  Mutations of members of ABCA subfamily are associated with human genetic diseases, such as, familial high-density lipoprotein (HDL) deficiency, neonatal surfactant deficiency, degenerative retinopathies, and congenital keratinization disorders.  The ABCA1 protein is involved in disorders of cholesterol transport and high-density lipoprotein (HDL) biosynthesis.  The ABCA4 (ABCR) protein transports vitamin A derivatives in the outer segments of photoreceptor cells, and therefore, performs a crucial step in the visual cycle.  The ABCA genes are not present in yeast.  However, evolutionary studies of ABCA genes indicate that they arose as transporters that subsequently duplicated and that certain sets of ABCA genes were lost in different eukaryotic lineages.
Probab=92.29  E-value=0.1  Score=45.87  Aligned_cols=23  Identities=22%  Similarity=0.309  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+..
T Consensus        30 ~~~i~G~nGsGKSTLl~~l~Gl~   52 (220)
T cd03263          30 IFGLLGHNGAGKTTTLKMLTGEL   52 (220)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            78999999999999999998754


No 120
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein.
Probab=92.28  E-value=0.1  Score=45.85  Aligned_cols=24  Identities=29%  Similarity=0.351  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        30 e~~~i~G~nGsGKSTLl~~l~Gl~   53 (216)
T TIGR00960        30 EMVFLVGHSGAGKSTFLKLILGIE   53 (216)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            368899999999999999998764


No 121
>cd01131 PilT Pilus retraction ATPase PilT. PilT is a nucleotide binding protein responsible for the retraction of type IV pili, likely by pili disassembly. This retraction provides the force required for travel of bacteria in low water environments by a mechanism known as twitching motility.
Probab=92.26  E-value=0.13  Score=45.39  Aligned_cols=24  Identities=38%  Similarity=0.559  Sum_probs=22.0

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +|.|+||.+||||++++.|++++.
T Consensus         3 lilI~GptGSGKTTll~~ll~~~~   26 (198)
T cd01131           3 LVLVTGPTGSGKSTTLAAMIDYIN   26 (198)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhh
Confidence            688999999999999999998864


No 122
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion.  Recognition and cleavage of the damaged DNA is a multistep ATP-dependent reaction that requires the UvrA, UvrB, and UvrC proteins.  Both UvrA and UvrB are ATPases, with UvrA having two ATP binding sites, which have the characteristic signature of the family of ABC proteins, and UvrB having one ATP binding site that is structurally related to that of helicases.
Probab=92.26  E-value=0.11  Score=45.42  Aligned_cols=21  Identities=43%  Similarity=0.447  Sum_probs=18.7

Q ss_pred             EEEEEecccccChhHHHHHHH
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLL   77 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll   77 (281)
                      .+++|+||.++|||+|||.++
T Consensus        22 ~~~~l~G~nG~GKSTLl~~il   42 (176)
T cd03238          22 VLVVVTGVSGSGKSTLVNEGL   42 (176)
T ss_pred             CEEEEECCCCCCHHHHHHHHh
Confidence            468899999999999999885


No 123
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=92.23  E-value=0.12  Score=41.82  Aligned_cols=21  Identities=38%  Similarity=0.292  Sum_probs=18.8

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||+|+|+++..
T Consensus         4 i~iiG~~~vGKTsl~~~~~~~   24 (162)
T cd04138           4 LVVVGAGGVGKSALTIQLIQN   24 (162)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678899999999999999854


No 124
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional
Probab=92.21  E-value=0.13  Score=48.91  Aligned_cols=32  Identities=19%  Similarity=0.203  Sum_probs=28.2

Q ss_pred             CCCceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          51 VKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        51 ~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      +..+.+.+|.|+|+.++|||+||+.+++.+..
T Consensus        99 ~~~~~~~~v~l~G~pGsGKTTLl~~l~~~l~~  130 (290)
T PRK10463         99 FAARKQLVLNLVSSPGSGKTTLLTETLMRLKD  130 (290)
T ss_pred             HHhcCCeEEEEECCCCCCHHHHHHHHHHHhcc
Confidence            34678999999999999999999999998643


No 125
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons.  The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins.  They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase.  In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins.  The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein
Probab=92.20  E-value=0.068  Score=48.25  Aligned_cols=52  Identities=44%  Similarity=0.630  Sum_probs=46.8

Q ss_pred             CCceEEEEEEecccccChhHHHHHHHHhhhhcccccCCCCCCCCCCCCCCCCcccCCCCcccccceeeeeceE
Q psy5031          52 KDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVY  124 (281)
Q Consensus        52 ~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~e~~t~gi~~~s~~~  124 (281)
                      .++||+||||+|++|||||||||+|++.                     ..+|+++.+.++||+|||||..|+
T Consensus         3 ~~~~v~vvsv~G~~~sGKS~llN~l~~~---------------------~~~f~~~~~~~~~T~gi~~~~~~~   54 (224)
T cd01851           3 AGFPVAVVSVFGPQSSGKSFLLNHLFGT---------------------LSGFDVMDTSQQTTKGIWMWSVPF   54 (224)
T ss_pred             CCCCEEEEEEECCCCCCHHHHHHHHhCC---------------------CCCeEecCCCCCCccceEEEeccc
Confidence            4789999999999999999999999754                     257999999999999999998775


No 126
>PF13671 AAA_33:  AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B ....
Probab=92.20  E-value=0.13  Score=41.50  Aligned_cols=24  Identities=25%  Similarity=0.340  Sum_probs=21.1

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ||-++|+.+||||+|+..|.+.+.
T Consensus         1 lii~~G~pgsGKSt~a~~l~~~~~   24 (143)
T PF13671_consen    1 LIILCGPPGSGKSTLAKRLAKRLG   24 (143)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHST
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCC
Confidence            678999999999999999987643


No 127
>PTZ00132 GTP-binding nuclear protein Ran; Provisional
Probab=92.18  E-value=0.46  Score=41.58  Aligned_cols=24  Identities=17%  Similarity=0.110  Sum_probs=19.8

Q ss_pred             eEEEEEEecccccChhHHHHHHHH
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      +..-|+++|+.++|||+|+++++.
T Consensus         8 ~~~kv~liG~~g~GKTtLi~~~~~   31 (215)
T PTZ00132          8 PEFKLILVGDGGVGKTTFVKRHLT   31 (215)
T ss_pred             CCceEEEECCCCCCHHHHHHHHHh
Confidence            445689999999999999987653


No 128
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=92.17  E-value=0.075  Score=40.83  Aligned_cols=19  Identities=42%  Similarity=0.401  Sum_probs=17.2

Q ss_pred             EecccccChhHHHHHHHHh
Q psy5031          61 VAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        61 I~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+.++|||+|+|++.+.
T Consensus         1 iiG~~~~GKStl~~~l~~~   19 (157)
T cd00882           1 VVGDSGVGKTSLLNRLLGG   19 (157)
T ss_pred             CCCcCCCcHHHHHHHHHhC
Confidence            5899999999999999765


No 129
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit. This model describes the ATP binding subunit of the multisubunit cobalt transporter in bacteria and its equivalents in archaea. The model is restricted to ATP subunit that is a part of the cobalt transporter, which belongs to the ABC transporter superfamily (ATP Binding Cassette). The model excludes ATP binding subunit that are associated with other transporters belonging to ABC transporter superfamily. This superfamily includes two groups, one which catalyze the uptake of small molecules, including ions from the external milieu and the other group which is engaged in the efflux of small molecular weight compounds and ions from within the cell. Energy derived from the hydrolysis of ATP drive the both the process of uptake and efflux.
Probab=92.17  E-value=0.11  Score=44.87  Aligned_cols=23  Identities=39%  Similarity=0.405  Sum_probs=20.7

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|++..
T Consensus        20 ~~~i~G~nGsGKSTLl~~i~G~~   42 (190)
T TIGR01166        20 VLALLGANGAGKSTLLLHLNGLL   42 (190)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            78999999999999999998653


No 130
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=92.16  E-value=0.11  Score=42.39  Aligned_cols=22  Identities=23%  Similarity=0.217  Sum_probs=19.4

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -|.|+|+.++|||.|+|++++.
T Consensus         3 ki~v~G~~~~GKSsli~~l~~~   24 (163)
T cd01860           3 KLVLLGDSSVGKSSLVLRFVKN   24 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHHcC
Confidence            3788999999999999999764


No 131
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  This ABC transport system of the CbiMNQO family is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most of cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=92.15  E-value=0.11  Score=45.36  Aligned_cols=24  Identities=33%  Similarity=0.389  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        28 ~~~~l~G~nGsGKSTLl~~l~G~~   51 (211)
T cd03225          28 EFVLIVGPNGSGKSTLLRLLNGLL   51 (211)
T ss_pred             cEEEEECCCCCCHHHHHHHHhcCC
Confidence            478999999999999999998764


No 132
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=92.14  E-value=0.13  Score=43.59  Aligned_cols=25  Identities=12%  Similarity=0.193  Sum_probs=22.1

Q ss_pred             EEEEEEecccccChhHHHHHHHHhh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +-+|.|+|+.+||||+|++.|...+
T Consensus         3 ~~ii~i~G~~GsGKsTl~~~l~~~~   27 (188)
T TIGR01360         3 CKIIFIVGGPGSGKGTQCEKIVEKY   27 (188)
T ss_pred             CcEEEEECCCCCCHHHHHHHHHHHh
Confidence            4588999999999999999998764


No 133
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient.  The Pst system of E. coli comprises four distinct subunits encoded by the pstS, pstA, pstB, and pstC genes.  The PstS protein is a phosphate-binding protein located in the periplasmic space. P stA and PstC are hydrophobic and they form the transmembrane portion of the Pst system.  PstB is the catalytic subunit, which couples the energy of ATP hydrolysis to the import of phosphate across cellular membranes through the Pst system, often referred as ABC-protein.  PstB belongs to one of the largest superfamilies of proteins characterized by a highly conserved adenosine triphosphate (ATP) binding cassette (ABC), which is also a nucleotide binding domain (NBD).
Probab=92.10  E-value=0.13  Score=45.61  Aligned_cols=24  Identities=33%  Similarity=0.371  Sum_probs=21.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+.+
T Consensus        27 e~~~i~G~nGsGKSTLl~~i~G~~   50 (227)
T cd03260          27 EITALIGPSGCGKSTLLRLLNRLN   50 (227)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhhc
Confidence            378899999999999999998875


No 134
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional
Probab=92.09  E-value=0.13  Score=45.35  Aligned_cols=27  Identities=22%  Similarity=0.266  Sum_probs=23.9

Q ss_pred             EEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      ..|++|+|+.+||||+|+..|+..+..
T Consensus         6 ~~ii~ivG~sgsGKTTLi~~li~~l~~   32 (173)
T PRK10751          6 IPLLAIAAWSGTGKTTLLKKLIPALCA   32 (173)
T ss_pred             ceEEEEECCCCChHHHHHHHHHHHHhh
Confidence            348999999999999999999988754


No 135
>PRK00300 gmk guanylate kinase; Provisional
Probab=92.09  E-value=0.13  Score=44.62  Aligned_cols=25  Identities=28%  Similarity=0.340  Sum_probs=21.9

Q ss_pred             EEEEEEecccccChhHHHHHHHHhh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      =.+|+|+|+.++|||+|++.|++.+
T Consensus         5 g~~i~i~G~sGsGKstl~~~l~~~~   29 (205)
T PRK00300          5 GLLIVLSGPSGAGKSTLVKALLERD   29 (205)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHhhC
Confidence            3578999999999999999998864


No 136
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids.  The  E. coli branched-chain amino acid transporter comprises a heterodimer of ABC transporters (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.
Probab=92.09  E-value=0.11  Score=45.76  Aligned_cols=24  Identities=25%  Similarity=0.426  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        27 e~~~i~G~nGsGKSTLl~~l~Gl~   50 (222)
T cd03224          27 EIVALLGRNGAGKTTLLKTIMGLL   50 (222)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCCC
Confidence            478999999999999999997654


No 137
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=92.07  E-value=0.12  Score=42.28  Aligned_cols=21  Identities=29%  Similarity=0.162  Sum_probs=18.9

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|+.++|||+|+|++.+.
T Consensus         3 i~v~G~~~~GKTsli~~~~~~   23 (164)
T smart00173        3 LVVLGSGGVGKSALTIQFVQG   23 (164)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            778999999999999999754


No 138
>cd04111 Rab39 Rab39 subfamily.  Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines.  It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.   Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=92.07  E-value=0.47  Score=41.94  Aligned_cols=22  Identities=32%  Similarity=0.211  Sum_probs=18.9

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -|.|+|+.++|||.|+|+|+..
T Consensus         4 KIvvvG~~~vGKTsLi~~l~~~   25 (211)
T cd04111           4 RLIVIGDSTVGKSSLLKRFTEG   25 (211)
T ss_pred             EEEEECCCCCCHHHHHHHHHcC
Confidence            3778999999999999999743


No 139
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=92.01  E-value=0.11  Score=43.08  Aligned_cols=24  Identities=21%  Similarity=0.164  Sum_probs=20.4

Q ss_pred             EEEEEEecccccChhHHHHHHHHh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -.-|+|+|+.++|||+|+|+|.+.
T Consensus        14 ~~~v~i~G~~g~GKStLl~~l~~~   37 (173)
T cd04155          14 EPRILILGLDNAGKTTILKQLASE   37 (173)
T ss_pred             ccEEEEEccCCCCHHHHHHHHhcC
Confidence            345889999999999999999654


No 140
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane.  The FtsE/X transporter is thought to be involved in cell division and is important for assembly or stability of the septal ring.
Probab=92.01  E-value=0.12  Score=45.19  Aligned_cols=23  Identities=30%  Similarity=0.384  Sum_probs=20.9

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        29 ~~~i~G~nGsGKSTLl~~l~G~~   51 (214)
T cd03292          29 FVFLVGPSGAGKSTLLKLIYKEE   51 (214)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            78899999999999999998764


No 141
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity.  In eubacteria and archaea, the typical organization consists of one ABC and one or two IMs.  Eukaryote systems of the ABCA subfamily display ABC domains strongly similar to this family.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=92.01  E-value=0.12  Score=45.28  Aligned_cols=24  Identities=17%  Similarity=0.338  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        27 ~~~~i~G~nGsGKSTLl~~l~G~~   50 (210)
T cd03269          27 EIFGLLGPNGAGKTTTIRMILGII   50 (210)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            368899999999999999998753


No 142
>CHL00071 tufA elongation factor Tu
Probab=92.00  E-value=0.78  Score=45.02  Aligned_cols=27  Identities=22%  Similarity=0.222  Sum_probs=23.9

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+|.--|+|+|...+|||+|+|+|+..
T Consensus         9 ~~~~~~i~i~Gh~d~GKSTL~~~Ll~~   35 (409)
T CHL00071          9 KKPHVNIGTIGHVDHGKTTLTAAITMT   35 (409)
T ss_pred             CCCeEEEEEECCCCCCHHHHHHHHHHH
Confidence            466777999999999999999999865


No 143
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2.7.1.48), also known as uridine kinase or uridine-cytidine kinase (UCK).
Probab=91.99  E-value=0.12  Score=44.87  Aligned_cols=24  Identities=29%  Similarity=0.371  Sum_probs=22.1

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ||+|+|+.+||||+|++.|...+.
T Consensus         1 ii~i~G~sgsGKttla~~l~~~l~   24 (179)
T cd02028           1 VVGIAGPSGSGKTTFAKKLSNQLR   24 (179)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHH
Confidence            689999999999999999998864


No 144
>PRK05439 pantothenate kinase; Provisional
Probab=91.98  E-value=0.23  Score=47.60  Aligned_cols=40  Identities=28%  Similarity=0.394  Sum_probs=29.4

Q ss_pred             HHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          40 EALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        40 eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ++++.++...  ..+.-.||+|+|+.++|||+|++.|...+.
T Consensus        72 ~~~~~fl~~~--~~~~~~iIgIaG~~gsGKSTla~~L~~~l~  111 (311)
T PRK05439         72 AALEQFLGKN--GQKVPFIIGIAGSVAVGKSTTARLLQALLS  111 (311)
T ss_pred             HHHHHHhccc--CCCCCEEEEEECCCCCCHHHHHHHHHHHHH
Confidence            3455555422  234568999999999999999999987653


No 145
>cd00881 GTP_translation_factor GTP translation factor family.  This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation.  In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.
Probab=91.97  E-value=0.13  Score=42.81  Aligned_cols=21  Identities=38%  Similarity=0.507  Sum_probs=19.3

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|...+|||+|+|.|+..
T Consensus         2 v~v~G~~~~GKStlln~l~~~   22 (189)
T cd00881           2 VGIAGHVDHGKTTLTERLLYV   22 (189)
T ss_pred             EEEEeCCCCCHHHHHHHHHHh
Confidence            688999999999999999876


No 146
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein. This model represents LolD, a member of the ABC transporter family (pfam00005). LolD is involved in localization of lipoproteins in some bacteria. It works with a transmembrane protein LolC, which in some species is a paralogous pair LolC and LolE. Depending on whether the residue immediately following the new, modified N-terminal Cys residue, the nascent lipoprotein may be carried further by LolA and LolB to the outer membrane, or remain at the inner membrane. The top scoring proteins excluded by this model include homologs from the archaeal genus Methanosarcina.
Probab=91.96  E-value=0.12  Score=45.49  Aligned_cols=24  Identities=33%  Similarity=0.400  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        32 ~~~~i~G~nGsGKSTLl~~i~G~~   55 (221)
T TIGR02211        32 EIVAIVGSSGSGKSTLLHLLGGLD   55 (221)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998764


No 147
>TIGR00554 panK_bact pantothenate kinase, bacterial type. Shown to be a homodimer in E. coli. This enzyme catalyzes the rate-limiting step in the biosynthesis of coenzyme A. It is very well conserved from E. coli to B. subtilis, but differs considerably from known eukaryotic forms, described in a separate model.
Probab=91.94  E-value=0.25  Score=46.92  Aligned_cols=28  Identities=25%  Similarity=0.348  Sum_probs=23.2

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ..| -||+|+|+.++|||+|++.|...+.
T Consensus        60 ~~p-~IIGIaG~~GSGKSTlar~L~~ll~   87 (290)
T TIGR00554        60 KIP-YIISIAGSVAVGKSTTARILQALLS   87 (290)
T ss_pred             CCC-EEEEEECCCCCCHHHHHHHHHHHHh
Confidence            344 6999999999999999988866553


No 148
>TIGR02673 FtsE cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein.
Probab=91.92  E-value=0.12  Score=45.23  Aligned_cols=23  Identities=26%  Similarity=0.398  Sum_probs=20.7

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|++.+
T Consensus        30 ~~~l~G~nGsGKSTLl~~i~Gl~   52 (214)
T TIGR02673        30 FLFLTGPSGAGKTTLLKLLYGAL   52 (214)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            78899999999999999998764


No 149
>PRK14241 phosphate transporter ATP-binding protein; Provisional
Probab=91.91  E-value=0.12  Score=46.80  Aligned_cols=24  Identities=33%  Similarity=0.285  Sum_probs=21.6

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|++.+
T Consensus        31 e~~~i~G~nGsGKSTLl~~laGl~   54 (258)
T PRK14241         31 SVTAFIGPSGCGKSTVLRTLNRMH   54 (258)
T ss_pred             cEEEEECCCCCCHHHHHHHHhccC
Confidence            578999999999999999998764


No 150
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), also known as guanylate kinase (GKase), catalyzes the reversible phosphoryl transfer from adenosine triphosphate (ATP) to guanosine monophosphate (GMP) to yield adenosine diphosphate (ADP) and guanosine diphosphate (GDP). It plays an essential role in the biosynthesis of guanosine triphosphate (GTP). This enzyme is also important for the activation of some antiviral and anticancer agents, such as acyclovir, ganciclovir, carbovir, and thiopurines.
Probab=91.90  E-value=0.12  Score=43.10  Aligned_cols=23  Identities=35%  Similarity=0.444  Sum_probs=20.4

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +|.|+||.++|||+|++.|.+.+
T Consensus         1 ~i~i~GpsGsGKstl~~~L~~~~   23 (137)
T cd00071           1 LIVLSGPSGVGKSTLLKRLLEEF   23 (137)
T ss_pred             CEEEECCCCCCHHHHHHHHHhcC
Confidence            47889999999999999998763


No 151
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein. Phosphonates are a class of phosphorus-containing organic compound with a stable direct C-P bond rather than a C-O-P linkage. A number of bacterial species have operons, typically about 14 genes in size, with genes for ATP-dependent transport of phosphonates, degradation, and regulation of the expression of the system. Members of this protein family are the ATP-binding cassette component of tripartite ABC transporters of phosphonates.
Probab=91.88  E-value=0.12  Score=46.13  Aligned_cols=24  Identities=33%  Similarity=0.425  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        29 e~~~l~G~nGsGKSTLl~~l~Gl~   52 (243)
T TIGR02315        29 EFVAIIGPSGAGKSTLLRCINRLV   52 (243)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCc
Confidence            378999999999999999998754


No 152
>cd04167 Snu114p Snu114p subfamily.  Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle.  U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns.  Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2.  This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.
Probab=91.85  E-value=0.46  Score=41.82  Aligned_cols=21  Identities=43%  Similarity=0.751  Sum_probs=18.9

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|...+|||+|+++|+..
T Consensus         3 v~iiG~~~~GKTtL~~~l~~~   23 (213)
T cd04167           3 VAIAGHLHHGKTSLLDMLIEQ   23 (213)
T ss_pred             EEEEcCCCCCHHHHHHHHHHh
Confidence            678899999999999999875


No 153
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component.  The biological function of this family is not well characterized, but display ABC domains similar to members of ABCA subfamily.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.85  E-value=0.11  Score=45.47  Aligned_cols=23  Identities=22%  Similarity=0.327  Sum_probs=21.1

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        27 ~~~i~G~nGsGKSTLl~~l~Gl~   49 (211)
T cd03264          27 MYGLLGPNGAGKTTLMRILATLT   49 (211)
T ss_pred             cEEEECCCCCCHHHHHHHHhCCC
Confidence            88999999999999999998754


No 154
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=91.80  E-value=0.52  Score=45.67  Aligned_cols=22  Identities=36%  Similarity=0.400  Sum_probs=19.4

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .|+|+|...+|||+|+|+|++.
T Consensus         1 ~i~ivG~~nvGKStL~n~l~~~   22 (429)
T TIGR03594         1 VVAIVGRPNVGKSTLFNRLTGK   22 (429)
T ss_pred             CEEEECCCCCCHHHHHHHHhCC
Confidence            3789999999999999999754


No 155
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=91.79  E-value=0.14  Score=41.38  Aligned_cols=21  Identities=29%  Similarity=0.245  Sum_probs=18.9

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|+.++|||+|+|+|++.
T Consensus         3 i~i~G~~~~GKStli~~l~~~   23 (162)
T cd04123           3 VVLLGEGRVGKTSLVLRYVEN   23 (162)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            688999999999999999754


No 156
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB. This molybdenum cofactor biosynthesis enzyme is similar to the urease accessory protein UreG and to the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocenters of their respective target enzymes.
Probab=91.79  E-value=0.14  Score=43.86  Aligned_cols=25  Identities=24%  Similarity=0.475  Sum_probs=22.8

Q ss_pred             EEEEecccccChhHHHHHHHHhhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      ||+|+|+.++|||+|+++|+..+..
T Consensus         1 vi~i~G~~gsGKTtl~~~l~~~l~~   25 (155)
T TIGR00176         1 VLQIVGPKNSGKTTLIERLVKALKA   25 (155)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHHh
Confidence            6899999999999999999998754


No 157
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin.  In addition to DrrA, the complex includes an integral membrane protein called DrrB.  DrrA belongs to the ABC family of transporters and shares sequence and functional similarities with a protein found in cancer cells called  P-glycoprotein.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region in addition to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.79  E-value=0.13  Score=45.43  Aligned_cols=24  Identities=17%  Similarity=0.317  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        27 e~~~i~G~nGsGKSTLl~~i~G~~   50 (220)
T cd03265          27 EIFGLLGPNGAGKTTTIKMLTTLL   50 (220)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            478899999999999999998754


No 158
>TIGR02173 cyt_kin_arch cytidylate kinase, putative. Proteins in this family are believed to be cytidylate kinase. Members of this family are found in the archaea and in spirochaetes, and differ considerably from the common bacterial form of cytidylate kinase described by TIGR00017.
Probab=91.78  E-value=0.16  Score=42.33  Aligned_cols=23  Identities=17%  Similarity=0.424  Sum_probs=21.2

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      ||.|.|+++||||++++.|.+.+
T Consensus         2 iI~i~G~~GSGKstia~~la~~l   24 (171)
T TIGR02173         2 IITISGPPGSGKTTVAKILAEKL   24 (171)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHc
Confidence            79999999999999999998764


No 159
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE).  They are clustered together phylogenetically.  MacAB is an exporter that confers resistance to macrolides, while the LolCDE system is not a transporter at all.  An FtsE null mutants showed filamentous growth and appeared viable on high salt medium only, indicating a role for FtsE in cell division and/or salt transport.  The LolCDE complex catalyses the release of lipoproteins from the cytoplasmic membrane prior to their targeting to the outer membrane.
Probab=91.77  E-value=0.13  Score=45.20  Aligned_cols=24  Identities=33%  Similarity=0.358  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|++.+
T Consensus        31 ~~~~l~G~nGsGKSTLl~~i~Gl~   54 (218)
T cd03255          31 EFVAIVGPSGSGKSTLLNILGGLD   54 (218)
T ss_pred             CEEEEEcCCCCCHHHHHHHHhCCc
Confidence            378899999999999999998764


No 160
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota.  The transition metal cobalt is an essential component of many enzymes and must be transported into cells in appropriate amounts when needed.  The CbiMNQO family ABC transport system is involved in cobalt transport in association with the cobalamin (vitamin B12) biosynthetic pathways.  Most cobalt (Cbi) transport systems possess a separate CbiN component, the cobalt-binding periplasmic protein, and they are encoded by the conserved gene cluster cbiMNQO.  Both the CbiM and CbiQ proteins are integral cytoplasmic membrane proteins, and the CbiO protein has the linker peptide and the Walker A and B motifs commonly found in the ATPase components of the ABC-type transport systems.
Probab=91.77  E-value=0.13  Score=44.93  Aligned_cols=24  Identities=21%  Similarity=0.379  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        27 e~~~i~G~nGsGKSTLl~~l~Gl~   50 (205)
T cd03226          27 EIIALTGKNGAGKTTLAKILAGLI   50 (205)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            378999999999999999998754


No 161
>PF05970 PIF1:  PIF1-like helicase;  InterPro: IPR010285  This entry represents PIF1 helicase and related proteins. The PIF1 helicase inhibits telomerase activity and is cell cycle regulated [, ]. 
Probab=91.76  E-value=0.2  Score=48.31  Aligned_cols=25  Identities=32%  Similarity=0.537  Sum_probs=21.2

Q ss_pred             EEEEecccccChhHHHHHHHHhhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .+-|.|+.+||||||+|.|..++..
T Consensus        24 ~~fv~G~~GtGKs~l~~~i~~~~~~   48 (364)
T PF05970_consen   24 NFFVTGPAGTGKSFLIKAIIDYLRS   48 (364)
T ss_pred             EEEEEcCCCCChhHHHHHHHHHhcc
Confidence            4567899999999999999988654


No 162
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=91.76  E-value=0.14  Score=41.90  Aligned_cols=22  Identities=41%  Similarity=0.563  Sum_probs=19.9

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +|+|+|..++|||.|+|+|...
T Consensus         2 ~i~iiG~~~~GKtsli~~l~~~   23 (168)
T cd01887           2 VVTVMGHVDHGKTTLLDKIRKT   23 (168)
T ss_pred             EEEEEecCCCCHHHHHHHHHhc
Confidence            5899999999999999999754


No 163
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=91.75  E-value=0.13  Score=42.21  Aligned_cols=21  Identities=29%  Similarity=0.333  Sum_probs=18.8

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||+|+|+|.+.
T Consensus         2 i~~vG~~~~GKstLi~~l~~~   22 (167)
T cd04160           2 VLILGLDNAGKTTFLEQLKTL   22 (167)
T ss_pred             EEEEecCCCCHHHHHHHHhhh
Confidence            678999999999999999764


No 164
>PF13555 AAA_29:  P-loop containing region of AAA domain
Probab=91.74  E-value=0.16  Score=37.77  Aligned_cols=25  Identities=32%  Similarity=0.324  Sum_probs=21.2

Q ss_pred             EEEEecccccChhHHHHHHHHhhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      +..|.|+.++|||+||+.+.--|++
T Consensus        25 ~tli~G~nGsGKSTllDAi~~~L~~   49 (62)
T PF13555_consen   25 VTLITGPNGSGKSTLLDAIQTVLYG   49 (62)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHcC
Confidence            6889999999999999999755544


No 165
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1).  NFT1 belongs to the MRP (mulrtidrug resisitance-associated protein) family of ABC transporters.  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions such as glutathione, glucuronate, and sulfate.
Probab=91.74  E-value=0.14  Score=44.82  Aligned_cols=24  Identities=29%  Similarity=0.479  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|++..
T Consensus        35 ~~~~i~G~nGsGKSTLl~~l~Gl~   58 (207)
T cd03369          35 EKIGIVGRTGAGKSTLILALFRFL   58 (207)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            468899999999999999998764


No 166
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules. The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.73  E-value=0.14  Score=45.07  Aligned_cols=26  Identities=31%  Similarity=0.309  Sum_probs=23.2

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHhh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+ -+++|+|+.++|||+|++.|++.+
T Consensus        22 ~~-e~~~i~G~nGsGKSTLl~~l~G~~   47 (214)
T cd03297          22 NE-EVTGIFGASGAGKSTLLRCIAGLE   47 (214)
T ss_pred             cc-eeEEEECCCCCCHHHHHHHHhCCC
Confidence            36 899999999999999999998764


No 167
>cd01884 EF_Tu EF-Tu subfamily.  This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts.  It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors.  The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family.  EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function.  When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors.  Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=91.72  E-value=0.75  Score=40.64  Aligned_cols=23  Identities=26%  Similarity=0.330  Sum_probs=20.4

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .-|+|+|...+|||+|+++|+..
T Consensus         3 ~ni~iiGh~~~GKTTL~~~Ll~~   25 (195)
T cd01884           3 VNVGTIGHVDHGKTTLTAAITKV   25 (195)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHH
Confidence            34899999999999999999865


No 168
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=91.71  E-value=0.13  Score=41.96  Aligned_cols=21  Identities=29%  Similarity=0.167  Sum_probs=18.8

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||.|+|+|...
T Consensus         3 i~v~G~~~~GKSsli~~l~~~   23 (161)
T cd01863           3 ILLIGDSGVGKSSLLLRFTDD   23 (161)
T ss_pred             EEEECCCCCCHHHHHHHHHcC
Confidence            789999999999999999743


No 169
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE).  The NikABCDE system of E. coli belongs to this family and is composed of the periplasmic binding protein NikA, two integral membrane components (NikB and NikC), and two ATPase (NikD and NikE).  The NikABCDE transporter is synthesized under anaerobic conditions to meet the increased demand for nickel resulting from hydrogenase synthesis.  The molecular mechanism of nickel uptake in many bacteria and most archaea is not known.  Many other members of this ABC family are also involved in the uptake of dipeptides and oligopeptides.  The oligopeptide transport system (Opp) is a five-component ABC transport composed of a membrane-anchored substrate binding proteins (SRP), OppA, two transmembrane proteins, OppB and OppC, and two ATP-binding domains, OppD and OppF.
Probab=91.70  E-value=0.13  Score=45.36  Aligned_cols=24  Identities=25%  Similarity=0.331  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        32 e~~~i~G~nGsGKSTLl~~l~G~~   55 (228)
T cd03257          32 ETLGLVGESGSGKSTLARAILGLL   55 (228)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998764


No 170
>PRK09087 hypothetical protein; Validated
Probab=91.67  E-value=0.38  Score=43.56  Aligned_cols=54  Identities=17%  Similarity=0.177  Sum_probs=37.2

Q ss_pred             eeEEEEe---CCC---ceEEe---CHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHh
Q psy5031          23 AIQIVKS---EEK---HKFIL---DYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        23 pvqLV~~---~~~---~~l~l---n~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +-||+-.   +.+   ..|.+   |..|+..+. +.  .+++-..+.|+|+.++|||+|++.+...
T Consensus         5 ~~Ql~l~~~~~~~~~~~~Fi~~~~N~~a~~~l~-~~--~~~~~~~l~l~G~~GsGKThLl~~~~~~   67 (226)
T PRK09087          5 PEQLPLNFSHDPAYGRDDLLVTESNRAAVSLVD-HW--PNWPSPVVVLAGPVGSGKTHLASIWREK   67 (226)
T ss_pred             CcceeeCCCCCCCCChhceeecCchHHHHHHHH-hc--ccCCCCeEEEECCCCCCHHHHHHHHHHh
Confidence            5566654   222   37777   788888543 21  2344446899999999999999988754


No 171
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system.  Phosphonates are a class of organophosphorus compounds characterized by a chemically stable carbon-to-phosphorus (C-P) bond.  Phosphonates are widespread among naturally occurring compounds in all kingdoms of wildlife, but only procaryotic microorganisms are able to cleave this bond.  Certain bacteria such as E. coli can use alkylphosphonates as a phosphorus source.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.61  E-value=0.13  Score=45.68  Aligned_cols=23  Identities=35%  Similarity=0.387  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|++.+
T Consensus        29 ~~~i~G~nGsGKSTLl~~l~Gl~   51 (241)
T cd03256          29 FVALIGPSGAGKSTLLRCLNGLV   51 (241)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCc
Confidence            78999999999999999998754


No 172
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=91.60  E-value=0.17  Score=41.28  Aligned_cols=23  Identities=26%  Similarity=0.163  Sum_probs=20.0

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .=|.++|+.++|||+|+|++++.
T Consensus         3 ~ki~i~G~~~~GKtsl~~~~~~~   25 (164)
T cd04145           3 YKLVVVGGGGVGKSALTIQFIQS   25 (164)
T ss_pred             eEEEEECCCCCcHHHHHHHHHhC
Confidence            45789999999999999999754


No 173
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=91.60  E-value=0.13  Score=43.13  Aligned_cols=26  Identities=23%  Similarity=0.341  Sum_probs=20.3

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      ..++. |.++|+.++|||.|+|+|...
T Consensus        12 ~~~~k-v~ivG~~~~GKTsL~~~l~~~   37 (173)
T cd04154          12 EREMR-ILILGLDNAGKTTILKKLLGE   37 (173)
T ss_pred             CCccE-EEEECCCCCCHHHHHHHHccC
Confidence            44443 559999999999999999643


No 174
>PF03308 ArgK:  ArgK protein;  InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components. In Escherichia coli, the arginine-ornithine transport system requires an arginine-ornithine-binding protein and the lysine-arginine-ornithine (LAO) transport system includes a LAO-binding protein. Both periplasmic proteins can be phosphorylated by a single kinase, ArgK [] resulting in reduced levels of transport activity of the periplasmic transport systems that include each of the binding proteins. The ArgK protein acts as an ATPase enzyme and as a kinase.; PDB: 3MD0_A 3P32_A 2QM7_A 2QM8_A 2WWW_D 2P67_A 3NXS_A.
Probab=91.60  E-value=0.22  Score=46.94  Aligned_cols=40  Identities=30%  Similarity=0.410  Sum_probs=29.8

Q ss_pred             HHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          39 YEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        39 ~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .+.|+.+..+    ..+-.+|+|.|+.+.|||+|++.|..++..
T Consensus        16 ~~ll~~l~~~----~g~a~~iGiTG~PGaGKSTli~~l~~~~~~   55 (266)
T PF03308_consen   16 RELLKRLYPH----TGRAHVIGITGPPGAGKSTLIDALIRELRE   55 (266)
T ss_dssp             HHHHHHHGGG----TT-SEEEEEEE-TTSSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHhh----cCCceEEEeeCCCCCcHHHHHHHHHHHHhh
Confidence            3556665542    335569999999999999999999998765


No 175
>TIGR03263 guanyl_kin guanylate kinase. Members of this family are the enzyme guanylate kinase, also called GMP kinase. This enzyme transfers a phosphate from ATP to GMP, yielding ADP and GDP.
Probab=91.58  E-value=0.15  Score=43.30  Aligned_cols=23  Identities=30%  Similarity=0.378  Sum_probs=20.7

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +|.|+||.++|||+|++.|.+..
T Consensus         3 ii~l~G~~GsGKsTl~~~L~~~~   25 (180)
T TIGR03263         3 LIVISGPSGVGKSTLVKALLEED   25 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHccC
Confidence            68899999999999999998753


No 176
>cd01885 EF2 EF2 (for archaea and eukarya).  Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes.  The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome.  The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins.  Two major mechanisms are known to regulate protein elongation and both involve eEF2.  First, eEF2 can be modulated by reversible phosphorylation.  Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes.  Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2.  In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation.  Seco
Probab=91.58  E-value=0.7  Score=41.91  Aligned_cols=21  Identities=29%  Similarity=0.382  Sum_probs=19.1

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|....|||+|++.|+..
T Consensus         3 vaiiGhvd~GKTTL~d~Ll~~   23 (222)
T cd01885           3 ICIIAHVDHGKTTLSDSLLAS   23 (222)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            788899999999999999865


No 177
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport.  Other members of this system include the MetP permease and  the MetQ substrate binding protein.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.55  E-value=0.14  Score=45.52  Aligned_cols=25  Identities=20%  Similarity=0.247  Sum_probs=21.5

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .+++|+|+.++|||+||+.|.+.+.
T Consensus        32 e~~~l~G~nGsGKSTLl~~l~G~~~   56 (233)
T cd03258          32 EIFGIIGRSGAGKSTLIRCINGLER   56 (233)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCCC
Confidence            3788999999999999999987643


No 178
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters.  This family includes transporters involved in the uptake of various metallic cations such as iron, manganese, and zinc.  The ATPases of this group of transporters are very similar to members of iron-siderophore uptake family suggesting that they share a common ancestor.  The best characterized metal-type ABC transporters are the YfeABCD system of Y. pestis, the SitABCD system of Salmonella enterica serovar Typhimurium, and the SitABCD transporter of Shigella flexneri.  Moreover other uncharacterized homologs of these metal-type transporters are mainly found in pathogens like Haemophilus or enteroinvasive E. coli isolates.
Probab=91.54  E-value=0.13  Score=45.16  Aligned_cols=23  Identities=30%  Similarity=0.482  Sum_probs=20.4

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+.+
T Consensus        27 ~~~l~G~nGsGKSTLl~~l~G~~   49 (213)
T cd03235          27 FLAIVGPNGAGKSTLLKAILGLL   49 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHcCCC
Confidence            68899999999999999997654


No 179
>PRK14242 phosphate transporter ATP-binding protein; Provisional
Probab=91.52  E-value=0.15  Score=45.89  Aligned_cols=23  Identities=35%  Similarity=0.356  Sum_probs=20.7

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+||+.|.+.
T Consensus        33 e~~~i~G~nGsGKSTLl~~l~Gl   55 (253)
T PRK14242         33 QVTALIGPSGCGKSTFLRCLNRM   55 (253)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhh
Confidence            37899999999999999999875


No 180
>COG4240 Predicted kinase [General function prediction only]
Probab=91.51  E-value=0.16  Score=47.62  Aligned_cols=29  Identities=24%  Similarity=0.386  Sum_probs=24.6

Q ss_pred             EEEEEEecccccChhHHHHHHHHhhhhcc
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRYMNFTY   84 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~l~~~~   84 (281)
                      =-||+|+||++||||||.-.|-+.|..++
T Consensus        50 Pli~gisGpQGSGKStls~~i~~~L~~kg   78 (300)
T COG4240          50 PLIVGISGPQGSGKSTLSALIVRLLAAKG   78 (300)
T ss_pred             ceEEEeecCCCCchhhHHHHHHHHHHHhc
Confidence            35899999999999999999888776653


No 181
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional
Probab=91.50  E-value=0.14  Score=45.61  Aligned_cols=24  Identities=29%  Similarity=0.354  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        36 e~~~l~G~nGsGKSTLl~~l~Gl~   59 (233)
T PRK11629         36 EMMAIVGSSGSGKSTLLHLLGGLD   59 (233)
T ss_pred             cEEEEECCCCCCHHHHHHHHhcCC
Confidence            378999999999999999998754


No 182
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein.  In A. tumefaciens cyclic beta-1, 2-glucan must be transported into the periplasmic space to exert its action as a virluence factor.  This subfamily belongs to the MRP-like family and is involved in drug, peptide, and lipid export.  The MRP-like family, similar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains each composed of six transmembrane (TM) helices and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.48  E-value=0.14  Score=45.23  Aligned_cols=23  Identities=30%  Similarity=0.689  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        31 ~~~i~G~nGsGKSTLl~~l~G~~   53 (229)
T cd03254          31 TVAIVGPTGAGKTTLINLLMRFY   53 (229)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCc
Confidence            68999999999999999998764


No 183
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively.  Histidine permease is a multisubunit complex containing the HisQ and HisM integral membrane subunits and two copies of HisP.  HisP has properties intermediate between those of integral and peripheral membrane proteins and is accessible from both sides of the membrane, presumably by its interaction with HisQ and HisM.  The two HisP subunits form a homodimer within the complex.  The domain structure of the amino acid uptake systems is typical for prokaryote extracellular solute binding protein-dependent uptake systems.  All of the amino acid uptake systems also have at least one, and in a few cases, two extracellular solute binding proteins located in the periplasm of Gram-negative bacteria, or attached to the cell membrane of Gram-positive bacteria.  The best-studied member of the PAAT (polar amino acid transport) family is the HisJQM
Probab=91.46  E-value=0.14  Score=44.59  Aligned_cols=23  Identities=35%  Similarity=0.343  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|++.+
T Consensus        28 ~~~l~G~nGsGKSTLl~~l~G~~   50 (213)
T cd03262          28 VVVIIGPSGSGKSTLLRCINLLE   50 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            78899999999999999998764


No 184
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional
Probab=91.45  E-value=0.15  Score=44.51  Aligned_cols=24  Identities=21%  Similarity=0.386  Sum_probs=20.7

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|++..
T Consensus        28 e~~~l~G~nGsGKSTLl~~i~G~~   51 (200)
T PRK13540         28 GLLHLKGSNGAGKTTLLKLIAGLL   51 (200)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            468899999999999999998653


No 185
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group. A gene pair with a fairly wide distribution consists of a polypeptide related to the lactococcin 972 (see TIGR01653) and multiple-membrane-spanning putative immunity protein (see TIGR01654). This model represents a small clade within the ABC transporters that regularly are found adjacent to these bacteriocin system gene pairs and are likely serve as export proteins.
Probab=91.42  E-value=0.15  Score=44.26  Aligned_cols=24  Identities=25%  Similarity=0.283  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|++.+
T Consensus        25 e~~~i~G~nGsGKSTLl~~l~G~~   48 (206)
T TIGR03608        25 KMYAIIGESGSGKSTLLNIIGLLE   48 (206)
T ss_pred             cEEEEECCCCCCHHHHHHHHhcCC
Confidence            368999999999999999998764


No 186
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=91.42  E-value=0.21  Score=41.17  Aligned_cols=26  Identities=15%  Similarity=0.207  Sum_probs=22.9

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      ++..-|.++|+.++|||+|++++...
T Consensus         5 ~~~~~v~v~G~~~~GKSsli~~l~~~   30 (169)
T cd04114           5 DFLFKIVLIGNAGVGKTCLVRRFTQG   30 (169)
T ss_pred             CceeEEEEECCCCCCHHHHHHHHHhC
Confidence            46788999999999999999999753


No 187
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids.  The genes yhbG and yhbN are located in a single operon and may function together in cell envelope during biogenesis.  YhbG is the putative ATP-binding cassette component and YhbN is the putative periplasmic-binding protein.  Depletion of each gene product leads to growth arrest, irreversible cell damage and loss of viability in E. coli.  The YhbG homolog (NtrA) is essential in Rhizobium meliloti, a symbiotic nitrogen-fixing bacterium.
Probab=91.40  E-value=0.14  Score=45.29  Aligned_cols=24  Identities=17%  Similarity=0.304  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|++.+
T Consensus        27 e~~~l~G~nGsGKSTLl~~l~Gl~   50 (232)
T cd03218          27 EIVGLLGPNGAGKTTTFYMIVGLV   50 (232)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            478999999999999999998764


No 188
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional
Probab=91.38  E-value=0.15  Score=45.70  Aligned_cols=24  Identities=29%  Similarity=0.224  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|++..
T Consensus        29 e~~~i~G~nGsGKSTLl~~l~G~~   52 (242)
T PRK11124         29 ETLVLLGPSGAGKSSLLRVLNLLE   52 (242)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            468999999999999999998764


No 189
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.38  E-value=0.15  Score=45.02  Aligned_cols=24  Identities=29%  Similarity=0.307  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        31 ~~~~i~G~nGsGKSTLl~~l~Gl~   54 (220)
T cd03293          31 EFVALVGPSGCGKSTLLRIIAGLE   54 (220)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998754


No 190
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional
Probab=91.36  E-value=0.15  Score=45.84  Aligned_cols=23  Identities=30%  Similarity=0.351  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+|++.|++.
T Consensus        29 e~~~i~G~nGsGKSTLl~~l~Gl   51 (246)
T PRK14269         29 KITALIGASGCGKSTFLRCFNRM   51 (246)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcc
Confidence            47899999999999999999875


No 191
>PRK00454 engB GTP-binding protein YsxC; Reviewed
Probab=91.36  E-value=0.14  Score=43.44  Aligned_cols=25  Identities=28%  Similarity=0.255  Sum_probs=21.2

Q ss_pred             eEEEEEEecccccChhHHHHHHHHh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      ...-|+|+|..++|||+|+|.|++.
T Consensus        23 ~~~~v~ivG~~~~GKSsli~~l~~~   47 (196)
T PRK00454         23 DGPEIAFAGRSNVGKSSLINALTNR   47 (196)
T ss_pred             CCCEEEEEcCCCCCHHHHHHHHhCC
Confidence            4455889999999999999999753


No 192
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins, and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains, which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=91.36  E-value=0.14  Score=44.82  Aligned_cols=24  Identities=21%  Similarity=0.351  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        26 e~~~l~G~nGsGKSTLl~~l~Gl~   49 (177)
T cd03222          26 EVIGIVGPNGTGKTTAVKILAGQL   49 (177)
T ss_pred             CEEEEECCCCChHHHHHHHHHcCC
Confidence            378899999999999999998754


No 193
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance.  Bacitracin is a dodecapeptide antibiotic produced by B. licheniformis and B. subtilis.  The synthesis of bacitracin is non-ribosomally catalyzed by a multienzyme complex BcrABC.  Bacitracin has potent antibiotic activity against gram-positive bacteria.  The inhibition of peptidoglycan biosynthesis is the best characterized bacterial effect of bacitracin.  The bacitracin resistance of B. licheniformis is mediated by the ABC transporter Bcr which is composed of two identical BcrA ATP-binding subunits and one each of the integral membrane proteins, BcrB and BcrC.  B. subtilis cells carrying bcr genes on high-copy number plasmids develop collateral detergent sensitivity, a similar phenomenon in human cells with overexpressed multi-drug resistance P-glycoprotein.
Probab=91.36  E-value=0.15  Score=44.49  Aligned_cols=24  Identities=17%  Similarity=0.310  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        27 ~~~~i~G~nGsGKSTLl~~l~Gl~   50 (208)
T cd03268          27 EIYGFLGPNGAGKTTTMKIILGLI   50 (208)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCc
Confidence            578899999999999999998754


No 194
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional
Probab=91.34  E-value=0.15  Score=45.07  Aligned_cols=24  Identities=29%  Similarity=0.328  Sum_probs=21.5

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+.+
T Consensus        37 e~~~i~G~nGsGKSTLl~~i~Gl~   60 (228)
T PRK10584         37 ETIALIGESGSGKSTLLAILAGLD   60 (228)
T ss_pred             CEEEEECCCCCCHHHHHHHHHcCC
Confidence            488999999999999999998764


No 195
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  Pentoses include xylose, arabinose, and ribose.  Important hexoses include glucose, galactose, and fructose.  In members of the Carb_monos family, the single hydrophobic gene product forms a homodimer while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=91.30  E-value=0.16  Score=43.23  Aligned_cols=23  Identities=30%  Similarity=0.325  Sum_probs=20.2

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -+++|+|+.++|||+|++.|.+.
T Consensus        27 e~~~l~G~nGsGKSTLl~~i~G~   49 (163)
T cd03216          27 EVHALLGENGAGKSTLMKILSGL   49 (163)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            47889999999999999999765


No 196
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup.  This family is comprised of proteins involved in the transport of apparently unrelated solutes and proteins specific for di- and oligosaccharides and polyols.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.   ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=91.29  E-value=0.15  Score=44.59  Aligned_cols=23  Identities=22%  Similarity=0.310  Sum_probs=20.6

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|++.+
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~G~~   50 (213)
T cd03259          28 FLALLGPSGCGKTTLLRLIAGLE   50 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            68899999999999999998764


No 197
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA. This model describes the cyt c biogenesis protein encoded by ccmA in bacteria. An exception is, an arabidopsis protein. Quite likely this is encoded by an organelle. Bacterial c-type cytocromes are located on the periplasmic side of the cytoplasmic membrane. Several gene products encoded in a locus designated as 'ccm' are implicated in the transport and assembly of the functional cytochrome C. This cluster includes genes: ccmA;B;C;D;E;F;G and H. The posttranslational pathway includes the transport of heme moiety, the secretion of the apoprotein and the covalent attachment of the heme with the apoprotein. The proteins ccmA and B represent an ABC transporter; ccmC and D participate in heme transfer to ccmE, which function as a periplasmic heme chaperone. The presence of ccmF, G and H is suggested to be obligatory for the final functional assembly of cytochrome c.
Probab=91.28  E-value=0.16  Score=44.23  Aligned_cols=25  Identities=28%  Similarity=0.321  Sum_probs=21.6

Q ss_pred             EEEEEEecccccChhHHHHHHHHhh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      =.+++|+|+.++|||+|++.|.+..
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~l~G~~   50 (198)
T TIGR01189        26 GEALQVTGPNGIGKTTLLRILAGLL   50 (198)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCC
Confidence            3578899999999999999998754


No 198
>PF13401 AAA_22:  AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B.
Probab=91.28  E-value=0.18  Score=40.01  Aligned_cols=25  Identities=28%  Similarity=0.453  Sum_probs=19.8

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .++.|.|+.++|||++++++++.+.
T Consensus         5 ~~~~i~G~~G~GKT~~~~~~~~~~~   29 (131)
T PF13401_consen    5 RILVISGPPGSGKTTLIKRLARQLN   29 (131)
T ss_dssp             --EEEEE-TTSSHHHHHHHHHHHHH
T ss_pred             cccEEEcCCCCCHHHHHHHHHHHhH
Confidence            3678899999999999999998764


No 199
>PRK14239 phosphate transporter ATP-binding protein; Provisional
Probab=91.27  E-value=0.15  Score=45.81  Aligned_cols=23  Identities=30%  Similarity=0.371  Sum_probs=20.4

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -+++|+|+.++|||+|++.|.+.
T Consensus        32 e~~~i~G~nGsGKSTLl~~l~Gl   54 (252)
T PRK14239         32 EITALIGPSGSGKSTLLRSINRM   54 (252)
T ss_pred             cEEEEECCCCCCHHHHHHHHhcc
Confidence            36899999999999999999764


No 200
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine.  MJ1267 is a branched-chain amino acid transporter with 29% similarity to both the LivF and LivG components of the E. coli  branched-chain amino acid transporter.  MJ1267 contains an insertion from residues 114 to 123 characteristic of LivG (Leucine-Isoleucine-Valine) homologs.  The branched-chain amino acid transporter from E. coli comprises a heterodimer of ABCs (LivF and LivG), a heterodimer of six-helix TM domains (LivM and LivH), and one of two alternative soluble periplasmic substrate binding proteins (LivK or LivJ).
Probab=91.24  E-value=0.14  Score=45.48  Aligned_cols=24  Identities=17%  Similarity=0.416  Sum_probs=21.0

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|.+.+
T Consensus        27 e~~~l~G~nGsGKSTLl~~l~Gl~   50 (236)
T cd03219          27 EIHGLIGPNGAGKTTLFNLISGFL   50 (236)
T ss_pred             cEEEEECCCCCCHHHHHHHHcCCC
Confidence            378999999999999999998754


No 201
>PRK03003 GTP-binding protein Der; Reviewed
Probab=91.23  E-value=1.2  Score=44.60  Aligned_cols=101  Identities=20%  Similarity=0.148  Sum_probs=0.0

Q ss_pred             EEEecccccChhHHHHHHHHhhhhcccccCCCCCCCCCCCCCCCCcccCCCCcccccceeeeeceEEeecCCcccchhhc
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFR  138 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~l~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~e~~t~gi~~~s~~~~~~~~~~~~~~~~r  138 (281)
                      |+|+|....|||+|+|+|++.                                                           
T Consensus       214 I~iiG~~nvGKSSLin~l~~~-----------------------------------------------------------  234 (472)
T PRK03003        214 VALVGKPNVGKSSLLNKLAGE-----------------------------------------------------------  234 (472)
T ss_pred             EEEECCCCCCHHHHHHHHhCC-----------------------------------------------------------


Q ss_pred             cCchhHHHHHHhhhcccccccCCCCCCCCCCCCCCCCcccCCCCCCcccceEeeecceeecCCCCCceEEEEEecCCCCC
Q psy5031         139 KGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFD  218 (281)
Q Consensus       139 ~gkS~Lln~l~~~~~~~~~~~~~~~~~~~~~~~~~~gF~~~~~~~~~TkGIWmWs~P~~~~~~~g~~v~VlLlDTEG~~d  218 (281)
                                                      .....-...+++...-...+.+           +...+.|+||.|+..
T Consensus       235 --------------------------------~~~~~s~~~gtT~d~~~~~~~~-----------~~~~~~l~DTaG~~~  271 (472)
T PRK03003        235 --------------------------------ERSVVDDVAGTTVDPVDSLIEL-----------GGKTWRFVDTAGLRR  271 (472)
T ss_pred             --------------------------------CcccccCCCCccCCcceEEEEE-----------CCEEEEEEECCCccc


Q ss_pred             CCcCcccchhhHHHHHhh------hhhhhhccCCCCChhhhhHhHHHHH
Q psy5031         219 SESTVRDCATVFALSTML------SSIQIYNLSQNIQEDDLQHLQLFTE  261 (281)
Q Consensus       219 ~~~s~~~d~~IFaLs~LL------SS~~IYNs~~~Ide~~L~~L~l~t~  261 (281)
                      ...........-.+.+..      .-.++|.....+..+++..+..+.+
T Consensus       272 ~~~~~~~~e~~~~~~~~~~i~~ad~vilV~Da~~~~s~~~~~~~~~~~~  320 (472)
T PRK03003        272 RVKQASGHEYYASLRTHAAIEAAEVAVVLIDASEPISEQDQRVLSMVIE  320 (472)
T ss_pred             cccccchHHHHHHHHHHHHHhcCCEEEEEEeCCCCCCHHHHHHHHHHHH


No 202
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD. This family represents the NikD subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase. NikD and NikE are homologous.
Probab=91.22  E-value=0.15  Score=45.41  Aligned_cols=24  Identities=25%  Similarity=0.317  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        13 e~~~i~G~nGsGKSTLl~~l~Gl~   36 (230)
T TIGR02770        13 EVLALVGESGSGKSLTCLAILGLL   36 (230)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            378999999999999999998764


No 203
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional
Probab=91.22  E-value=0.16  Score=44.07  Aligned_cols=23  Identities=35%  Similarity=0.417  Sum_probs=20.7

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|++.+
T Consensus        28 ~~~l~G~nGsGKSTLl~~l~G~~   50 (195)
T PRK13541         28 ITYIKGANGCGKSSLLRMIAGIM   50 (195)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            78899999999999999998753


No 204
>cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases. The homohexamer, VirB11 is one of eleven Vir proteins, which are required for T-pilus biogenesis and virulence in the transfer of T-DNA from the Ti (tumor-inducing) plasmid of bacterial to plant cells. The pilus is a fibrous cell surface organelle, which mediates adhesion between bacteria during conjugative transfer or between bacteria and host eukaryotic cells during infection. VirB11- related ATPases include the archaeal flagella biosynthesis protein and the pilus assembly proteins CpaF/TadA and TrbB.  This alignment contains the C-terminal domain, which is the ATPase.
Probab=91.20  E-value=0.18  Score=43.76  Aligned_cols=40  Identities=23%  Similarity=0.321  Sum_probs=28.4

Q ss_pred             eCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhh
Q psy5031          37 LDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        37 ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      ++++..+.+...  +.  +=.++.|+|+.++|||+|++.|++.+
T Consensus        10 ~~~~~~~~l~~~--v~--~g~~i~I~G~tGSGKTTll~aL~~~i   49 (186)
T cd01130          10 FSPLQAAYLWLA--VE--ARKNILISGGTGSGKTTLLNALLAFI   49 (186)
T ss_pred             CCHHHHHHHHHH--Hh--CCCEEEEECCCCCCHHHHHHHHHhhc
Confidence            456666544331  22  23578999999999999999998775


No 205
>TIGR01978 sufC FeS assembly ATPase SufC. SufC is part of the SUF system, shown in E. coli to consist of six proteins and believed to act in Fe-S cluster formation during oxidative stress. SufC forms a complex with SufB and SufD. SufC belongs to the ATP-binding cassette transporter family (pfam00005) but is no longer thought to be part of a transporter. The complex is reported as cytosolic (PubMed:12554644) or associated with the membrane (PubMed:11943156). The SUF system also includes a cysteine desulfurase (SufS, enhanced by SufE) and a probable iron-sulfur cluster assembly scaffold protein, SufA.
Probab=91.15  E-value=0.15  Score=45.34  Aligned_cols=23  Identities=22%  Similarity=0.205  Sum_probs=20.6

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+||+.|.+.
T Consensus        27 e~~~i~G~nGsGKSTLl~~l~Gl   49 (243)
T TIGR01978        27 EIHAIMGPNGSGKSTLSKTIAGH   49 (243)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            37889999999999999999875


No 206
>cd02020 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the reversible phosphorylation of cytidine monophosphate (CMP) to produce cytidine diphosphate (CDP), using ATP as the preferred phosphoryl donor.
Probab=91.14  E-value=0.18  Score=40.77  Aligned_cols=23  Identities=22%  Similarity=0.478  Sum_probs=21.1

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      ||.|+|+++||||++...|...+
T Consensus         1 ~I~i~G~~GsGKst~a~~la~~~   23 (147)
T cd02020           1 IIAIDGPAGSGKSTVAKLLAKKL   23 (147)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHh
Confidence            68999999999999999999875


No 207
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional
Probab=91.12  E-value=0.17  Score=45.59  Aligned_cols=24  Identities=25%  Similarity=0.299  Sum_probs=21.0

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        30 e~~~i~G~nGsGKSTLl~~i~Gl~   53 (250)
T PRK14262         30 QITAIIGPSGCGKTTLLRSINRMN   53 (250)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            378999999999999999998653


No 208
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional
Probab=91.11  E-value=0.16  Score=46.36  Aligned_cols=24  Identities=25%  Similarity=0.443  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|++.+
T Consensus        28 e~~~i~G~nGsGKSTLl~~l~Gl~   51 (255)
T PRK11248         28 ELLVVLGPSGCGKTTLLNLIAGFV   51 (255)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            478999999999999999998764


No 209
>cd03221 ABCF_EF-3 ABCF_EF-3  Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth.  EF-3 stimulates the binding of the EF-1: GTP: aa-tRNA ternary complex to the ribosomal A site by facilitated release of the deacylated tRNA from the E site.  The reaction requires ATP hydrolysis.  EF-3 contains two ATP nucleotide binding sequence (NBS) motifs.  NBSI is sufficient for the intrinsic ATPase activity. NBSII is essential for the ribosome-stimulated functions.
Probab=91.09  E-value=0.16  Score=42.49  Aligned_cols=23  Identities=26%  Similarity=0.294  Sum_probs=20.3

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+|++.|.+.
T Consensus        27 e~~~i~G~nGsGKStLl~~l~G~   49 (144)
T cd03221          27 DRIGLVGRNGAGKSTLLKLIAGE   49 (144)
T ss_pred             CEEEEECCCCCCHHHHHHHHcCC
Confidence            47889999999999999999765


No 210
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain.  They export degradative enzymes by using a type I protein secretion system and  lack an N-terminal signal peptide, but contain a C-terminal secretion signal.  The Type I secretion apparatus is made up of three components, an ABC transporter, a membrane fusion protein (MFP), and an outer membrane protein (OMP).  For the HlyA transporter complex, HlyB (ABC transporter) and HlyD (MFP) reside in the inner membrane of E. coli.  The OMP component is TolC, which is thought to interact with the MFP to form a continuous channel across the periplasm from the cytoplasm to the exterior.  HlyB belongs to the family of ABC transporters, which are ubiquitous, ATP-dependent transmembrane pumps or channels.  The spectrum of transport substra
Probab=91.08  E-value=0.19  Score=42.90  Aligned_cols=23  Identities=26%  Similarity=0.440  Sum_probs=20.6

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|++..
T Consensus        30 ~~~i~G~nGsGKStLl~~l~G~~   52 (173)
T cd03246          30 SLAIIGPSGSGKSTLARLILGLL   52 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHhcc
Confidence            68899999999999999998763


No 211
>PRK12736 elongation factor Tu; Reviewed
Probab=91.07  E-value=0.65  Score=45.34  Aligned_cols=27  Identities=22%  Similarity=0.285  Sum_probs=23.9

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+|-.-|+|+|...+|||+|+++|+.+
T Consensus         9 ~k~~~ni~i~Ghvd~GKSTL~~~L~~~   35 (394)
T PRK12736          9 SKPHVNIGTIGHVDHGKTTLTAAITKV   35 (394)
T ss_pred             CCCeeEEEEEccCCCcHHHHHHHHHhh
Confidence            567777999999999999999999865


No 212
>cd04169 RF3 RF3 subfamily.  Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria.  Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide.  The class II release factor RF3 then initiates the release of the class I RF from the ribosome.  RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state.  GDP/GTP exchange occurs, followed by the release of the class I RF.  Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome.  RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts.
Probab=91.07  E-value=0.51  Score=43.84  Aligned_cols=23  Identities=22%  Similarity=0.273  Sum_probs=20.0

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      --|+|+|...+|||+|+|+|+..
T Consensus         3 Rni~ivGh~~~GKTTL~e~ll~~   25 (267)
T cd04169           3 RTFAIISHPDAGKTTLTEKLLLF   25 (267)
T ss_pred             cEEEEEcCCCCCHHHHHHHHHHh
Confidence            35889999999999999999854


No 213
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional
Probab=91.04  E-value=0.18  Score=45.43  Aligned_cols=23  Identities=35%  Similarity=0.400  Sum_probs=20.2

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -+++|+|+.++|||+|++.|.+.
T Consensus        30 e~~~i~G~nGsGKSTLl~~i~Gl   52 (250)
T PRK14245         30 SVVAFIGPSGCGKSTFLRLFNRM   52 (250)
T ss_pred             CEEEEECCCCCCHHHHHHHHhhh
Confidence            36899999999999999999763


No 214
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilus, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of a single ATP-binding protein and a single intergral membrane protein.
Probab=91.02  E-value=0.17  Score=44.45  Aligned_cols=24  Identities=25%  Similarity=0.315  Sum_probs=20.5

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|.+.+
T Consensus        32 e~~~i~G~nGsGKSTLl~~l~Gl~   55 (218)
T cd03266          32 EVTGLLGPNGAGKTTTLRMLAGLL   55 (218)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCc
Confidence            367889999999999999998753


No 215
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=90.99  E-value=0.68  Score=39.13  Aligned_cols=22  Identities=27%  Similarity=0.403  Sum_probs=19.4

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -|.++|...+|||.|+|++++.
T Consensus         2 ki~ivG~~~vGKTsli~~~~~~   23 (170)
T cd04108           2 KVIVVGDLSVGKTCLINRFCKD   23 (170)
T ss_pred             EEEEECCCCCCHHHHHHHHhcC
Confidence            4779999999999999999754


No 216
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters. Many non-lantibiotic bacteriocins of lactic acid bacteria are produced as precursors which have N-terminal leader peptides that share similarities in amino acid sequence and contain a conserved processing site of two glycine residues in positions -1 and -2.  A dedicated ATP-binding cassette (ABC) transporter is responsible for the proteolytic cleavage of the leader peptides and subsequent translocation of the bacteriocins across the cytoplasmic membrane.
Probab=90.99  E-value=0.17  Score=44.41  Aligned_cols=23  Identities=35%  Similarity=0.468  Sum_probs=20.6

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+..
T Consensus        32 ~~~i~G~nGsGKSTLl~~i~G~~   54 (220)
T cd03245          32 KVAIIGRVGSGKSTLLKLLAGLY   54 (220)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCc
Confidence            78899999999999999998653


No 217
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1.  In fact, the yeast MDL1 (multidrug resistance-like protein 1) and MDL2 (multidrug resistance-like protein 2) transporters are also included in this CD.  MDL1 is an ATP-dependent permease that acts as a high-copy suppressor of ATM1 and is thought to have a role in resistance to oxidative stress. Interestingly, subfamily B is more closely related to the carboxyl-terminal component of subfamily C than the two halves of ABCC molecules are with one another.
Probab=90.96  E-value=0.17  Score=45.08  Aligned_cols=24  Identities=29%  Similarity=0.452  Sum_probs=21.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        30 e~~~l~G~nGsGKSTLl~~i~G~~   53 (238)
T cd03249          30 KTVALVGSSGCGKSTVVSLLERFY   53 (238)
T ss_pred             CEEEEEeCCCCCHHHHHHHHhccC
Confidence            578899999999999999998764


No 218
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK.  ATP binding cassette (ABC) proteins function from bacteria to human, mediating the translocation of substances into and out of cells or organelles.  ABC transporters contain two transmembrane-spanning domains (TMDs) or subunits and two nucleotide binding domains (NBDs) or subunits that couple transport to the hydrolysis of ATP.  In the maltose transport system, the periplasmic maltose binding protein (MBP) stimulates the ATPase activity of the membrane-associated transporter, which consists of two transmembrane subunits, MalF and MalG, and two copies of the ATP binding subunit, MalK, and becomes tightly bound to the transporter in the catalytic transition state, ensuring that maltose is passed to the transporter as ATP is hydrolyzed.
Probab=90.95  E-value=0.18  Score=44.15  Aligned_cols=23  Identities=22%  Similarity=0.221  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|++.+
T Consensus        28 ~~~l~G~nGsGKSTLl~~l~G~~   50 (213)
T cd03301          28 FVVLLGPSGCGKTTTLRMIAGLE   50 (213)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            68899999999999999998764


No 219
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminus, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resistance lung cancer cell in which p-glycoprotein was not overexpressed.  MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=90.93  E-value=0.18  Score=44.31  Aligned_cols=24  Identities=38%  Similarity=0.411  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+..
T Consensus        31 e~~~i~G~nGsGKSTLl~~l~G~~   54 (221)
T cd03244          31 EKVGIVGRTGSGKSSLLLALFRLV   54 (221)
T ss_pred             CEEEEECCCCCCHHHHHHHHHcCC
Confidence            378899999999999999998764


No 220
>cd04168 TetM_like Tet(M)-like subfamily.  Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria.  Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site.  This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative.  Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G.  EF-G and Tet(M) compete for binding on the ribosomes.  Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind.  Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity.  These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.
Probab=90.93  E-value=1  Score=40.93  Aligned_cols=21  Identities=24%  Similarity=0.327  Sum_probs=19.2

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|...+|||+|+|+|+..
T Consensus         2 i~i~G~~~~GKTtL~~~ll~~   22 (237)
T cd04168           2 IGILAHVDAGKTTLTESLLYT   22 (237)
T ss_pred             EEEEcCCCCCHHHHHHHHHHH
Confidence            789999999999999999865


No 221
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.90  E-value=0.18  Score=45.37  Aligned_cols=24  Identities=29%  Similarity=0.450  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        30 e~~~i~G~nGsGKSTLl~~i~G~~   53 (250)
T PRK14247         30 TITALMGPSGSGKSTLLRVFNRLI   53 (250)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccC
Confidence            478999999999999999998764


No 222
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.89  E-value=0.18  Score=44.74  Aligned_cols=24  Identities=29%  Similarity=0.523  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        29 e~~~i~G~nGsGKSTLl~~l~Gl~   52 (234)
T cd03251          29 ETVALVGPSGSGKSTLVNLIPRFY   52 (234)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            378999999999999999998664


No 223
>cd01120 RecA-like_NTPases RecA-like NTPases. This family includes the NTP binding domain of F1 and V1 H+ATPases, DnaB and related helicases as well as bacterial RecA and related eukaryotic and archaeal recombinases. This group also includes bacterial conjugation proteins and related DNA transfer proteins involved in type II and type IV secretion.
Probab=90.88  E-value=0.19  Score=40.48  Aligned_cols=23  Identities=26%  Similarity=0.215  Sum_probs=20.7

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      ++.|+|+.++|||+|+..++...
T Consensus         1 ~~~i~G~~G~GKT~l~~~i~~~~   23 (165)
T cd01120           1 LILVFGPTGSGKTTLALQLALNI   23 (165)
T ss_pred             CeeEeCCCCCCHHHHHHHHHHHH
Confidence            46799999999999999998875


No 224
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria.  Although the specific function of ATM1 is unknown, its disruption results in the accumulation of excess mitochondrial iron, loss of mitochondrial cytochromes, oxidative damage to mitochondrial DNA, and decreased levels of cytosolic heme proteins.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.87  E-value=0.18  Score=44.77  Aligned_cols=24  Identities=33%  Similarity=0.575  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+..
T Consensus        28 e~~~l~G~nGsGKSTLl~~i~Gl~   51 (236)
T cd03253          28 KKVAIVGPSGSGKSTILRLLFRFY   51 (236)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            478999999999999999998754


No 225
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.86  E-value=0.19  Score=45.24  Aligned_cols=24  Identities=29%  Similarity=0.304  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|++..
T Consensus        31 e~~~i~G~nGsGKSTLl~~l~G~~   54 (251)
T PRK14270         31 KITALIGPSGCGKSTFLRCLNRMN   54 (251)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhcc
Confidence            368899999999999999998764


No 226
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity.  In bacteria and archaea, these transporters usually include an ATP-binding protein and one or two integral membrane proteins.  Eukaryote systems of the ABCA subfamily display ABC domains that are quite similar to this family.  The ATP-binding domain shows the highest similarity between all members of the ABC transporter family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.86  E-value=0.18  Score=43.03  Aligned_cols=22  Identities=23%  Similarity=0.434  Sum_probs=19.9

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +++|+|+.++|||+|++.|.+.
T Consensus        28 ~~~i~G~nGsGKStLl~~l~G~   49 (173)
T cd03230          28 IYGLLGPNGAGKTTLIKIILGL   49 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            6889999999999999999765


No 227
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import.  Responsible for energy coupling to the transport system.  The complex is composed of two ATP-binding proteins (cysA), two transmembrane proteins (cysT and cysW), and a solute-binding protein (cysP).  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.84  E-value=0.18  Score=45.18  Aligned_cols=24  Identities=25%  Similarity=0.357  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        29 e~~~i~G~nGsGKSTLl~~l~Gl~   52 (239)
T cd03296          29 ELVALLGPSGSGKTTLLRLIAGLE   52 (239)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998764


No 228
>PLN03110 Rab GTPase; Provisional
Probab=90.79  E-value=0.74  Score=40.75  Aligned_cols=25  Identities=24%  Similarity=0.254  Sum_probs=21.1

Q ss_pred             eEEEEEEecccccChhHHHHHHHHh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      ...-|.|+|+..+|||+|+++|.+.
T Consensus        11 ~~~Ki~ivG~~~vGKStLi~~l~~~   35 (216)
T PLN03110         11 YLFKIVLIGDSGVGKSNILSRFTRN   35 (216)
T ss_pred             ceeEEEEECCCCCCHHHHHHHHhcC
Confidence            4556889999999999999999653


No 229
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.78  E-value=0.2  Score=45.79  Aligned_cols=22  Identities=32%  Similarity=0.347  Sum_probs=20.2

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +++|+|+.++|||+||+.|.+.
T Consensus        49 ~~~i~G~nGsGKSTLl~~l~Gl   70 (268)
T PRK14248         49 VTALIGPSGCGKSTFLRSINRM   70 (268)
T ss_pred             EEEEECCCCCCHHHHHHHHHhc
Confidence            7899999999999999999874


No 230
>PLN02796 D-glycerate 3-kinase
Probab=90.77  E-value=0.2  Score=48.80  Aligned_cols=27  Identities=22%  Similarity=0.272  Sum_probs=23.9

Q ss_pred             eEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +--+|+|+|+.++|||+|++.|...+.
T Consensus        99 ~pliIGI~G~sGSGKSTLa~~L~~lL~  125 (347)
T PLN02796         99 PPLVIGISAPQGCGKTTLVFALVYLFN  125 (347)
T ss_pred             CCEEEEEECCCCCcHHHHHHHHHHHhc
Confidence            447999999999999999999988764


No 231
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional
Probab=90.77  E-value=0.18  Score=45.19  Aligned_cols=23  Identities=30%  Similarity=0.364  Sum_probs=20.7

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+.+
T Consensus        31 ~~~i~G~nGsGKSTLl~~l~G~~   53 (250)
T PRK11264         31 VVAIIGPSGSGKTTLLRCINLLE   53 (250)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            68999999999999999998764


No 232
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.73  E-value=0.19  Score=43.07  Aligned_cols=23  Identities=30%  Similarity=0.390  Sum_probs=20.5

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+|++.|++.
T Consensus        27 ~~~~i~G~nGsGKSTLl~~l~G~   49 (178)
T cd03229          27 EIVALLGPSGSGKSTLLRCIAGL   49 (178)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            37889999999999999999765


No 233
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.73  E-value=0.18  Score=45.44  Aligned_cols=22  Identities=36%  Similarity=0.395  Sum_probs=20.2

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +++|+|+.++|||+|++.|.+.
T Consensus        34 ~~~i~G~nGsGKSTLl~~l~Gl   55 (253)
T PRK14261         34 VTALIGPSGCGKSTLLRCFNRM   55 (253)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            6899999999999999999865


No 234
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification.
Probab=90.72  E-value=0.18  Score=44.97  Aligned_cols=24  Identities=33%  Similarity=0.434  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+..
T Consensus        28 e~~~i~G~nGsGKSTLl~~l~G~~   51 (236)
T TIGR03864        28 EFVALLGPNGAGKSTLFSLLTRLY   51 (236)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCc
Confidence            378899999999999999998764


No 235
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.70  E-value=0.18  Score=45.26  Aligned_cols=23  Identities=26%  Similarity=0.515  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|++.+
T Consensus        31 ~~~i~G~nGsGKSTLl~~l~Gl~   53 (241)
T PRK14250         31 IYTIVGPSGAGKSTLIKLINRLI   53 (241)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            68999999999999999998764


No 236
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=90.68  E-value=0.21  Score=40.70  Aligned_cols=22  Identities=32%  Similarity=0.167  Sum_probs=19.0

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -|.|+|+.++|||+|+|++...
T Consensus         3 ki~i~G~~~vGKTsl~~~~~~~   24 (163)
T cd04136           3 KVVVLGSGGVGKSALTVQFVQG   24 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHHhC
Confidence            4778899999999999999753


No 237
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter.  The CCM family is involved in bacterial cytochrome c biogenesis.  Cytochrome c maturation in E. coli requires the ccm operon, which encodes eight membrane proteins (CcmABCDEFGH).  CcmE is a periplasmic heme chaperone that binds heme covalently and transfers it onto apocytochrome c in the presence of CcmF, CcmG, and CcmH.  The CcmAB proteins represent an ABC transporter and the CcmCD proteins participate in heme transfer to CcmE.
Probab=90.66  E-value=0.19  Score=43.94  Aligned_cols=24  Identities=29%  Similarity=0.353  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|++..
T Consensus        27 e~~~i~G~nGsGKSTLl~~l~G~~   50 (201)
T cd03231          27 EALQVTGPNGSGKTTLLRILAGLS   50 (201)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            478899999999999999998753


No 238
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.66  E-value=0.19  Score=45.28  Aligned_cols=24  Identities=33%  Similarity=0.342  Sum_probs=21.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|++.+
T Consensus        31 e~~~l~G~nGsGKSTLl~~l~G~~   54 (253)
T PRK14267         31 GVFALMGPSGCGKSTLLRTFNRLL   54 (253)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccC
Confidence            478999999999999999998764


No 239
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional
Probab=90.65  E-value=0.19  Score=44.10  Aligned_cols=24  Identities=21%  Similarity=0.369  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.+.+..
T Consensus        29 e~~~i~G~nGsGKSTLl~~l~G~~   52 (207)
T PRK13539         29 EALVLTGPNGSGKTTLLRLIAGLL   52 (207)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378899999999999999998753


No 240
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.65  E-value=0.2  Score=45.30  Aligned_cols=24  Identities=29%  Similarity=0.295  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|.+.+
T Consensus        34 e~~~i~G~nGsGKSTLl~~l~Gl~   57 (254)
T PRK14273         34 SITALIGPSGCGKSTFLRTLNRMN   57 (254)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            388999999999999999998764


No 241
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=90.64  E-value=0.19  Score=40.79  Aligned_cols=21  Identities=29%  Similarity=0.224  Sum_probs=18.8

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+..+|||+|+|+++..
T Consensus         3 v~v~G~~~~GKTtli~~l~~~   23 (164)
T smart00175        3 IILIGDSGVGKSSLLSRFTDG   23 (164)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            788999999999999999754


No 242
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional
Probab=90.64  E-value=0.19  Score=45.65  Aligned_cols=24  Identities=33%  Similarity=0.296  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        40 e~~~i~G~nGsGKSTLl~~l~Gl~   63 (260)
T PRK10744         40 QVTAFIGPSGCGKSTLLRTFNRMY   63 (260)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            478999999999999999998764


No 243
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed
Probab=90.61  E-value=1.2  Score=46.82  Aligned_cols=101  Identities=23%  Similarity=0.274  Sum_probs=0.0

Q ss_pred             EEEecccccChhHHHHHHHHhhhhcccccCCCCCCCCCCCCCCCCcccCCCCcccccceeeeeceEEeecCCcccchhhc
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKVSAFR  138 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~l~~~~~~~~~~~~~~~~~~~~~~~f~~~~~~e~~t~gi~~~s~~~~~~~~~~~~~~~~r  138 (281)
                      |+|+|...+|||+|+|+|++.                                                           
T Consensus       453 I~ivG~~nvGKSSLin~l~~~-----------------------------------------------------------  473 (712)
T PRK09518        453 VALVGRPNVGKSSLLNQLTHE-----------------------------------------------------------  473 (712)
T ss_pred             EEEECCCCCCHHHHHHHHhCc-----------------------------------------------------------


Q ss_pred             cCchhHHHHHHhhhcccccccCCCCCCCCCCCCCCCCcccCCCCCCcccceEeeecceeecCCCCCceEEEEEecCCCCC
Q psy5031         139 KGKSFLLDFLLRYMNFTYIEEAPSGDWMGPDDVPLEGFSWRGGSERDTTGILMWSHVYIATLPTGEKAAVILLDTQGTFD  218 (281)
Q Consensus       139 ~gkS~Lln~l~~~~~~~~~~~~~~~~~~~~~~~~~~gF~~~~~~~~~TkGIWmWs~P~~~~~~~g~~v~VlLlDTEG~~d  218 (281)
                                                      ...-.=...+++...-...|.+         +|..  +.|+||.|+..
T Consensus       474 --------------------------------~~~~v~~~~gtT~d~~~~~~~~---------~~~~--~~liDTaG~~~  510 (712)
T PRK09518        474 --------------------------------ERAVVNDLAGTTRDPVDEIVEI---------DGED--WLFIDTAGIKR  510 (712)
T ss_pred             --------------------------------cccccCCCCCCCcCcceeEEEE---------CCCE--EEEEECCCccc


Q ss_pred             CCcCcccchhhHHHHHhh------hhhhhhccCCCCChhhhhHhHHHHH
Q psy5031         219 SESTVRDCATVFALSTML------SSIQIYNLSQNIQEDDLQHLQLFTE  261 (281)
Q Consensus       219 ~~~s~~~d~~IFaLs~LL------SS~~IYNs~~~Ide~~L~~L~l~t~  261 (281)
                      ...........-.+.++-      .-.++|.....+.++++..+..+.+
T Consensus       511 ~~~~~~~~e~~~~~r~~~~i~~advvilViDat~~~s~~~~~i~~~~~~  559 (712)
T PRK09518        511 RQHKLTGAEYYSSLRTQAAIERSELALFLFDASQPISEQDLKVMSMAVD  559 (712)
T ss_pred             CcccchhHHHHHHHHHHHHhhcCCEEEEEEECCCCCCHHHHHHHHHHHH


No 244
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment.  ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition, to the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.61  E-value=0.2  Score=44.98  Aligned_cols=23  Identities=17%  Similarity=0.361  Sum_probs=20.6

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        29 ~~~i~G~nGsGKSTLl~~l~G~~   51 (242)
T cd03295          29 FLVLIGPSGSGKTTTMKMINRLI   51 (242)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            68999999999999999998754


No 245
>cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes. In E. coli, the synthesis of Moco involves genes from several loci: moa, mob, mod, moe and mog. The mob locus contains mobA and mobB genes. MobB catalyzes the attachment of the guanine dinucleotide to molybdopterin.
Probab=90.61  E-value=0.25  Score=42.69  Aligned_cols=26  Identities=27%  Similarity=0.356  Sum_probs=23.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .+|+|+|+.++|||+|+++|.+.+..
T Consensus         2 ~vi~i~G~~gsGKTTli~~L~~~l~~   27 (159)
T cd03116           2 KVIGFVGYSGSGKTTLLEKLIPALSA   27 (159)
T ss_pred             eEEEEECCCCCCHHHHHHHHHHHHHH
Confidence            37999999999999999999998754


No 246
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional
Probab=90.58  E-value=0.2  Score=44.54  Aligned_cols=24  Identities=25%  Similarity=0.288  Sum_probs=21.0

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+..
T Consensus        34 e~~~i~G~nGsGKSTLl~~l~G~~   57 (225)
T PRK10247         34 EFKLITGPSGCGKSTLLKIVASLI   57 (225)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            378999999999999999998753


No 247
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.56  E-value=0.22  Score=45.21  Aligned_cols=23  Identities=26%  Similarity=0.307  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        40 ~~~l~G~nGsGKSTLl~~l~G~~   62 (259)
T PRK14274         40 VTAIIGPSGCGKSTFIKTLNLMI   62 (259)
T ss_pred             EEEEECCCCCCHHHHHHHHHhhc
Confidence            68999999999999999998764


No 248
>PRK10908 cell division protein FtsE; Provisional
Probab=90.55  E-value=0.2  Score=44.30  Aligned_cols=24  Identities=25%  Similarity=0.264  Sum_probs=20.8

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+.+
T Consensus        29 e~~~i~G~nGsGKSTLl~~l~G~~   52 (222)
T PRK10908         29 EMAFLTGHSGAGKSTLLKLICGIE   52 (222)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            468889999999999999998654


No 249
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.54  E-value=0.21  Score=45.02  Aligned_cols=23  Identities=30%  Similarity=0.329  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        32 ~~~i~G~nGsGKSTLl~~l~Gl~   54 (252)
T PRK14256         32 VTAIIGPSGCGKSTVLRSINRMH   54 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHHhcc
Confidence            68999999999999999998764


No 250
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=90.54  E-value=0.82  Score=37.94  Aligned_cols=20  Identities=25%  Similarity=0.235  Sum_probs=18.1

Q ss_pred             EEEecccccChhHHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~   78 (281)
                      |.|+|+.++|||.|+++++.
T Consensus         3 i~vvG~~~~GKTsli~~~~~   22 (161)
T cd04117           3 LLLIGDSGVGKTCLLCRFTD   22 (161)
T ss_pred             EEEECcCCCCHHHHHHHHhc
Confidence            67999999999999999964


No 251
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit. Model TIGR03731 represents the family of all lantibiotics related to gallidermin, including epidermin, mutatin, and nisin. This protein family describes the ATP-binding subunit of a gallidermin/epidermin class lantibiotic protection transporter. It is largely restricted to gallidermin-family lantibiotic biosynthesis and export cassettes, but also occurs in orphan transporter cassettes in species that lack candidate lantibiotic precursor and synthetase genes.
Probab=90.54  E-value=0.2  Score=44.28  Aligned_cols=24  Identities=29%  Similarity=0.379  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|++.+
T Consensus        27 e~~~i~G~nGsGKSTLl~~l~G~~   50 (223)
T TIGR03740        27 SVYGLLGPNGAGKSTLLKMITGIL   50 (223)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            378899999999999999998754


No 252
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters.
Probab=90.53  E-value=0.2  Score=45.07  Aligned_cols=24  Identities=38%  Similarity=0.311  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        28 e~~~i~G~nGsGKSTLl~~l~G~~   51 (247)
T TIGR00972        28 QVTALIGPSGCGKSTLLRSLNRMN   51 (247)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccC
Confidence            378899999999999999998764


No 253
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI s are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLIs have an N-terminal Fe-S domain and two nucleotide binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=90.52  E-value=0.19  Score=46.17  Aligned_cols=26  Identities=27%  Similarity=0.262  Sum_probs=22.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      -+++|+|+.++|||+||+.|.+.+..
T Consensus        27 e~~~IvG~nGsGKSTLlk~l~Gl~~p   52 (255)
T cd03236          27 QVLGLVGPNGIGKSTALKILAGKLKP   52 (255)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCcCC
Confidence            37889999999999999999887543


No 254
>PRK06547 hypothetical protein; Provisional
Probab=90.51  E-value=0.33  Score=42.25  Aligned_cols=27  Identities=22%  Similarity=0.225  Sum_probs=23.7

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHhh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+.-+|.|.|+.+||||+|.+.|...+
T Consensus        13 ~~~~~i~i~G~~GsGKTt~a~~l~~~~   39 (172)
T PRK06547         13 GGMITVLIDGRSGSGKTTLAGALAART   39 (172)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHh
Confidence            456699999999999999999998764


No 255
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional
Probab=90.50  E-value=0.2  Score=44.55  Aligned_cols=24  Identities=21%  Similarity=0.164  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|++..
T Consensus        14 e~~~l~G~NGsGKSTLlk~i~Gl~   37 (213)
T PRK15177         14 EHIGILAAPGSGKTTLTRLLCGLD   37 (213)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCc
Confidence            578999999999999999998754


No 256
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors.  The eye pigmentation of Drosophila is developed from the synthesis and deposition in the cells of red pigments, which are synthesized from guanine, and brown pigments, which are synthesized from tryptophan.  The pigment precursors are encoded by the white, brown, and scarlet genes, respectively.  Evidence from genetic and biochemical studies suggest that the White and Brown proteins function as heterodimers to import guanine, while the White and Scarlet proteins function to import tryptophan.  However, a recent study also suggests that White may be involved in the transport of a metabolite, such as 3-hydroxykynurenine, across intracellular membranes.  Mammalian ABC transporters belonging to the White subfamily (ABCG1, ABCG5, and ABCG8) have been shown to be involved in the regulation of lipid-trafficking mechanisms in 
Probab=90.48  E-value=0.2  Score=44.45  Aligned_cols=24  Identities=29%  Similarity=0.411  Sum_probs=21.5

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+.+
T Consensus        34 e~~~l~G~nGsGKSTLlk~l~G~~   57 (226)
T cd03234          34 QVMAILGSSGSGKTTLLDAISGRV   57 (226)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCcc
Confidence            578999999999999999998764


No 257
>COG3596 Predicted GTPase [General function prediction only]
Probab=90.46  E-value=0.44  Score=45.46  Aligned_cols=25  Identities=36%  Similarity=0.441  Sum_probs=19.8

Q ss_pred             CceEEEEEEecccccChhHHHHHHHH
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      ..||- |=|+|..+.|||.|+|.|..
T Consensus        37 ~~pvn-vLi~G~TG~GKSSliNALF~   61 (296)
T COG3596          37 KEPVN-VLLMGATGAGKSSLINALFQ   61 (296)
T ss_pred             cCcee-EEEecCCCCcHHHHHHHHHh
Confidence            34554 34899999999999999973


No 258
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome.  The peroxisomal membrane forms a permeability barrier for a wide variety of metabolites required for and formed during fatty acid beta-oxidation.  To communicate with the cytoplasm and mitochondria, peroxisomes need dedicated proteins to transport such hydrophilic molecules across their membranes.  X-linked adrenoleukodystrophy (X-ALD) is caused by mutations in the ALD gene, which encodes ALDP (adrenoleukodystrophy protein ), a peroxisomal integral membrane protein that is a member of the ATP-binding cassette (ABC) transporter protein family.  The disease is characterized by a striking and unpredictable variation in phenotypic expression.  Phenotypes include the rapidly progressive childhood cerebral form (CCALD), the milder adult form, adrenomyeloneuropathy (AMN), and variants without neurologic involvement (i.e. asympt
Probab=90.45  E-value=0.21  Score=42.55  Aligned_cols=23  Identities=26%  Similarity=0.262  Sum_probs=20.5

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.+++.+
T Consensus        29 ~~~i~G~nGsGKSTLl~~l~G~~   51 (166)
T cd03223          29 RLLITGPSGTGKSSLFRALAGLW   51 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            68899999999999999998764


No 259
>PRK14240 phosphate transporter ATP-binding protein; Provisional
Probab=90.43  E-value=0.21  Score=44.91  Aligned_cols=22  Identities=36%  Similarity=0.374  Sum_probs=20.2

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +++|+|+.++|||+||+.|.+.
T Consensus        31 ~~~i~G~nGsGKSTLl~~i~G~   52 (250)
T PRK14240         31 VTALIGPSGCGKSTFLRTLNRM   52 (250)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            6899999999999999999874


No 260
>PRK14235 phosphate transporter ATP-binding protein; Provisional
Probab=90.41  E-value=0.23  Score=45.53  Aligned_cols=24  Identities=33%  Similarity=0.308  Sum_probs=21.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+..
T Consensus        46 e~~~i~G~nGsGKSTLl~~l~Gl~   69 (267)
T PRK14235         46 TVTAFIGPSGCGKSTFLRCLNRMN   69 (267)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhhc
Confidence            468999999999999999998764


No 261
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters.  PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.40  E-value=0.19  Score=44.18  Aligned_cols=24  Identities=33%  Similarity=0.213  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+..
T Consensus        34 e~~~i~G~nGsGKSTLl~~l~G~~   57 (202)
T cd03233          34 EMVLVLGRPGSGCSTLLKALANRT   57 (202)
T ss_pred             cEEEEECCCCCCHHHHHHHhcccC
Confidence            488999999999999999998754


No 262
>smart00763 AAA_PrkA PrkA AAA domain. This is a family of PrkA bacterial and archaeal serine kinases approximately 630 residues long. This is the N-terminal AAA domain.
Probab=90.39  E-value=0.42  Score=46.88  Aligned_cols=45  Identities=24%  Similarity=0.223  Sum_probs=30.9

Q ss_pred             CHHHHHHHHccc----CCCCceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          38 DYEALERILLQD----HVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        38 n~eal~~il~~~----~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      +++|++.+...-    .-.+.+=.++.++||.++|||+|++.|.+.+..
T Consensus        56 ~~~~i~~lv~~l~~~a~g~~~~r~il~L~GPPGsGKStla~~La~~l~~  104 (361)
T smart00763       56 MEEAIERFVNYFKSAAQGLEERKQILYLLGPVGGGKSSLVECLKRGLEE  104 (361)
T ss_pred             cHHHHHHHHHHHHHHHhcCCCCCcEEEEECCCCCCHHHHHHHHHHHHhh
Confidence            566666654310    000223467999999999999999999988643


No 263
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional
Probab=90.38  E-value=0.2  Score=44.74  Aligned_cols=24  Identities=17%  Similarity=0.281  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        30 e~~~l~G~nGsGKSTLl~~l~G~~   53 (241)
T PRK10895         30 EIVGLLGPNGAGKTTTFYMVVGIV   53 (241)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            378899999999999999998764


No 264
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP.  Probably responsible for the translocation of thiamine across the membrane. ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=90.37  E-value=0.21  Score=43.67  Aligned_cols=24  Identities=25%  Similarity=0.479  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|++.+
T Consensus        25 e~~~l~G~nGsGKSTLl~~l~gl~   48 (211)
T cd03298          25 EITAIVGPSGSGKSTLLNLIAGFE   48 (211)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            478899999999999999998764


No 265
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional
Probab=90.35  E-value=0.21  Score=45.35  Aligned_cols=24  Identities=29%  Similarity=0.405  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        33 e~~~i~G~nGsGKSTLl~~l~Gl~   56 (258)
T PRK11701         33 EVLGIVGESGSGKTTLLNALSARL   56 (258)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378899999999999999998764


No 266
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism]
Probab=90.34  E-value=0.3  Score=44.84  Aligned_cols=29  Identities=21%  Similarity=0.392  Sum_probs=26.4

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .++.+|+|+|+..||||++++.|...+.+
T Consensus         6 ~~~iiIgIaG~SgSGKTTva~~l~~~~~~   34 (218)
T COG0572           6 EKVIIIGIAGGSGSGKTTVAKELSEQLGV   34 (218)
T ss_pred             CceEEEEEeCCCCCCHHHHHHHHHHHhCc
Confidence            56899999999999999999999988764


No 267
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional
Probab=90.32  E-value=0.2  Score=45.97  Aligned_cols=23  Identities=26%  Similarity=0.514  Sum_probs=20.7

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        35 ~~~l~G~nGsGKSTLl~~l~Gl~   57 (272)
T PRK15056         35 IAALVGVNGSGKSTLFKALMGFV   57 (272)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            78999999999999999998764


No 268
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.31  E-value=0.23  Score=44.70  Aligned_cols=24  Identities=29%  Similarity=0.283  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+..
T Consensus        31 e~~~i~G~nGsGKSTLl~~l~Gl~   54 (251)
T PRK14251         31 ELTALIGPSGCGKSTFLRCLNRMN   54 (251)
T ss_pred             CEEEEECCCCCCHHHHHHHHhhcc
Confidence            468999999999999999998764


No 269
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=90.29  E-value=0.2  Score=40.53  Aligned_cols=21  Identities=33%  Similarity=0.422  Sum_probs=18.9

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.++|..++|||+|+|+|++.
T Consensus         5 i~i~G~~~~GKstli~~l~~~   25 (174)
T cd01895           5 IAIIGRPNVGKSSLVNALLGE   25 (174)
T ss_pred             EEEEcCCCCCHHHHHHHHhCc
Confidence            789999999999999999754


No 270
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos).  The Carb_Monos family is involved in the uptake of monosaccharides, such as pentoses (such as xylose, arabinose, and ribose) and hexoses (such as xylose, arabinose, and ribose), that cannot be broken down to simple sugars by hydrolysis.  In members of Carb_Monos family the single hydrophobic gene product forms a homodimer, while the ABC protein represents a fusion of two nucleotide-binding domains.  However, it is assumed that two copies of the ABC domains are present in the assembled transporter.
Probab=90.26  E-value=0.21  Score=42.98  Aligned_cols=23  Identities=26%  Similarity=0.434  Sum_probs=20.6

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+..
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~G~~   50 (182)
T cd03215          28 IVGIAGLVGNGQTELAEALFGLR   50 (182)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            68899999999999999998653


No 271
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.24  E-value=0.22  Score=45.29  Aligned_cols=24  Identities=29%  Similarity=0.301  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+..
T Consensus        39 e~~~i~G~nGsGKSTLl~~i~Gl~   62 (258)
T PRK14268         39 SVTALIGPSGCGKSTFIRCLNRMN   62 (258)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            378999999999999999998753


No 272
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=90.23  E-value=0.21  Score=44.30  Aligned_cols=25  Identities=32%  Similarity=0.363  Sum_probs=21.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .+++|+|+.++|||+||+.|.+.+.
T Consensus        27 e~~~l~G~nGsGKSTLl~~l~G~~~   51 (230)
T TIGR03410        27 EVTCVLGRNGVGKTTLLKTLMGLLP   51 (230)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCCC
Confidence            4788899999999999999987643


No 273
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=90.22  E-value=0.21  Score=45.66  Aligned_cols=24  Identities=21%  Similarity=0.264  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        36 e~~~I~G~nGsGKSTLl~~i~Gl~   59 (269)
T PRK13648         36 QWTSIVGHNGSGKSTIAKLMIGIE   59 (269)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            378999999999999999998764


No 274
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D. This model describes the ATP binding subunits of nitrate transport in bacteria and archaea. This protein belongs to the ATP-binding cassette (ABC) superfamily. It is thought that the two subunits encoded by ntrC and ntrD form the binding surface for interaction with ATP. This model is restricted in identifying ATP binding subunit associated with the nitrate transport. Nitrate assimilation is aided by other proteins derived from the operon which among others include products of ntrA - a regulatory protein; ntrB - a hydropbobic transmembrane permease and narB - a reductase.
Probab=90.22  E-value=0.22  Score=44.58  Aligned_cols=24  Identities=29%  Similarity=0.344  Sum_probs=21.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        12 e~~~i~G~nGsGKSTLl~~l~Gl~   35 (230)
T TIGR01184        12 EFISLIGHSGCGKSTLLNLISGLA   35 (230)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998764


No 275
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=90.22  E-value=0.23  Score=41.15  Aligned_cols=21  Identities=38%  Similarity=0.238  Sum_probs=18.7

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.++|+.++|||.|+|+++..
T Consensus         4 v~~vG~~~vGKTsli~~~~~~   24 (165)
T cd04140           4 VVVFGAGGVGKSSLVLRFVKG   24 (165)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            679999999999999999754


No 276
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional
Probab=90.21  E-value=0.22  Score=43.57  Aligned_cols=24  Identities=29%  Similarity=0.380  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|++.+
T Consensus        28 e~~~l~G~nGsGKSTLl~~l~G~~   51 (204)
T PRK13538         28 ELVQIEGPNGAGKTSLLRILAGLA   51 (204)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998764


No 277
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.21  E-value=0.22  Score=44.72  Aligned_cols=23  Identities=26%  Similarity=0.278  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+.+
T Consensus        32 ~~~i~G~nGsGKSTLl~~i~G~~   54 (252)
T PRK14272         32 VNALIGPSGCGKTTFLRAINRMH   54 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHhccC
Confidence            68999999999999999998764


No 278
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=90.16  E-value=0.21  Score=45.94  Aligned_cols=24  Identities=21%  Similarity=0.252  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        34 e~~~l~G~nGsGKSTLl~~i~Gl~   57 (280)
T PRK13649         34 SYTAFIGHTGSGKSTIMQLLNGLH   57 (280)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998764


No 279
>PF00004 AAA:  ATPase family associated with various cellular activities (AAA);  InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport. Some of them function as molecular chaperones, subunits of proteolytic complexes or independent proteases (FtsH, Lon). They also act as DNA helicases and transcription factors []. AAA ATPases belong to the AAA+ superfamily of ringshaped P-loop NTPases, which act via the energy-dependent unfolding of macromolecules [, ]. There are six major clades of AAA domains (proteasome subunits, metalloproteases, domains D1 and D2 of ATPases with two AAA domains, the MSP1/katanin/spastin group and BCS1 and it homologues), as well as a number of deeply branching minor clades []. They assemble into oligomeric assemblies (often hexamers) that form a ring-shaped structure with a central pore. These proteins produce a molecular motor that couples ATP binding and hydrolysis to changes in conformational states that act upon a target substrate, either translocating or remodelling it []. They are found in all living organisms and share the common feature of the presence of a highly conserved AAA domain called the AAA module. This domain is responsible for ATP binding and hydrolysis. It contains 200-250 residues, among them there are two classical motifs, Walker A (GX4GKT) and Walker B (HyDE) []. The functional variety seen between AAA ATPases is in part due to their extensive number of accessory domains and factors, and to their variable organisation within oligomeric assemblies, in addition to changes in key functional residues within the ATPase domain itself. More information about these proteins can be found at Protein of the Month: AAA ATPases [].; GO: 0005524 ATP binding; PDB: 3H4M_A 1NSF_A 1D2N_A 1HQY_E 1DO0_E 1DO2_C 1G4B_E 1HT1_F 1G4A_F 1HT2_G ....
Probab=90.16  E-value=0.3  Score=38.43  Aligned_cols=23  Identities=26%  Similarity=0.418  Sum_probs=20.5

Q ss_pred             EEEecccccChhHHHHHHHHhhh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      |-+.||.++|||+|+..+.+++.
T Consensus         1 ill~G~~G~GKT~l~~~la~~l~   23 (132)
T PF00004_consen    1 ILLHGPPGTGKTTLARALAQYLG   23 (132)
T ss_dssp             EEEESSTTSSHHHHHHHHHHHTT
T ss_pred             CEEECcCCCCeeHHHHHHHhhcc
Confidence            45899999999999999999863


No 280
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=90.15  E-value=0.22  Score=40.62  Aligned_cols=21  Identities=38%  Similarity=0.227  Sum_probs=18.5

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.++|+.++|||.|+|++...
T Consensus         2 i~i~G~~~~GKTsl~~~~~~~   22 (160)
T cd04156           2 VLLLGLDSAGKSTLLYKLKHA   22 (160)
T ss_pred             EEEEcCCCCCHHHHHHHHhcC
Confidence            678899999999999999754


No 281
>PRK10078 ribose 1,5-bisphosphokinase; Provisional
Probab=90.07  E-value=0.24  Score=42.88  Aligned_cols=23  Identities=26%  Similarity=0.267  Sum_probs=20.2

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +|.|+||.++|||+|++.|...+
T Consensus         4 ~i~l~G~sGsGKsTl~~~l~~~~   26 (186)
T PRK10078          4 LIWLMGPSGSGKDSLLAALRQRE   26 (186)
T ss_pred             EEEEECCCCCCHHHHHHHHhccC
Confidence            67889999999999999997653


No 282
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL. Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lysase complex. This protein (PhnL) and the adjacent-encoded PhnK (TIGR02323) resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se.
Probab=90.07  E-value=0.23  Score=43.85  Aligned_cols=24  Identities=33%  Similarity=0.355  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        35 e~~~l~G~nGsGKSTLl~~i~G~~   58 (224)
T TIGR02324        35 ECVALSGPSGAGKSTLLKSLYANY   58 (224)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998764


No 283
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=90.06  E-value=0.24  Score=40.09  Aligned_cols=22  Identities=36%  Similarity=0.161  Sum_probs=19.3

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -|+++|+.++|||+|+|++...
T Consensus         2 ki~~~G~~~~GKTsl~~~l~~~   23 (164)
T cd04139           2 KVIVVGAGGVGKSALTLQFMYD   23 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHhC
Confidence            3788999999999999999754


No 284
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=90.06  E-value=0.22  Score=46.13  Aligned_cols=25  Identities=24%  Similarity=0.284  Sum_probs=21.8

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      -+++|+|+.++|||+||+.|++.+.
T Consensus        38 e~~~l~G~nGsGKSTLl~~l~Gl~~   62 (289)
T PRK13645         38 KVTCVIGTTGSGKSTMIQLTNGLII   62 (289)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCCC
Confidence            3789999999999999999987643


No 285
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.05  E-value=0.26  Score=44.34  Aligned_cols=23  Identities=39%  Similarity=0.375  Sum_probs=21.0

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+..
T Consensus        31 ~~~i~G~nGsGKSTLl~~l~Gl~   53 (249)
T PRK14253         31 VTALIGPSGCGKSTLLRCLNRMN   53 (249)
T ss_pred             EEEEECCCCCCHHHHHHHHHhhc
Confidence            88999999999999999998764


No 286
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+). This enzyme catalyzes the phosphorylation of nicotinamide riboside (NR) to form nicotinamide mononucleotide (NMN). It defines the NR salvage pathway of NAD+ biosynthesis in addition to the pathways through nicotinic acid mononucleotide (NaMN). This enzyme can also phosphorylate the anticancer drug tiazofurin, which is an analog of nicotinamide riboside.
Probab=90.03  E-value=0.23  Score=44.16  Aligned_cols=23  Identities=30%  Similarity=0.574  Sum_probs=21.4

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      ||+|+|..+||||+|++.|...+
T Consensus         1 ii~i~G~sgsGKTtla~~l~~~~   23 (187)
T cd02024           1 IVGISGVTNSGKTTLAKLLQRIL   23 (187)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHc
Confidence            68999999999999999999876


No 287
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes. This enzyme catalyzes the phosphorylation of D-ribulose 5-phosphate to form D-ribulose 1, 5-biphosphate, using ATP and NADPH produced by the primary reactions of photosynthesis.
Probab=90.02  E-value=0.22  Score=46.49  Aligned_cols=24  Identities=33%  Similarity=0.403  Sum_probs=21.6

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ||+|+|+.++|||+|++.|.+.+.
T Consensus         1 iigI~G~sGsGKSTl~~~L~~ll~   24 (273)
T cd02026           1 IIGVAGDSGCGKSTFLRRLTSLFG   24 (273)
T ss_pred             CEEEECCCCCCHHHHHHHHHHhhC
Confidence            689999999999999999987754


No 288
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of a conserved four gene ABC transporter operon found next to ectoine unilization operons and ectoine biosynthesis operons. Ectoine is a compatible solute that protects enzymes from high osmolarity. It is released by some species in response to hypoosmotic shock, and it is taken up by a number of bacteria as a compatible solute or for consumption. This family shows strong sequence similiarity to a number of amino acid ABC transporter ATP-binding proteins.
Probab=90.01  E-value=0.23  Score=44.85  Aligned_cols=23  Identities=30%  Similarity=0.420  Sum_probs=20.6

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|++.+
T Consensus        28 ~~~i~G~nGsGKSTLl~~l~G~~   50 (252)
T TIGR03005        28 KVALIGPSGSGKSTILRILMTLE   50 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            68899999999999999998754


No 289
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis. It catalyzes the reversible decarboxylation and phosphorylation of oxaloacetate to yield phosphoenolpyruvate and carbon dioxide, using a nucleotide molecule (ATP  or GTP) for the phosphoryl transfer, and has a strict requirement for divalent metal ions for activity.  PEPCK's separate into two phylogenetic groups based on their nucleotide substrate specificity (the ATP-, and GTP-dependent groups).HprK/P, the bifunctional histidine-containing protein kinase/phosphatase, controls the phosphorylation state of the phosphocarrier protein HPr and regulates the utilization of carbon sources by gram-positive bacteria. It catalyzes both the ATP-dependent phosphorylation of HPr and its dephosphorylation by phosphorolysis. PEPCK and the C-terminal catalytic domain of HprK/P are structural
Probab=90.01  E-value=0.26  Score=40.35  Aligned_cols=21  Identities=33%  Similarity=0.233  Sum_probs=19.1

Q ss_pred             EEEEEecccccChhHHHHHHH
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLL   77 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll   77 (281)
                      .+++|+|+.++|||+|++.+.
T Consensus        16 e~v~I~GpSGsGKSTLl~~l~   36 (107)
T cd00820          16 VGVLITGDSGIGKTELALELI   36 (107)
T ss_pred             EEEEEEcCCCCCHHHHHHHhh
Confidence            467999999999999999986


No 290
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional
Probab=90.00  E-value=0.24  Score=44.65  Aligned_cols=22  Identities=32%  Similarity=0.339  Sum_probs=20.1

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +++|+|+.++|||+||+.|.+.
T Consensus        33 ~~~l~G~nGsGKSTLl~~l~Gl   54 (252)
T PRK14255         33 ITALIGPSGCGKSTYLRTLNRM   54 (252)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            7899999999999999999864


No 291
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional
Probab=89.98  E-value=0.23  Score=45.61  Aligned_cols=23  Identities=39%  Similarity=0.390  Sum_probs=21.0

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+.+
T Consensus        40 ~~~I~G~NGsGKSTLlk~l~Gl~   62 (257)
T PRK11247         40 FVAVVGRSGCGKSTLLRLLAGLE   62 (257)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCC
Confidence            78999999999999999998764


No 292
>PF13604 AAA_30:  AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A.
Probab=89.96  E-value=0.52  Score=41.55  Aligned_cols=37  Identities=32%  Similarity=0.402  Sum_probs=27.0

Q ss_pred             HHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          40 EALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        40 eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      +|++.++..    +..+++  |.|+.+|||||+|..+.+.+..
T Consensus         8 ~a~~~~l~~----~~~~~~--l~G~aGtGKT~~l~~~~~~~~~   44 (196)
T PF13604_consen    8 EAVRAILTS----GDRVSV--LQGPAGTGKTTLLKALAEALEA   44 (196)
T ss_dssp             HHHHHHHHC----TCSEEE--EEESTTSTHHHHHHHHHHHHHH
T ss_pred             HHHHHHHhc----CCeEEE--EEECCCCCHHHHHHHHHHHHHh
Confidence            577777642    334544  5899999999999999887654


No 293
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea.  Only very few species lack representatives of the siderophore family transporters.  The E. coli BtuCD protein is an ABC transporter mediating vitamin B12 uptake.  The two ATP-binding cassettes (BtuD) are in close contact with each other, as are the two membrane-spanning subunits (BtuC); this arrangement is distinct from that observed for the E. coli lipid flippase MsbA.  The BtuC subunits provide 20 transmembrane helices grouped around a translocation pathway that is closed to the cytoplasm by a gate region, whereas the dimer arrangement of the BtuD subunits resembles the ATP-bound form of the Rad50 DNA repair enzyme.  A prominent cytoplasmic loop of BtuC forms the contact region with the ATP-binding cassette and represent a conserved motif among the ABC transporters.
Probab=89.96  E-value=0.24  Score=42.51  Aligned_cols=23  Identities=35%  Similarity=0.395  Sum_probs=20.4

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -+++|+|+.++|||+|++.|.+.
T Consensus        26 ~~~~l~G~nGsGKStLl~~i~G~   48 (180)
T cd03214          26 EIVGILGPNGAGKSTLLKTLAGL   48 (180)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCC
Confidence            37889999999999999999765


No 294
>PRK07261 topology modulation protein; Provisional
Probab=89.96  E-value=0.27  Score=42.39  Aligned_cols=22  Identities=27%  Similarity=0.262  Sum_probs=19.6

Q ss_pred             EEEecccccChhHHHHHHHHhh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      |.|+|+.++|||+|+..|.+.+
T Consensus         3 i~i~G~~GsGKSTla~~l~~~~   24 (171)
T PRK07261          3 IAIIGYSGSGKSTLARKLSQHY   24 (171)
T ss_pred             EEEEcCCCCCHHHHHHHHHHHh
Confidence            7899999999999999997763


No 295
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional
Probab=89.91  E-value=0.21  Score=45.60  Aligned_cols=24  Identities=38%  Similarity=0.361  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|++..
T Consensus        38 e~~~i~G~nGsGKSTLl~~l~Gl~   61 (265)
T PRK10575         38 KVTGLIGHNGSGKSTLLKMLGRHQ   61 (265)
T ss_pred             CEEEEECCCCCCHHHHHHHHcCCC
Confidence            378999999999999999998753


No 296
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E. coli.  The hemolysin A (HlyA) transport machinery is composed of the ATP-binding cassette (ABC) transporter HlyB located in the inner membrane, hemolysin D (HlyD), also anchored in the inner membrane, and TolC, which resides in the outer membrane.  HlyD apparently forms a continuous channel that bridges the entire periplasm, interacting with TolC and HlyB.  This arrangement prevents the appearance of periplasmic intermediates of HlyA during substrate transport.  Little is known about the molecular details of HlyA transport, but it is evident that ATP-hydrolysis by the ABC-transporter HlyB is a necessary source of energy.
Probab=89.91  E-value=0.24  Score=44.10  Aligned_cols=24  Identities=33%  Similarity=0.509  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|++.+
T Consensus        29 e~~~i~G~nGsGKSTLl~~l~Gl~   52 (237)
T cd03252          29 EVVGIVGRSGSGKSTLTKLIQRFY   52 (237)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCc
Confidence            378899999999999999998764


No 297
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed
Probab=89.88  E-value=0.24  Score=44.28  Aligned_cols=24  Identities=33%  Similarity=0.371  Sum_probs=21.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|++.+
T Consensus        28 e~~~l~G~nGsGKSTLl~~l~G~~   51 (240)
T PRK09493         28 EVVVIIGPSGSGKSTLLRCINKLE   51 (240)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998764


No 298
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.88  E-value=0.24  Score=44.59  Aligned_cols=23  Identities=35%  Similarity=0.368  Sum_probs=20.6

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+.+
T Consensus        32 ~~~i~G~nGsGKSTLl~~l~Gl~   54 (251)
T PRK14249         32 ITAIIGPSGCGKSTLLRALNRMN   54 (251)
T ss_pred             EEEEECCCCCCHHHHHHHHhccc
Confidence            67899999999999999998764


No 299
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.86  E-value=0.24  Score=45.45  Aligned_cols=24  Identities=25%  Similarity=0.303  Sum_probs=21.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|++.+
T Consensus        36 e~~~l~G~nGsGKSTLl~~l~Gl~   59 (271)
T PRK13632         36 EYVAILGHNGSGKSTISKILTGLL   59 (271)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            378999999999999999998764


No 300
>PF09547 Spore_IV_A:  Stage IV sporulation protein A (spore_IV_A);  InterPro: IPR014201 This entry is designated stage IV sporulation protein A. It acts in the mother cell compartment and plays a role in spore coat morphogenesis []. A comparative genome analysis of all sequenced genomes of Firmicutes shows that the proteins are strictly conserved among the sub-set of endospore-forming species. 
Probab=89.86  E-value=0.23  Score=50.09  Aligned_cols=26  Identities=23%  Similarity=0.499  Sum_probs=22.1

Q ss_pred             eEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      -|. |+|+||-|||||++..+|.+-+.
T Consensus        17 dIY-iGVVGPVRTGKSTFIKRFMel~V   42 (492)
T PF09547_consen   17 DIY-IGVVGPVRTGKSTFIKRFMELLV   42 (492)
T ss_pred             ceE-EEeecCcccCchhHHHHHHHHhc
Confidence            344 69999999999999999998753


No 301
>PRK09825 idnK D-gluconate kinase; Provisional
Probab=89.86  E-value=0.3  Score=42.51  Aligned_cols=24  Identities=17%  Similarity=0.187  Sum_probs=21.3

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ++.|+|+.++|||+|++.+.+.+.
T Consensus         5 ~i~l~G~sGsGKSTl~~~la~~l~   28 (176)
T PRK09825          5 SYILMGVSGSGKSLIGSKIAALFS   28 (176)
T ss_pred             EEEEECCCCCCHHHHHHHHHHhcC
Confidence            688999999999999999988653


No 302
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=89.86  E-value=0.23  Score=44.74  Aligned_cols=24  Identities=25%  Similarity=0.433  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+..
T Consensus        32 e~~~l~G~nGsGKSTLl~~l~Gl~   55 (255)
T PRK11300         32 EIVSLIGPNGAGKTTVFNCLTGFY   55 (255)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCCc
Confidence            478999999999999999998764


No 303
>PRK12735 elongation factor Tu; Reviewed
Probab=89.85  E-value=1  Score=43.95  Aligned_cols=27  Identities=26%  Similarity=0.283  Sum_probs=24.3

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+|.--|+|+|...+|||+|+|+|+..
T Consensus         9 ~~~~~~i~iiGhvd~GKSTL~~~L~~~   35 (396)
T PRK12735          9 TKPHVNVGTIGHVDHGKTTLTAAITKV   35 (396)
T ss_pred             CCCeEEEEEECcCCCCHHHHHHHHHHh
Confidence            578888999999999999999999864


No 304
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea.  This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily.  The characteristic feature of these transporters is the obligatory coupling of ATP hydrolysis to substrate translocation.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.84  E-value=0.24  Score=45.48  Aligned_cols=24  Identities=29%  Similarity=0.391  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|.+.+
T Consensus        51 e~~~l~G~nGsGKSTLl~~L~Gl~   74 (269)
T cd03294          51 EIFVIMGLSGSGKSTLLRCINRLI   74 (269)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            378999999999999999998764


No 305
>TIGR00101 ureG urease accessory protein UreG. This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel.
Probab=89.84  E-value=0.3  Score=43.40  Aligned_cols=24  Identities=33%  Similarity=0.531  Sum_probs=21.5

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .|+|+|+.++|||+|++++++.+.
T Consensus         3 ~i~i~G~~GsGKTTll~~l~~~l~   26 (199)
T TIGR00101         3 KIGVAGPVGSGKTALIEALTRALR   26 (199)
T ss_pred             EEEEECCCCCCHHHHHHHHHHhhC
Confidence            588999999999999999998753


No 306
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component.  Biosynthesis of iron-sulfur clusters (Fe-S) depends on multiprotein systems.  The SUF system of E. coli and Erwinia chrysanthemi is important for Fe-S biogenesis under stressful conditions.  The SUF system is made of six proteins: SufC is an atypical cytoplasmic ABC-ATPase, which forms a complex with SufB and SufD; SufA plays the role of a scaffold protein for assembly of iron-sulfur clusters and delivery to target proteins; SufS is a cysteine desulfurase which mobilizes the sulfur atom from cysteine and provides it to the cluster; SufE has no associated function yet.
Probab=89.83  E-value=0.24  Score=43.35  Aligned_cols=23  Identities=26%  Similarity=0.261  Sum_probs=20.6

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+|++.|.+.
T Consensus        27 e~~~i~G~nGsGKStLl~~l~G~   49 (200)
T cd03217          27 EVHALMGPNGSGKSTLAKTIMGH   49 (200)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCC
Confidence            47889999999999999999765


No 307
>TIGR01393 lepA GTP-binding protein LepA. LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function is unknown.
Probab=89.83  E-value=1.6  Score=45.25  Aligned_cols=24  Identities=38%  Similarity=0.484  Sum_probs=20.8

Q ss_pred             EEEEEEecccccChhHHHHHHHHh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |-=|+|+|....|||+|+++|+..
T Consensus         3 iRNi~IIGh~d~GKTTL~~rLl~~   26 (595)
T TIGR01393         3 IRNFSIIAHIDHGKSTLADRLLEY   26 (595)
T ss_pred             eeEEEEECCCCCCHHHHHHHHHHH
Confidence            445789999999999999999865


No 308
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional
Probab=89.82  E-value=0.24  Score=45.38  Aligned_cols=24  Identities=25%  Similarity=0.350  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|.+.+
T Consensus        40 e~~~i~G~NGsGKSTLl~~l~Gl~   63 (267)
T PRK15112         40 QTLAIIGENGSGKSTLAKMLAGMI   63 (267)
T ss_pred             CEEEEEcCCCCCHHHHHHHHhCCC
Confidence            368899999999999999998764


No 309
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.79  E-value=0.25  Score=45.42  Aligned_cols=24  Identities=33%  Similarity=0.278  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+..
T Consensus        40 e~~~l~G~nGsGKSTLl~~l~Gl~   63 (269)
T PRK14259         40 KVTALIGPSGCGKSTVLRSLNRMN   63 (269)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            378899999999999999998753


No 310
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters. PDR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  This PDR subfamily represents domain I of its (ABC-IM)2 organization.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.78  E-value=0.25  Score=42.97  Aligned_cols=23  Identities=30%  Similarity=0.411  Sum_probs=20.3

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -+++|+|+.++|||+|++.|...
T Consensus        34 e~~~l~G~nGsGKSTLl~~l~G~   56 (192)
T cd03232          34 TLTALMGESGAGKTTLLDVLAGR   56 (192)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCC
Confidence            47899999999999999999753


No 311
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional
Probab=89.77  E-value=0.24  Score=45.16  Aligned_cols=23  Identities=39%  Similarity=0.413  Sum_probs=20.7

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|++.+
T Consensus        30 ~~~i~G~nGsGKSTLl~~i~G~~   52 (258)
T PRK13548         30 VVAILGPNGAGKSTLLRALSGEL   52 (258)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            68999999999999999998754


No 312
>PRK13651 cobalt transporter ATP-binding subunit; Provisional
Probab=89.76  E-value=0.24  Score=46.78  Aligned_cols=25  Identities=16%  Similarity=0.331  Sum_probs=21.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .+++|+|+.++|||+|++.|.+.+.
T Consensus        34 e~v~iiG~nGsGKSTLl~~L~Gl~~   58 (305)
T PRK13651         34 EFIAIIGQTGSGKTTFIEHLNALLL   58 (305)
T ss_pred             CEEEEECCCCCcHHHHHHHHhCCCC
Confidence            3789999999999999999987654


No 313
>KOG1547|consensus
Probab=89.75  E-value=1.1  Score=42.59  Aligned_cols=20  Identities=30%  Similarity=0.360  Sum_probs=16.3

Q ss_pred             CCCceEEEEEecCCCCCCCc
Q psy5031         202 TGEKAAVILLDTQGTFDSES  221 (281)
Q Consensus       202 ~g~~v~VlLlDTEG~~d~~~  221 (281)
                      +|=++.+-++||+|++|.=.
T Consensus       100 ~gVklkltviDTPGfGDqIn  119 (336)
T KOG1547|consen  100 KGVKLKLTVIDTPGFGDQIN  119 (336)
T ss_pred             cceEEEEEEecCCCcccccC
Confidence            56678899999999998743


No 314
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=89.73  E-value=1.4  Score=39.16  Aligned_cols=26  Identities=19%  Similarity=0.294  Sum_probs=22.5

Q ss_pred             EEEEEecccccChhHHHHHHHHhhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .||.++||.++||++.+=.|..++..
T Consensus         2 ~vi~lvGptGvGKTTt~aKLAa~~~~   27 (196)
T PF00448_consen    2 KVIALVGPTGVGKTTTIAKLAARLKL   27 (196)
T ss_dssp             EEEEEEESTTSSHHHHHHHHHHHHHH
T ss_pred             EEEEEECCCCCchHhHHHHHHHHHhh
Confidence            37899999999999999999887643


No 315
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor.  The ABC ATPase, RNase L inhibitor (RLI), is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids.  RLI's are not transport proteins and thus cluster with a group of soluble proteins that lack the transmembrane components commonly found in other members of the family.  Structurally, RLI's have an N-terminal Fe-S domain and two nucleotide-binding domains which are arranged to form two composite active sites in their interface cleft.  RLI is one of the most conserved enzymes between archaea and eukaryotes with a sequence identity of more than 48%.  The high degree of evolutionary conservation suggests that RLI performs a central role in archaeal and eukaryotic physiology.
Probab=89.73  E-value=0.24  Score=45.16  Aligned_cols=24  Identities=21%  Similarity=0.378  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        26 e~~~i~G~NGsGKSTLlk~L~G~~   49 (246)
T cd03237          26 EVIGILGPNGIGKTTFIKMLAGVL   49 (246)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378899999999999999998764


No 316
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional
Probab=89.72  E-value=0.25  Score=44.94  Aligned_cols=24  Identities=33%  Similarity=0.401  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+..
T Consensus        31 e~~~i~G~nGsGKSTLl~~i~G~~   54 (262)
T PRK09984         31 EMVALLGPSGSGKSTLLRHLSGLI   54 (262)
T ss_pred             cEEEEECCCCCCHHHHHHHHhccC
Confidence            378999999999999999998754


No 317
>PRK00698 tmk thymidylate kinase; Validated
Probab=89.71  E-value=0.33  Score=41.71  Aligned_cols=26  Identities=19%  Similarity=0.365  Sum_probs=22.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .+|+|.|+-++|||++++.|..++..
T Consensus         4 ~~I~ieG~~gsGKsT~~~~L~~~l~~   29 (205)
T PRK00698          4 MFITIEGIDGAGKSTQIELLKELLEQ   29 (205)
T ss_pred             eEEEEECCCCCCHHHHHHHHHHHHHH
Confidence            37899999999999999999988644


No 318
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed
Probab=89.70  E-value=0.25  Score=45.11  Aligned_cols=24  Identities=25%  Similarity=0.411  Sum_probs=21.0

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        31 e~~~I~G~NGsGKSTLl~~i~Gl~   54 (251)
T PRK09544         31 KILTLLGPNGAGKSTLVRVVLGLV   54 (251)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            468999999999999999998754


No 319
>TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB. Members of this protein family are the DotB component of Dot/Icm secretion systems, as found in obligate intracellular pathogens Legionella pneumophila and Coxiella burnetii. While this system resembles type IV secretion systems and has been called a form of type IV, the liturature now seems to favor calling this the Dot/Icm system. This family is most closely related to TraJ proteins of plasmid transfer, rather than to proteins of other type IV secretion systems.
Probab=89.70  E-value=0.29  Score=47.63  Aligned_cols=26  Identities=35%  Similarity=0.429  Sum_probs=23.5

Q ss_pred             EEEEEEecccccChhHHHHHHHHhhh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      =.+|.|+||.+||||++|+.|++++.
T Consensus       134 ~glilI~GpTGSGKTTtL~aLl~~i~  159 (358)
T TIGR02524       134 EGIVFITGATGSGKSTLLAAIIRELA  159 (358)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHHHh
Confidence            46899999999999999999999864


No 320
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=89.70  E-value=0.28  Score=40.26  Aligned_cols=21  Identities=29%  Similarity=0.173  Sum_probs=18.7

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||.|+|+|...
T Consensus         3 i~i~G~~~~GKSsli~~l~~~   23 (171)
T cd00157           3 IVVVGDGAVGKTCLLISYTTG   23 (171)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            668999999999999999754


No 321
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK. Members of this family are the PhnK protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three component ABC transporter, where TIGR01097 is the permease, TIGR01098 is the phosphonates binding protein, and TIGR02315 is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated complex. This protein (PhnK) and the adjacent-encoded PhnL resemble transporter ATP-binding proteins but are suggested, based on mutatgenesis studies, to be part of this complex rather than part of a transporter per se.
Probab=89.69  E-value=0.25  Score=44.54  Aligned_cols=24  Identities=33%  Similarity=0.414  Sum_probs=21.0

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        30 e~~~i~G~nGsGKSTLl~~l~G~~   53 (253)
T TIGR02323        30 EVLGIVGESGSGKSTLLGCLAGRL   53 (253)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            378899999999999999998764


No 322
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional
Probab=89.69  E-value=0.24  Score=44.80  Aligned_cols=23  Identities=30%  Similarity=0.450  Sum_probs=20.6

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        30 ~~~l~G~nGsGKSTLl~~l~Gl~   52 (255)
T PRK11231         30 ITALIGPNGCGKSTLLKCFARLL   52 (255)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCc
Confidence            78999999999999999998753


No 323
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional
Probab=89.68  E-value=0.24  Score=45.40  Aligned_cols=23  Identities=22%  Similarity=0.358  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        35 ~~~i~G~nGsGKSTLl~~l~Gl~   57 (269)
T PRK11831         35 ITAIMGPSGIGKTTLLRLIGGQI   57 (269)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            78999999999999999998764


No 324
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE. This family represents the NikE subunit of a multisubunit nickel import ABC transporter complex. Nickel, once imported, may be used in urease and in certain classes of hydrogenase and superoxide dismutase.
Probab=89.68  E-value=0.24  Score=45.19  Aligned_cols=24  Identities=33%  Similarity=0.296  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|++.+
T Consensus        38 e~~~i~G~nGsGKSTLl~~l~Gl~   61 (265)
T TIGR02769        38 ETVGLLGRSGCGKSTLARLLLGLE   61 (265)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378899999999999999998764


No 325
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein. This model describes the energy-transducing ATPase subunit ThiQ of the ThiBPQ thiamine (and thiamine pyrophosphate) ABC transporter in several Proteobacteria. This protein is found so far only in Proteobacteria, and is found in complete genomes only if the ThiB and ThiP subunits are also found.
Probab=89.67  E-value=0.26  Score=43.30  Aligned_cols=25  Identities=28%  Similarity=0.559  Sum_probs=21.7

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .+++|+|+.++|||+|++.|++.+.
T Consensus        25 e~~~i~G~nGsGKSTLl~~l~G~~~   49 (213)
T TIGR01277        25 EIVAIMGPSGAGKSTLLNLIAGFIE   49 (213)
T ss_pred             cEEEEECCCCCCHHHHHHHHhcCCC
Confidence            4688999999999999999987643


No 326
>CHL00131 ycf16 sulfate ABC transporter protein; Validated
Probab=89.64  E-value=0.23  Score=44.68  Aligned_cols=23  Identities=22%  Similarity=0.238  Sum_probs=20.1

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+|++.|++.
T Consensus        34 e~~~i~G~nGsGKSTLl~~i~Gl   56 (252)
T CHL00131         34 EIHAIMGPNGSGKSTLSKVIAGH   56 (252)
T ss_pred             cEEEEECCCCCCHHHHHHHHcCC
Confidence            47889999999999999999764


No 327
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=89.63  E-value=0.26  Score=41.79  Aligned_cols=21  Identities=29%  Similarity=0.314  Sum_probs=18.5

Q ss_pred             EEEEecccccChhHHHHHHHH
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      -|.|+|+.++|||+|+|++.+
T Consensus        21 ki~ilG~~~~GKStLi~~l~~   41 (190)
T cd00879          21 KILFLGLDNAGKTTLLHMLKD   41 (190)
T ss_pred             EEEEECCCCCCHHHHHHHHhc
Confidence            348999999999999999964


No 328
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional
Probab=89.62  E-value=0.25  Score=44.02  Aligned_cols=24  Identities=29%  Similarity=0.497  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+..
T Consensus        26 e~~~l~G~nGsGKSTLl~~l~Gl~   49 (232)
T PRK10771         26 ERVAILGPSGAGKSTLLNLIAGFL   49 (232)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378899999999999999998754


No 329
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed
Probab=89.61  E-value=0.23  Score=44.46  Aligned_cols=23  Identities=30%  Similarity=0.221  Sum_probs=20.4

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+|++.|.+.
T Consensus        28 e~~~i~G~nGsGKSTLl~~l~Gl   50 (248)
T PRK09580         28 EVHAIMGPNGSGKSTLSATLAGR   50 (248)
T ss_pred             CEEEEECCCCCCHHHHHHHHcCC
Confidence            37889999999999999999775


No 330
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules.  Loaded MHC I leave the ER and display their antigenic cargo on the cell surface to cytotoxic T cells.  Subsequently, virus-infected or malignantly transformed cells can be eliminated.  TAP belongs to the large family of ATP-binding cassette (ABC) transporters, which translocate a vast variety of solutes across membranes.
Probab=89.60  E-value=0.28  Score=43.37  Aligned_cols=24  Identities=25%  Similarity=0.407  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|++.+
T Consensus        41 e~~~i~G~nGsGKSTLl~~l~Gl~   64 (226)
T cd03248          41 EVTALVGPSGSGKSTVVALLENFY   64 (226)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCc
Confidence            378999999999999999998764


No 331
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=89.59  E-value=0.23  Score=46.15  Aligned_cols=29  Identities=28%  Similarity=0.244  Sum_probs=25.6

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .|=-|++|+||.++|||+||..|..++..
T Consensus        25 ~pGev~ailGPNGAGKSTlLk~LsGel~p   53 (259)
T COG4559          25 RPGEVLAILGPNGAGKSTLLKALSGELSP   53 (259)
T ss_pred             cCCcEEEEECCCCccHHHHHHHhhCccCC
Confidence            45678999999999999999999988764


No 332
>PRK14237 phosphate transporter ATP-binding protein; Provisional
Probab=89.58  E-value=0.29  Score=44.85  Aligned_cols=24  Identities=29%  Similarity=0.289  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|.+.+
T Consensus        47 e~~~I~G~nGsGKSTLl~~l~Gl~   70 (267)
T PRK14237         47 KITALIGPSGSGKSTYLRSLNRMN   70 (267)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhcc
Confidence            378999999999999999998754


No 333
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional
Probab=89.57  E-value=0.23  Score=44.25  Aligned_cols=23  Identities=35%  Similarity=0.361  Sum_probs=20.6

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+.+
T Consensus        33 ~~~i~G~nGsGKSTLl~~l~G~~   55 (237)
T PRK11614         33 IVTLIGANGAGKTTLLGTLCGDP   55 (237)
T ss_pred             EEEEECCCCCCHHHHHHHHcCCC
Confidence            78999999999999999997653


No 334
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.53  E-value=0.24  Score=45.38  Aligned_cols=23  Identities=35%  Similarity=0.309  Sum_probs=20.7

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        29 ~~~i~G~nGsGKSTLl~~l~Gl~   51 (271)
T PRK13638         29 VTGLVGANGCGKSTLFMNLSGLL   51 (271)
T ss_pred             EEEEECCCCCCHHHHHHHHcCCC
Confidence            78999999999999999998754


No 335
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.52  E-value=0.29  Score=44.08  Aligned_cols=23  Identities=30%  Similarity=0.293  Sum_probs=20.7

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+..
T Consensus        33 ~~~I~G~nGsGKSTLl~~i~G~~   55 (251)
T PRK14244         33 VTAFIGPSGCGKSTFLRCFNRMN   55 (251)
T ss_pred             EEEEECCCCCCHHHHHHHHHhhc
Confidence            78899999999999999998763


No 336
>PRK06762 hypothetical protein; Provisional
Probab=89.52  E-value=0.35  Score=40.59  Aligned_cols=23  Identities=17%  Similarity=0.300  Sum_probs=21.0

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +|.|+|+.++|||++...|.+.+
T Consensus         4 li~i~G~~GsGKST~A~~L~~~l   26 (166)
T PRK06762          4 LIIIRGNSGSGKTTIAKQLQERL   26 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHh
Confidence            67889999999999999998875


No 337
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins.  GTPases act as molecular switches regulating diverse cellular processes.  DRG2 and DRG1 comprise the DRG subfamily in eukaryotes.  In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes.  It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=89.50  E-value=0.24  Score=44.86  Aligned_cols=23  Identities=35%  Similarity=0.280  Sum_probs=19.9

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |-|+++|+.++|||+|+|+|.+.
T Consensus         1 ~~v~lvG~~~~GKStLl~~Ltg~   23 (233)
T cd01896           1 ARVALVGFPSVGKSTLLSKLTNT   23 (233)
T ss_pred             CEEEEECCCCCCHHHHHHHHHCC
Confidence            35789999999999999999754


No 338
>cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor. TMPK represents the rate-limiting step in either de novo or salvage biosynthesis of thymidine triphosphate (TTP).
Probab=89.46  E-value=0.35  Score=40.81  Aligned_cols=25  Identities=20%  Similarity=0.343  Sum_probs=22.4

Q ss_pred             EEEEecccccChhHHHHHHHHhhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      +|+|.|+-++|||++++.|...+..
T Consensus         2 ~I~ieG~~GsGKtT~~~~L~~~l~~   26 (200)
T cd01672           2 FIVFEGIDGAGKTTLIELLAERLEA   26 (200)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHH
Confidence            6889999999999999999988753


No 339
>PF06309 Torsin:  Torsin;  InterPro: IPR010448 This family consists of several eukaryotic torsin proteins. Torsion dystonia is an autosomal dominant movement disorder characterised by involuntary, repetitive muscle contractions and twisted postures. The most severe early-onset form of dystonia has been linked to mutations in the human DYT1 (TOR1A) gene encoding a protein termed torsinA. While causative genetic alterations have been identified, the function of torsin proteins and the molecular mechanism underlying dystonia remain unknown. Phylogenetic analysis of the torsin protein family indicates these proteins share distant sequence similarity with the large and diverse family of AAA ATPase, central region containing proteins () proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor
Probab=89.46  E-value=0.71  Score=39.04  Aligned_cols=42  Identities=21%  Similarity=0.262  Sum_probs=32.1

Q ss_pred             HHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhhhc
Q psy5031          40 EALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMNFT   83 (281)
Q Consensus        40 eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~~   83 (281)
                      .|+...+..+ ..+|| =|+|.-|+.+|||||+...|++.++..
T Consensus        39 ~ai~~~l~~~-~p~Kp-LVlSfHG~tGtGKn~v~~liA~~ly~~   80 (127)
T PF06309_consen   39 NAIKGHLANP-NPRKP-LVLSFHGWTGTGKNFVSRLIAEHLYKS   80 (127)
T ss_pred             HHHHHHHcCC-CCCCC-EEEEeecCCCCcHHHHHHHHHHHHHhc
Confidence            4555555432 24667 689999999999999999999998753


No 340
>PLN02348 phosphoribulokinase
Probab=89.46  E-value=0.33  Score=48.15  Aligned_cols=28  Identities=25%  Similarity=0.192  Sum_probs=25.0

Q ss_pred             eEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      ...||+|+|+.++|||+|+++|.+.+..
T Consensus        48 ~p~IIGIaG~SGSGKSTfA~~L~~~Lg~   75 (395)
T PLN02348         48 GTVVIGLAADSGCGKSTFMRRLTSVFGG   75 (395)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHhh
Confidence            4579999999999999999999998754


No 341
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]
Probab=89.44  E-value=0.31  Score=43.38  Aligned_cols=26  Identities=27%  Similarity=0.374  Sum_probs=23.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      -||+++||.++|||+|+.++...+..
T Consensus        29 eivtlMGPSGcGKSTLls~~~G~La~   54 (213)
T COG4136          29 EIVTLMGPSGCGKSTLLSWMIGALAG   54 (213)
T ss_pred             cEEEEECCCCccHHHHHHHHHhhccc
Confidence            48999999999999999999888643


No 342
>PRK14238 phosphate transporter ATP-binding protein; Provisional
Probab=89.44  E-value=0.3  Score=44.93  Aligned_cols=24  Identities=29%  Similarity=0.324  Sum_probs=21.6

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        51 e~~~I~G~nGsGKSTLl~~i~Gl~   74 (271)
T PRK14238         51 EVTAIIGPSGCGKSTYIKTLNRMV   74 (271)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhhc
Confidence            488999999999999999998864


No 343
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.42  E-value=0.27  Score=45.62  Aligned_cols=25  Identities=20%  Similarity=0.280  Sum_probs=21.8

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .+++|+|+.++|||+|++.|.+.+.
T Consensus        34 e~~~i~G~nGsGKSTLl~~L~Gl~~   58 (286)
T PRK13646         34 KYYAIVGQTGSGKSTLIQNINALLK   58 (286)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCCC
Confidence            4789999999999999999987653


No 344
>TIGR01313 therm_gnt_kin carbohydrate kinase, thermoresistant glucokinase family. This model represents a subfamily of proteins that includes thermoresistant and thermosensitve isozymes of gluconate kinase (gluconokinase) in E. coli and other related proteins; members of this family are often named by similarity to the thermostable isozyme. These proteins show homology to shikimate kinases and adenylate kinases but not to gluconate kinases from the FGGY family of carbohydrate kinases.
Probab=89.41  E-value=0.26  Score=41.26  Aligned_cols=23  Identities=22%  Similarity=0.264  Sum_probs=20.0

Q ss_pred             EEEecccccChhHHHHHHHHhhh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      |.++|+.++|||++++.|.+.+.
T Consensus         1 i~l~G~~GsGKSTla~~l~~~l~   23 (163)
T TIGR01313         1 FVLMGVAGSGKSTIASALAHRLG   23 (163)
T ss_pred             CEEECCCCCCHHHHHHHHHHhcC
Confidence            45889999999999999998753


No 345
>PF13086 AAA_11:  AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A.
Probab=89.40  E-value=0.43  Score=40.84  Aligned_cols=23  Identities=17%  Similarity=0.304  Sum_probs=18.6

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +..|.||.+||||+++-.++..+
T Consensus        19 ~~~i~GpPGTGKT~~l~~~i~~~   41 (236)
T PF13086_consen   19 ITLIQGPPGTGKTTTLASIIAQL   41 (236)
T ss_dssp             -EEEE-STTSSHHHHHHHHHHHH
T ss_pred             CEEEECCCCCChHHHHHHHHHHh
Confidence            77789999999999888888776


No 346
>PRK14243 phosphate transporter ATP-binding protein; Provisional
Probab=89.40  E-value=0.3  Score=44.62  Aligned_cols=23  Identities=26%  Similarity=0.313  Sum_probs=20.5

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+||+.|.+.
T Consensus        37 e~~~i~G~nGsGKSTLl~~l~Gl   59 (264)
T PRK14243         37 QITAFIGPSGCGKSTILRCFNRL   59 (264)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhh
Confidence            47889999999999999999864


No 347
>cd03290 ABCC_SUR1_N The SUR domain 1.  The sulfonylurea receptor SUR is an ATP transporter of the ABCC/MRP family with tandem ATPase binding domains.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=89.37  E-value=0.28  Score=43.15  Aligned_cols=24  Identities=33%  Similarity=0.322  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+-.
T Consensus        28 e~~~i~G~nGsGKSTLl~~i~G~~   51 (218)
T cd03290          28 QLTMIVGQVGCGKSSLLLAILGEM   51 (218)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccC
Confidence            478999999999999999998754


No 348
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis.  The CydC and CydD proteins are important for the formation of cytochrome bd terminal oxidase of E. coli and it has been proposed that they were necessary for biosynthesis of the cytochrome bd quinol oxidase and for periplasmic c-type cytochromes.  CydCD were proposed to determine a heterooligomeric complex important for heme export into the periplasm or to be involved in the maintenance of the proper redox state of the periplasmic space.  In Bacillus subtilius, the absence of CydCD does not affect the presence of halo-cytochrome c in the membrane and this observation suggests that CydCD proteins are not involved in the export of heme in this organism.
Probab=89.36  E-value=0.29  Score=41.84  Aligned_cols=22  Identities=32%  Similarity=0.380  Sum_probs=19.8

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +++|+|+.++|||+||+.|.+.
T Consensus        30 ~~~i~G~nGsGKStLl~~l~G~   51 (178)
T cd03247          30 KIALLGRSGSGKSTLLQLLTGD   51 (178)
T ss_pred             EEEEECCCCCCHHHHHHHHhcc
Confidence            6889999999999999999765


No 349
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D.  PotA has two domains with the N-terminal domain containing the ATPase activity and the residues required for homodimerization with PotA and heterdimerization with PotB.  ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.34  E-value=0.29  Score=43.68  Aligned_cols=25  Identities=20%  Similarity=0.267  Sum_probs=21.8

Q ss_pred             EEEEEEecccccChhHHHHHHHHhh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      =.+++|+|+.++|||+|++.|++..
T Consensus        26 Ge~~~i~G~nGsGKSTLl~~l~g~~   50 (232)
T cd03300          26 GEFFTLLGPSGCGKTTLLRLIAGFE   50 (232)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhcCC
Confidence            3578899999999999999998764


No 350
>PRK07429 phosphoribulokinase; Provisional
Probab=89.34  E-value=0.34  Score=46.63  Aligned_cols=28  Identities=29%  Similarity=0.329  Sum_probs=24.4

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ...-+|+|+|+.++|||+|++.|.+.+.
T Consensus         6 ~~~~IIgI~G~SGSGKSTla~~L~~ll~   33 (327)
T PRK07429          6 DRPVLLGVAGDSGCGKTTFLRGLADLLG   33 (327)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHhHhc
Confidence            3456999999999999999999998764


No 351
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt   The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export.  Among the variety of membrane-linked or extracellular polysaccharides excreted by bacteria, only capsular polysaccharides, lipopolysaccharides, and teichoic acids have been shown to be exported by ABC transporters.  A typical system is made of a conserved integral membrane and an ABC.  In addition to these proteins, capsular polysaccharide exporter systems require two 'accessory' proteins to perform their function: a periplasmic (E.coli) or a lipid-anchored outer membrane protein called OMA (Neisseria meningitidis and Haemophilus influenzae) and a cytoplasmic membrane protein MPA2.
Probab=89.32  E-value=0.27  Score=43.86  Aligned_cols=24  Identities=29%  Similarity=0.314  Sum_probs=21.0

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+..
T Consensus        49 e~~~i~G~nGsGKSTLl~~l~G~~   72 (224)
T cd03220          49 ERIGLIGRNGAGKSTLLRLLAGIY   72 (224)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            368899999999999999998754


No 352
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.32  E-value=0.31  Score=43.81  Aligned_cols=23  Identities=30%  Similarity=0.326  Sum_probs=20.6

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+||+.|++.
T Consensus        30 e~~~i~G~nGsGKSTLl~~l~Gl   52 (250)
T PRK14266         30 SVTALIGPSGCGKSTFIRTLNRM   52 (250)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhh
Confidence            37889999999999999999875


No 353
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export.  They belong to the subfamily C of the ATP-binding cassette (ABC) superfamily of transport proteins.  The ABCC subfamily contains transporters with a diverse functional spectrum that includes ion transport, cell surface receptor, and toxin secretion activities.  The MRP-like family, simlar to all ABC proteins, have a common four-domain core structure constituted by two membrane-spanning domains, each composed of six transmembrane (TM) helices, and two nucleotide-binding domains (NBD).  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=89.32  E-value=0.31  Score=41.53  Aligned_cols=24  Identities=42%  Similarity=0.558  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.+.+.+
T Consensus        29 ~~~~l~G~nGsGKstLl~~i~G~~   52 (171)
T cd03228          29 EKVAIVGPSGSGKSTLLKLLLRLY   52 (171)
T ss_pred             CEEEEECCCCCCHHHHHHHHHcCC
Confidence            378999999999999999997653


No 354
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.30  E-value=0.28  Score=45.39  Aligned_cols=24  Identities=17%  Similarity=0.209  Sum_probs=21.6

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        34 e~~~I~G~nGaGKSTLl~~l~G~~   57 (282)
T PRK13640         34 SWTALIGHNGSGKSTISKLINGLL   57 (282)
T ss_pred             CEEEEECCCCCcHHHHHHHHhccc
Confidence            478999999999999999998765


No 355
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=89.29  E-value=0.27  Score=40.06  Aligned_cols=21  Identities=24%  Similarity=0.127  Sum_probs=18.7

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|+.++|||.|+|++.+.
T Consensus         2 i~iiG~~~~GKssli~~~~~~   22 (158)
T cd00878           2 ILILGLDGAGKTTILYKLKLG   22 (158)
T ss_pred             EEEEcCCCCCHHHHHHHHhcC
Confidence            678999999999999999754


No 356
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=89.29  E-value=0.3  Score=40.18  Aligned_cols=22  Identities=36%  Similarity=0.374  Sum_probs=19.3

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .|.++|...+|||.|+|+|.+.
T Consensus         2 ~i~~~G~~~~GKssli~~l~~~   23 (168)
T cd01897           2 TLVIAGYPNVGKSSLVNKLTRA   23 (168)
T ss_pred             eEEEEcCCCCCHHHHHHHHhcC
Confidence            4788999999999999999754


No 357
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional
Probab=89.28  E-value=0.28  Score=44.44  Aligned_cols=24  Identities=29%  Similarity=0.299  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|++.+
T Consensus        32 e~~~l~G~nGsGKSTLl~~i~G~~   55 (257)
T PRK10619         32 DVISIIGSSGSGKSTFLRCINFLE   55 (257)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            478899999999999999998764


No 358
>KOG2485|consensus
Probab=89.27  E-value=0.84  Score=44.27  Aligned_cols=25  Identities=32%  Similarity=0.219  Sum_probs=19.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .-|=|+|....|||.|+|.+.+...
T Consensus       144 ~~vmVvGvPNVGKSsLINa~r~~~L  168 (335)
T KOG2485|consen  144 YNVMVVGVPNVGKSSLINALRNVHL  168 (335)
T ss_pred             eeEEEEcCCCCChHHHHHHHHHHHh
Confidence            3455788888999999998876643


No 359
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.27  E-value=0.28  Score=45.21  Aligned_cols=24  Identities=25%  Similarity=0.228  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        29 e~~~i~G~nGsGKSTLl~~l~Gl~   52 (274)
T PRK13644         29 EYIGIIGKNGSGKSTLALHLNGLL   52 (274)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            378999999999999999998754


No 360
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.26  E-value=0.28  Score=45.53  Aligned_cols=25  Identities=24%  Similarity=0.369  Sum_probs=21.6

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      -+++|+|+.++|||+||+.|++.+.
T Consensus        34 e~~~iiG~NGaGKSTLl~~l~Gl~~   58 (287)
T PRK13641         34 SFVALVGHTGSGKSTLMQHFNALLK   58 (287)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCCC
Confidence            3689999999999999999987643


No 361
>PLN03046 D-glycerate 3-kinase; Provisional
Probab=89.26  E-value=0.33  Score=48.87  Aligned_cols=26  Identities=19%  Similarity=0.139  Sum_probs=22.6

Q ss_pred             EEEEEEecccccChhHHHHHHHHhhh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      --||+|+|+.+||||+|++.|...+.
T Consensus       212 PlIIGIsG~qGSGKSTLa~~L~~lL~  237 (460)
T PLN03046        212 PLVIGFSAPQGCGKTTLVFALDYLFR  237 (460)
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHhc
Confidence            36999999999999999999976653


No 362
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.  This family is also known as MRP (mulrtidrug resisitance-associated protein).  Some of the MRP members have five additional transmembrane segments in their N-terminas, but the function of these additional membrane-spanning domains is not clear.  The MRP was found in the multidrug-resisting lung cancer cell in which p-glycoprotein was not overexpressed. MRP exports glutathione by drug stimulation, as well as, certain substrates in conjugated forms with anions, such as glutathione, glucuronate, and sulfate.
Probab=89.25  E-value=0.29  Score=42.62  Aligned_cols=23  Identities=39%  Similarity=0.553  Sum_probs=20.5

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.+++..
T Consensus        33 ~~~i~G~nG~GKSTLl~~i~G~~   55 (204)
T cd03250          33 LVAIVGPVGSGKSSLLSALLGEL   55 (204)
T ss_pred             EEEEECCCCCCHHHHHHHHhCcC
Confidence            78899999999999999998753


No 363
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake.  NatB possess six putative membrane spanning regions at its C-terminus.  In B. subtilis, NatAB is inducible by agents such as ethanol and protonophores, which lower the protonmotive force across the membrane.  The closest sequence similarity to NatA is exhibited by DrrA of the two-component daunomycin- and doxorubicin-efflux system.  Hence, the functional NatAB is presumably assembled with two copies of the single ATP-binding protein and the single intergral membrane protein.
Probab=89.25  E-value=0.28  Score=44.01  Aligned_cols=24  Identities=25%  Similarity=0.331  Sum_probs=21.0

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        48 e~~~i~G~NGsGKSTLl~~i~Gl~   71 (236)
T cd03267          48 EIVGFIGPNGAGKTTTLKILSGLL   71 (236)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCc
Confidence            478899999999999999998754


No 364
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit. This protein family is the ATP-binding cassette subunit of binding protein-dependent ABC transporter complex that strictly co-occurs with TIGR03769. TIGRFAMs model TIGR03769 describes a protein domain that occurs singly or as one of up to three repeats in proteins of a number of Actinobacteria, including Propionibacterium acnes KPA171202. The TIGR03769 domain occurs both in an adjacent gene for the substrate-binding protein and in additional (often nearby) proteins, often with LPXTG-like sortase recognition signals. Homologous ATP-binding subunits outside the scope of this family include manganese transporter MntA in Synechocystis sp. PCC 6803 and chelated iron transporter subunits. The function of this transporter complex is unknown.
Probab=89.20  E-value=0.29  Score=43.57  Aligned_cols=24  Identities=25%  Similarity=0.389  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+..
T Consensus         7 e~~~l~G~nGsGKSTLl~~l~G~~   30 (223)
T TIGR03771         7 ELLGLLGPNGAGKTTLLRAILGLI   30 (223)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            478899999999999999998764


No 365
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional
Probab=89.20  E-value=0.29  Score=43.24  Aligned_cols=23  Identities=30%  Similarity=0.382  Sum_probs=20.4

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+..
T Consensus        39 ~~~i~G~nGsGKSTLl~~i~G~~   61 (214)
T PRK13543         39 ALLVQGDNGAGKTTLLRVLAGLL   61 (214)
T ss_pred             EEEEEcCCCCCHHHHHHHHhCCC
Confidence            68899999999999999998753


No 366
>TIGR00017 cmk cytidylate kinase. This family consists of cytidylate kinase, which catalyzes the phosphorylation of cytidine 5-monophosphate (dCMP) to cytidine 5 -diphosphate (dCDP) in the presence of ATP or GTP. UMP and dCMP can also act as acceptors.
Probab=89.20  E-value=0.35  Score=43.63  Aligned_cols=24  Identities=17%  Similarity=0.328  Sum_probs=21.5

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +|+|.|+.++|||++++.|...+.
T Consensus         4 ~i~i~G~~GsGKst~~~~la~~~~   27 (217)
T TIGR00017         4 IIAIDGPSGAGKSTVAKAVAEKLG   27 (217)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHhC
Confidence            699999999999999999987543


No 367
>cd01857 HSR1_MMR1 HSR1/MMR1.  Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.
Probab=89.19  E-value=0.28  Score=40.44  Aligned_cols=22  Identities=27%  Similarity=0.353  Sum_probs=19.1

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+.++|..+.|||+|+|.|++.
T Consensus        85 ~~~~~G~~~vGKstlin~l~~~  106 (141)
T cd01857          85 TIGLVGYPNVGKSSLINALVGK  106 (141)
T ss_pred             EEEEECCCCCCHHHHHHHHhCC
Confidence            5678899999999999999754


No 368
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit. This model describes daunorubicin resistance ABC transporter, ATP binding subunit in bacteria and archaea. This model is restricted in its scope to preferentially recognize the ATP binding subunit associated with effux of the drug, daunorubicin. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. In eukaryotes proteins of similar function include p-gyco proteins, multidrug resistance protein etc.
Probab=89.19  E-value=0.28  Score=45.88  Aligned_cols=25  Identities=20%  Similarity=0.279  Sum_probs=21.8

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .+++++|+.++|||+|++.|++.+.
T Consensus        20 e~~~l~G~NGaGKSTLl~~l~Gl~~   44 (302)
T TIGR01188        20 EVFGFLGPNGAGKTTTIRMLTTLLR   44 (302)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCCC
Confidence            3789999999999999999987653


No 369
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=89.01  E-value=0.29  Score=45.52  Aligned_cols=23  Identities=30%  Similarity=0.365  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+-+
T Consensus        34 ~v~i~G~nGsGKSTLl~~l~Gl~   56 (288)
T PRK13643         34 YTALIGHTGSGKSTLLQHLNGLL   56 (288)
T ss_pred             EEEEECCCCChHHHHHHHHhcCC
Confidence            78999999999999999998754


No 370
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional
Probab=89.00  E-value=0.31  Score=44.97  Aligned_cols=23  Identities=30%  Similarity=0.362  Sum_probs=20.5

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        48 ~~~IiG~nGsGKSTLl~~l~Gl~   70 (274)
T PRK14265         48 IIAFIGPSGCGKSTLLRCFNRMN   70 (274)
T ss_pred             EEEEECCCCCCHHHHHHHHhccc
Confidence            68999999999999999998653


No 371
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.99  E-value=0.34  Score=44.05  Aligned_cols=24  Identities=29%  Similarity=0.306  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|++.+
T Consensus        34 e~~~l~G~nGsGKSTLlk~l~Gl~   57 (259)
T PRK14260         34 KVTAIIGPSGCGKSTFIKTLNRIS   57 (259)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhhc
Confidence            378899999999999999998764


No 372
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit. The gene pair cydCD encodes an ABC-family transporter in which each gene contains an N-terminal membrane-spanning domain (pfam00664) and a C-terminal ATP-binding domain (pfam00005). In E. coli these genes were discovered as mutants which caused the terminal heme-copper oxidase complex cytochrome bd to fail to assemble. Recent work has shown that the transporter is involved in export of redox-active thiol compounds such as cysteine and glutathione. The linkage to assembly of the cytochrome bd complex is further supported by the conserved operon structure found outside the gammaproteobacteria (cydABCD) containing both the transporter and oxidase genes components. The genes used as the seed members for this model are all either found in the gammproteobacterial context or the CydABCD context. All members of this family scoring above trusted at the time of its creation were from genomes which encode a cytochrome bd complex.
Probab=88.96  E-value=0.28  Score=49.00  Aligned_cols=24  Identities=33%  Similarity=0.376  Sum_probs=20.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -.|+|+|+.++|||+|+|.|++..
T Consensus       362 ~~vaIvG~SGsGKSTLl~lL~g~~  385 (529)
T TIGR02868       362 ERVAILGPSGSGKSTLLMLLTGLL  385 (529)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            356788999999999999998764


No 373
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional
Probab=88.95  E-value=0.28  Score=44.84  Aligned_cols=24  Identities=38%  Similarity=0.386  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        34 e~~~i~G~nGsGKSTLl~~i~G~~   57 (265)
T PRK10253         34 HFTAIIGPNGCGKSTLLRTLSRLM   57 (265)
T ss_pred             CEEEEECCCCCCHHHHHHHHcCCC
Confidence            378999999999999999997653


No 374
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional
Probab=88.93  E-value=0.29  Score=45.31  Aligned_cols=23  Identities=35%  Similarity=0.355  Sum_probs=20.9

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|++.+
T Consensus        29 ~~~l~G~nGsGKSTLl~~laG~~   51 (272)
T PRK13547         29 VTALLGRNGAGKSTLLKALAGDL   51 (272)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            78999999999999999998754


No 375
>PRK14731 coaE dephospho-CoA kinase; Provisional
Probab=88.91  E-value=0.36  Score=42.90  Aligned_cols=23  Identities=35%  Similarity=0.533  Sum_probs=20.7

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+|+|.|..+||||++++.|.+.
T Consensus         6 ~~igitG~igsGKSt~~~~l~~~   28 (208)
T PRK14731          6 FLVGVTGGIGSGKSTVCRFLAEM   28 (208)
T ss_pred             EEEEEECCCCCCHHHHHHHHHHC
Confidence            47899999999999999999763


No 376
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=88.89  E-value=0.31  Score=45.14  Aligned_cols=24  Identities=29%  Similarity=0.304  Sum_probs=21.3

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +++|+|+.++|||+|++.|.+.+.
T Consensus        35 ~~~i~G~nGaGKSTLl~~i~G~~~   58 (279)
T PRK13635         35 WVAIVGHNGSGKSTLAKLLNGLLL   58 (279)
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCC
Confidence            689999999999999999987643


No 377
>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=88.88  E-value=0.34  Score=43.31  Aligned_cols=22  Identities=27%  Similarity=0.370  Sum_probs=20.3

Q ss_pred             EEEEEecccccChhHHHHHHHH
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      .+++|+||.++|||+|++.+..
T Consensus        26 ~i~~ivGpNGaGKSTll~~i~~   47 (212)
T cd03274          26 SFSAIVGPNGSGKSNVIDSMLF   47 (212)
T ss_pred             CeEEEECCCCCCHHHHHHHHHH
Confidence            5899999999999999999973


No 378
>COG5019 CDC3 Septin family protein [Cell division and chromosome partitioning / Cytoskeleton]
Probab=88.87  E-value=1.2  Score=43.92  Aligned_cols=26  Identities=19%  Similarity=0.276  Sum_probs=20.4

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +.+.. |=++|+.++|||+++|-|+..
T Consensus        21 Gi~f~-im~~G~sG~GKttfiNtL~~~   46 (373)
T COG5019          21 GIDFT-IMVVGESGLGKTTFINTLFGT   46 (373)
T ss_pred             CCceE-EEEecCCCCchhHHHHhhhHh
Confidence            44444 457899999999999999765


No 379
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=88.85  E-value=0.2  Score=39.12  Aligned_cols=19  Identities=42%  Similarity=0.450  Sum_probs=17.0

Q ss_pred             EecccccChhHHHHHHHHh
Q psy5031          61 VAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        61 I~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+.++|||+|+|.|.+.
T Consensus         1 i~G~~gsGKstl~~~l~~~   19 (163)
T cd00880           1 LFGRTNAGKSSLLNALLGQ   19 (163)
T ss_pred             CcCCCCCCHHHHHHHHhCc
Confidence            5899999999999999765


No 380
>PRK09435 membrane ATPase/protein kinase; Provisional
Probab=88.84  E-value=0.62  Score=45.04  Aligned_cols=29  Identities=17%  Similarity=0.165  Sum_probs=25.5

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .+-.+|+|.|+.++|||+|++.|...+..
T Consensus        54 ~~~~~igi~G~~GaGKSTl~~~l~~~l~~   82 (332)
T PRK09435         54 GNALRIGITGVPGVGKSTFIEALGMHLIE   82 (332)
T ss_pred             CCcEEEEEECCCCCCHHHHHHHHHHHHHH
Confidence            45679999999999999999999988754


No 381
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.82  E-value=0.32  Score=44.30  Aligned_cols=24  Identities=33%  Similarity=0.337  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+..
T Consensus        34 e~~~I~G~nGsGKSTLl~~l~Gl~   57 (261)
T PRK14258         34 KVTAIIGPSGCGKSTFLKCLNRMN   57 (261)
T ss_pred             cEEEEECCCCCCHHHHHHHHhccc
Confidence            378899999999999999998764


No 382
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=88.81  E-value=0.32  Score=44.89  Aligned_cols=24  Identities=25%  Similarity=0.303  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|++.+
T Consensus        31 e~~~i~G~NGsGKSTLl~~l~Gl~   54 (277)
T PRK13652         31 SRIAVIGPNGAGKSTLFRHFNGIL   54 (277)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            478999999999999999998764


No 383
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=88.80  E-value=0.32  Score=44.96  Aligned_cols=25  Identities=20%  Similarity=0.230  Sum_probs=21.7

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      -+++|+|+.++|||+|++.|++.+.
T Consensus        34 e~~~i~G~nGsGKSTLl~~l~Gl~~   58 (279)
T PRK13650         34 EWLSIIGHNGSGKSTTVRLIDGLLE   58 (279)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCCC
Confidence            3689999999999999999987653


No 384
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.79  E-value=0.33  Score=44.23  Aligned_cols=24  Identities=29%  Similarity=0.296  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        43 e~~~i~G~nGsGKSTLl~~l~Gl~   66 (265)
T PRK14252         43 QVTALIGPSGCGKSTFLRCFNRMH   66 (265)
T ss_pred             cEEEEECCCCCCHHHHHHHHhccc
Confidence            378999999999999999998653


No 385
>PRK04182 cytidylate kinase; Provisional
Probab=88.74  E-value=0.41  Score=40.07  Aligned_cols=23  Identities=17%  Similarity=0.427  Sum_probs=21.0

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +|.|+|..+||||++...|...+
T Consensus         2 ~I~i~G~~GsGKstia~~la~~l   24 (180)
T PRK04182          2 IITISGPPGSGKTTVARLLAEKL   24 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHc
Confidence            68999999999999999998764


No 386
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD. Members of this protein family are ABC transporter ATP-binding subunits associated with urea transport and metabolism. This protein is found in a conserved five-gene transport operon typically found adjacent to urease genes. It was shown in Cyanobacteria that disruption leads to the loss of high-affinity urea transport activity.
Probab=88.68  E-value=0.32  Score=43.41  Aligned_cols=24  Identities=17%  Similarity=0.264  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        29 e~~~l~G~nGsGKSTLl~~l~G~~   52 (242)
T TIGR03411        29 ELRVIIGPNGAGKTTMMDVITGKT   52 (242)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998764


No 387
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=88.65  E-value=0.29  Score=40.55  Aligned_cols=21  Identities=29%  Similarity=0.194  Sum_probs=18.6

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+..+|||.|+|+++..
T Consensus         1 i~i~G~~~vGKTsli~~~~~~   21 (174)
T smart00174        1 LVVVGDGAVGKTCLLISYTTN   21 (174)
T ss_pred             CEEECCCCCCHHHHHHHHHhC
Confidence            578999999999999999754


No 388
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=88.64  E-value=0.35  Score=40.48  Aligned_cols=21  Identities=29%  Similarity=0.249  Sum_probs=18.3

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+++|+..+|||+|+|+++..
T Consensus         4 v~l~G~~g~GKTtl~~~~~~~   24 (180)
T cd04137           4 IAVLGSRSVGKSSLTVQFVEG   24 (180)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            568899999999999999753


No 389
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI. This model does not recognize the highly divergent NodI from Azorhizobium caulinodans.
Probab=88.64  E-value=0.32  Score=45.46  Aligned_cols=24  Identities=25%  Similarity=0.329  Sum_probs=21.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++++|+.++|||+||+.|++.+
T Consensus        31 e~~~l~G~NGaGKSTLl~~l~Gl~   54 (303)
T TIGR01288        31 ECFGLLGPNGAGKSTIARMLLGMI   54 (303)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            478999999999999999998764


No 390
>PF00910 RNA_helicase:  RNA helicase;  InterPro: IPR000605 Helicases have been classified in 5 superfamilies (SF1-SF5). All of the proteins bind ATP and, consequently, all of them carry the classical Walker A (phosphate-binding loop or P-loop) and Walker B (Mg2+-binding aspartic acid) motifs. Superfamily 3 consists of helicases encoded mainly by small DNA viruses and some large nucleocytoplasmic DNA viruses [, ]. Small viruses are very dependent on the host-cell machinery to replicate. SF3 helicase in small viruses is associated with an origin-binding domain. By pairing a domain that recognises the ori with a helicase, the virus can bypass the host-cell-based regulation pathway and initiate its own replication. The protein binds to the viral ori leading to origin unwinding. Cellular replication proteins are then recruited to the ori and the viral DNA is replicated. In SF3 helicases the Walker A and Walker B motifs are separated by spacers of rather uniform, and relatively short, length. In addition to the A and B motifs this family is characterised by a third motif (C) which resides between the B motif and the C terminus of the conserved region. This motif consists of an Asn residue preceded by a run of hydrophobic residues []. Several structures of SF3 helicases have been solved []. They all possess the same core alpha/beta fold, consisting of a five-stranded parallel beta sheet flanked on both sides by several alpha helices. In contrast to SF1 and SF2 helicases, which have RecA-like core folds, the strand connectivity within the alpha/beta core domain is that of AAA+ proteins []. The SF3 helicase proteins assemble into a hexameric ring. Some proteins known to contain an SF3 helicase domain are listed below:  Polyomavirus large T antigen. It initiates DNA unwinding and replication via interactions with the viral origin of replication. Papillomavirus E1 protein. An ATP-dependent DNA helicase required for initiation of viral DNA replication. Parvovirus Rep/NS1 protein, which is also required for the initiation of viral replication. Poxviridae and other large DNA viruses D5 protein. Bacteriophage DNA primase/helicase protein. Bacterial prophage DNA primase/helicase protein.   The entry represents the core alpha/beta fold of the SF3 helicase domain found predominantly in DNA viruses.; GO: 0003723 RNA binding, 0003724 RNA helicase activity
Probab=88.62  E-value=0.35  Score=38.42  Aligned_cols=24  Identities=25%  Similarity=0.128  Sum_probs=21.1

Q ss_pred             EEEecccccChhHHHHHHHHhhhh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      |-|.|+.++|||+|++.|++.+..
T Consensus         1 I~i~G~~G~GKS~l~~~l~~~l~~   24 (107)
T PF00910_consen    1 IWIYGPPGIGKSTLAKELAKDLLK   24 (107)
T ss_pred             CEEECCCCCCHHHHHHHHHHHHHH
Confidence            458999999999999999988764


No 391
>PF00071 Ras:  Ras family;  InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....
Probab=88.61  E-value=0.38  Score=39.29  Aligned_cols=21  Identities=29%  Similarity=0.379  Sum_probs=18.7

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||.|++++...
T Consensus         2 i~vvG~~~vGKtsl~~~~~~~   22 (162)
T PF00071_consen    2 IVVVGDSGVGKTSLINRLING   22 (162)
T ss_dssp             EEEEESTTSSHHHHHHHHHHS
T ss_pred             EEEECCCCCCHHHHHHHHHhh
Confidence            678999999999999999754


No 392
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism]
Probab=88.60  E-value=0.41  Score=41.83  Aligned_cols=28  Identities=21%  Similarity=0.414  Sum_probs=25.3

Q ss_pred             EEEEEEecccccChhHHHHHHHHhhhhc
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRYMNFT   83 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~l~~~   83 (281)
                      ..|++|+|...|||++|+..+.+.+...
T Consensus         2 ~~Il~ivG~k~SGKTTLie~lv~~L~~~   29 (161)
T COG1763           2 MKILGIVGYKNSGKTTLIEKLVRKLKAR   29 (161)
T ss_pred             CcEEEEEecCCCChhhHHHHHHHHHHhC
Confidence            4699999999999999999999988764


No 393
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.60  E-value=0.34  Score=44.80  Aligned_cols=24  Identities=33%  Similarity=0.369  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|.+.+
T Consensus        48 e~~~I~G~nGsGKSTLl~~l~Gl~   71 (276)
T PRK14271         48 AVTSLMGPTGSGKTTFLRTLNRMN   71 (276)
T ss_pred             cEEEEECCCCCCHHHHHHHHhccC
Confidence            468999999999999999998754


No 394
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family. Members of this protein family are found mostly in the Cyanobacteria, but also in the Planctomycetes. Cyanobacterial examples are involved in heterocyst formation, by which some fraction of members of the colony undergo a developmental change and become capable of nitrogen fixation. The DevBCA proteins are thought export of either heterocyst-specific glycolipids or an enzyme essential for formation of the laminated layer found in heterocysts.
Probab=88.58  E-value=0.35  Score=42.74  Aligned_cols=24  Identities=25%  Similarity=0.324  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        32 ~~~~I~G~nGsGKStLl~~l~G~~   55 (220)
T TIGR02982        32 EIVILTGPSGSGKTTLLTLIGGLR   55 (220)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            588999999999999999998754


No 395
>PRK08118 topology modulation protein; Reviewed
Probab=88.55  E-value=0.4  Score=41.28  Aligned_cols=24  Identities=29%  Similarity=0.267  Sum_probs=20.9

Q ss_pred             EEEecccccChhHHHHHHHHhhhh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      |.|+|+.++|||+|+..|.+.+..
T Consensus         4 I~I~G~~GsGKSTlak~L~~~l~~   27 (167)
T PRK08118          4 IILIGSGGSGKSTLARQLGEKLNI   27 (167)
T ss_pred             EEEECCCCCCHHHHHHHHHHHhCC
Confidence            788999999999999999887543


No 396
>PF05729 NACHT:  NACHT domain
Probab=88.53  E-value=0.46  Score=38.63  Aligned_cols=25  Identities=32%  Similarity=0.313  Sum_probs=22.0

Q ss_pred             EEEEecccccChhHHHHHHHHhhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      ++-|.|+.++|||.+|..+...+..
T Consensus         2 ~l~I~G~~G~GKStll~~~~~~~~~   26 (166)
T PF05729_consen    2 VLWISGEPGSGKSTLLRKLAQQLAE   26 (166)
T ss_pred             EEEEECCCCCChHHHHHHHHHHHHh
Confidence            6789999999999999999987654


No 397
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.53  E-value=0.35  Score=44.96  Aligned_cols=23  Identities=30%  Similarity=0.342  Sum_probs=20.6

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+||+.|.+.
T Consensus        66 e~~~l~G~nGsGKSTLl~~L~Gl   88 (286)
T PRK14275         66 YVTAIIGPSGCGKSTFLRAINRM   88 (286)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcc
Confidence            37899999999999999999874


No 398
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=88.51  E-value=0.33  Score=46.16  Aligned_cols=24  Identities=21%  Similarity=0.257  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        53 e~~~I~G~nGsGKSTLl~~L~Gl~   76 (320)
T PRK13631         53 KIYFIIGNSGSGKSTLVTHFNGLI   76 (320)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998764


No 399
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=88.50  E-value=0.37  Score=39.93  Aligned_cols=21  Identities=29%  Similarity=0.165  Sum_probs=18.5

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||.|+|++...
T Consensus         3 i~i~G~~~~GKTsl~~~~~~~   23 (174)
T cd04135           3 CVVVGDGAVGKTCLLMSYAND   23 (174)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678999999999999999754


No 400
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=88.49  E-value=0.32  Score=39.56  Aligned_cols=20  Identities=25%  Similarity=0.353  Sum_probs=17.9

Q ss_pred             EEEecccccChhHHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~   78 (281)
                      |.++|+.++|||.|+|+|..
T Consensus         2 i~~vG~~~~GKTsl~~~l~~   21 (162)
T cd04157           2 ILVVGLDNSGKTTIINQLKP   21 (162)
T ss_pred             EEEECCCCCCHHHHHHHHcc
Confidence            57889999999999999964


No 401
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR).  DR is a well-described phenomenon occurring in fungi and shares several similarities with processes in bacteria and higher eukaryotes.  Compared to other members of the ABC transporter subfamilies, the ABCG transporter family is composed of proteins that have an ATP-binding cassette domain at the N-terminus and a TM (transmembrane) domain at the C-terminus.
Probab=88.47  E-value=0.34  Score=42.25  Aligned_cols=24  Identities=29%  Similarity=0.308  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|++.+
T Consensus        36 e~~~l~G~nGsGKStLl~~i~Gl~   59 (194)
T cd03213          36 ELTAIMGPSGAGKSTLLNALAGRR   59 (194)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            378899999999999999998653


No 402
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.47  E-value=0.35  Score=44.97  Aligned_cols=24  Identities=29%  Similarity=0.292  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|++.+
T Consensus        66 e~~~I~G~nGsGKSTLl~~l~Gl~   89 (285)
T PRK14254         66 QVTAMIGPSGCGKSTFLRCINRMN   89 (285)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccC
Confidence            378999999999999999998764


No 403
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional
Probab=88.44  E-value=0.33  Score=46.51  Aligned_cols=24  Identities=29%  Similarity=0.282  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|++.+
T Consensus        32 ei~~iiG~nGsGKSTLlk~L~Gl~   55 (343)
T PRK11153         32 EIFGVIGASGAGKSTLIRCINLLE   55 (343)
T ss_pred             CEEEEECCCCCcHHHHHHHHhCCC
Confidence            478899999999999999998764


No 404
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=88.39  E-value=0.34  Score=44.64  Aligned_cols=25  Identities=28%  Similarity=0.151  Sum_probs=21.7

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      -+++|+|+.++|||+|++.|.+.+.
T Consensus        32 e~~~i~G~nGsGKSTLl~~l~Gl~~   56 (274)
T PRK13647         32 SKTALLGPNGAGKSTLLLHLNGIYL   56 (274)
T ss_pred             CEEEEECCCCCcHHHHHHHHhcCCC
Confidence            4788999999999999999987643


No 405
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional
Probab=88.36  E-value=0.35  Score=43.81  Aligned_cols=24  Identities=25%  Similarity=0.308  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+.+
T Consensus        30 e~~~l~G~nGsGKSTLl~~l~Gl~   53 (254)
T PRK10418         30 RVLALVGGSGSGKSLTCAAALGIL   53 (254)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378899999999999999998764


No 406
>PRK03695 vitamin B12-transporter ATPase; Provisional
Probab=88.35  E-value=0.31  Score=44.15  Aligned_cols=23  Identities=26%  Similarity=0.320  Sum_probs=20.7

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+++|+|+.++|||+|++.|.+.
T Consensus        23 ei~~l~G~nGsGKSTLl~~l~Gl   45 (248)
T PRK03695         23 EILHLVGPNGAGKSTLLARMAGL   45 (248)
T ss_pred             CEEEEECCCCCCHHHHHHHHcCC
Confidence            48999999999999999999765


No 407
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein. This small clade of ABC-type transporter ATP-binding protein components is found as a three gene cassette along with a periplasmic substrate-binding protein (TIGR03868) and a permease (TIGR03869). The organisms containing this cassette are all Actinobacteria and all contain numerous genes requiring the coenzyme F420. This model was defined based on five such organisms, four of which are lacking all F420 biosynthetic capability save the final side-chain polyglutamate attachment step (via the gene cofE: TIGR01916). In Jonesia denitrificans DSM 20603 and marine actinobacterium PHSC20C1 this cassette is in an apparent operon with the cofE gene and, in PHSC20C1, also with a F420-dependent glucose-6-phosphate dehydrogenase (TIGR03554). Based on these observations we propose that this ATP-binding protein is a component of an F420-0 (that is, F420 lacking only the polyglutamate tail) transporter.
Probab=88.34  E-value=0.33  Score=43.94  Aligned_cols=24  Identities=29%  Similarity=0.371  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+.+
T Consensus        28 e~~~i~G~nGsGKSTLl~~i~G~~   51 (256)
T TIGR03873        28 SLTGLLGPNGSGKSTLLRLLAGAL   51 (256)
T ss_pred             cEEEEECCCCCCHHHHHHHHcCCC
Confidence            378899999999999999998754


No 408
>PRK04213 GTP-binding protein; Provisional
Probab=88.34  E-value=0.33  Score=41.70  Aligned_cols=23  Identities=26%  Similarity=0.173  Sum_probs=20.0

Q ss_pred             EEEEEEecccccChhHHHHHHHH
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      ..-|.++|...+|||+|+|+|..
T Consensus         9 ~~~i~i~G~~~~GKSsLin~l~~   31 (201)
T PRK04213          9 KPEIVFVGRSNVGKSTLVRELTG   31 (201)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhC
Confidence            44688999999999999999964


No 409
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=88.33  E-value=0.35  Score=44.96  Aligned_cols=24  Identities=29%  Similarity=0.398  Sum_probs=21.4

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +++|+|+.++|||+|++.|++.+.
T Consensus        35 ~~~i~G~nGaGKSTLl~~l~Gl~~   58 (287)
T PRK13637         35 FVGLIGHTGSGKSTLIQHLNGLLK   58 (287)
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCC
Confidence            789999999999999999987653


No 410
>PRK14236 phosphate transporter ATP-binding protein; Provisional
Probab=88.28  E-value=0.39  Score=44.08  Aligned_cols=24  Identities=33%  Similarity=0.281  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        52 e~~~I~G~nGsGKSTLl~~laGl~   75 (272)
T PRK14236         52 RVTAFIGPSGCGKSTLLRCFNRMN   75 (272)
T ss_pred             CEEEEECCCCCCHHHHHHHHHhcC
Confidence            478999999999999999998764


No 411
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional
Probab=88.22  E-value=0.36  Score=44.10  Aligned_cols=23  Identities=35%  Similarity=0.520  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+..
T Consensus        38 ~~~i~G~nGsGKSTLl~~iaG~~   60 (257)
T PRK14246         38 IFGIMGPSGSGKSTLLKVLNRLI   60 (257)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            78999999999999999998764


No 412
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=88.21  E-value=0.37  Score=44.45  Aligned_cols=24  Identities=25%  Similarity=0.238  Sum_probs=21.1

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +++|+|+.++|||+|++.|++.+.
T Consensus        35 ~~~I~G~nGsGKSTLl~~l~Gl~~   58 (277)
T PRK13642         35 WVSIIGQNGSGKSTTARLIDGLFE   58 (277)
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCC
Confidence            689999999999999999987643


No 413
>cd04166 CysN_ATPS CysN_ATPS subfamily.  CysN, together with protein CysD, form the ATP sulfurylase (ATPS) complex in some bacteria and lower eukaryotes.  ATPS catalyzes the production of ATP sulfurylase (APS) and pyrophosphate (PPi) from ATP and sulfate.  CysD, which catalyzes ATP hydrolysis, is a member of the ATP pyrophosphatase (ATP PPase) family.  CysN hydrolysis of GTP is required for CysD hydrolysis of ATP; however, CysN hydrolysis of GTP is not dependent on CysD hydrolysis of ATP.  CysN is an example of lateral gene transfer followed by acquisition of new function.  In many organisms, an ATPS exists which is not GTP-dependent and shares no sequence or structural similarity to CysN.
Probab=88.20  E-value=0.36  Score=42.48  Aligned_cols=21  Identities=33%  Similarity=0.373  Sum_probs=19.2

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|...+|||+|+|+|+..
T Consensus         2 i~iiG~~~~GKStL~~~Ll~~   22 (208)
T cd04166           2 FLTCGSVDDGKSTLIGRLLYD   22 (208)
T ss_pred             EEEEECCCCCHHHHHHHHHHH
Confidence            789999999999999999865


No 414
>cd03288 ABCC_SUR2 The SUR domain 2.  The sulfonylurea receptor SUR is an ATP binding cassette (ABC) protein of the ABCC/MRP family.  Unlike other ABC proteins, it has no intrinsic transport function, neither active nor passive, but associates with the potassium channel proteins Kir6.1 or Kir6.2 to form the ATP-sensitive potassium (K(ATP)) channel.  Within the channel complex, SUR serves as a regulatory subunit that fine-tunes the gating of Kir6.x in response to alterations in cellular metabolism.  It constitutes a major pharmaceutical target as it binds numerous drugs, K(ATP) channel openers and blockers, capable of up- or down-regulating channel activity.
Probab=88.13  E-value=0.4  Score=43.62  Aligned_cols=23  Identities=30%  Similarity=0.342  Sum_probs=20.9

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|++..
T Consensus        49 ~~~i~G~nGsGKSTLl~~l~Gl~   71 (257)
T cd03288          49 KVGICGRTGSGKSSLSLAFFRMV   71 (257)
T ss_pred             EEEEECCCCCCHHHHHHHHHccc
Confidence            78999999999999999998764


No 415
>TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily. Members of this protein are marked as probable ATPases by the nucleotide binding P-loop motif GXXGXGKTT, a motif DEAQ similar to the DEAD/H box of helicases, and extensive homology to ATPases of MSHA-type pilus systems and to GspA proteins associated with type II protein secretion systems.
Probab=88.08  E-value=0.44  Score=42.82  Aligned_cols=25  Identities=24%  Similarity=0.444  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .++.|.|+.++|||+|++.+++.+.
T Consensus        44 ~~~~l~G~~G~GKTtl~~~l~~~l~   68 (269)
T TIGR03015        44 GFILITGEVGAGKTTLIRNLLKRLD   68 (269)
T ss_pred             CEEEEEcCCCCCHHHHHHHHHHhcC
Confidence            3577899999999999999987753


No 416
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=88.06  E-value=0.38  Score=38.47  Aligned_cols=22  Identities=36%  Similarity=0.335  Sum_probs=19.2

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -|+++|+..+|||+|+|++...
T Consensus         3 ~i~l~G~~~~GKstli~~l~~~   24 (157)
T cd04164           3 KVVIVGKPNVGKSSLLNALAGR   24 (157)
T ss_pred             EEEEECCCCCCHHHHHHHHHCC
Confidence            3789999999999999999754


No 417
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=87.95  E-value=0.42  Score=40.39  Aligned_cols=21  Identities=29%  Similarity=0.210  Sum_probs=18.9

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+..+|||.|+|++++.
T Consensus         3 i~vvG~~~vGKTsli~~l~~~   23 (187)
T cd04132           3 IVVVGDGGCGKTCLLIVYSQG   23 (187)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678999999999999999754


No 418
>KOG0410|consensus
Probab=87.95  E-value=0.32  Score=47.61  Aligned_cols=27  Identities=30%  Similarity=0.407  Sum_probs=24.6

Q ss_pred             CCceEEEEEEecccccChhHHHHHHHH
Q psy5031          52 KDKHVVVVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        52 ~~~pVaVVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      .+.+..||||+|...+|||+|+|+|-.
T Consensus       174 ~~~s~pviavVGYTNaGKsTLikaLT~  200 (410)
T KOG0410|consen  174 EGESSPVIAVVGYTNAGKSTLIKALTK  200 (410)
T ss_pred             ccCCCceEEEEeecCccHHHHHHHHHh
Confidence            367899999999999999999999974


No 419
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=87.86  E-value=0.41  Score=39.72  Aligned_cols=21  Identities=24%  Similarity=0.260  Sum_probs=18.5

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+..+|||.|+++++..
T Consensus         4 i~iiG~~~~GKTsl~~~~~~~   24 (175)
T cd01870           4 LVIVGDGACGKTCLLIVFSKD   24 (175)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            678899999999999999754


No 420
>PRK04040 adenylate kinase; Provisional
Probab=87.85  E-value=0.49  Score=41.69  Aligned_cols=23  Identities=35%  Similarity=0.403  Sum_probs=21.3

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +|.|+|..++|||++++.|.+.+
T Consensus         4 ~i~v~G~pG~GKtt~~~~l~~~l   26 (188)
T PRK04040          4 VVVVTGVPGVGKTTVLNKALEKL   26 (188)
T ss_pred             EEEEEeCCCCCHHHHHHHHHHHh
Confidence            78899999999999999998876


No 421
>cd02027 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyzes the phosphorylation of adenosine 5'-phosphosulfate to form 3'-phosphoadenosine 5'-phosphosulfate (PAPS). The end-product PAPS is a biologically "activated" sulfate form important for the assimilation of inorganic sulfate.
Probab=87.84  E-value=0.44  Score=40.10  Aligned_cols=24  Identities=25%  Similarity=0.214  Sum_probs=21.6

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ||.|+|..+||||+|+..|.+.+.
T Consensus         1 ~i~i~G~~GsGKSTla~~L~~~l~   24 (149)
T cd02027           1 VIWLTGLSGSGKSTIARALEEKLF   24 (149)
T ss_pred             CEEEEcCCCCCHHHHHHHHHHHHH
Confidence            578999999999999999998864


No 422
>TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family. This subfamily of the adenylate kinase superfamily contains examples of UMP-CMP kinase, as well as others proteins with unknown specificity, some currently designated adenylate kinase. All known members are eukaryotic.
Probab=87.84  E-value=0.42  Score=40.57  Aligned_cols=23  Identities=26%  Similarity=0.221  Sum_probs=20.9

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      ||-|+|+.+||||++...|...+
T Consensus         1 ~i~i~G~pGsGKst~a~~la~~~   23 (183)
T TIGR01359         1 VVFVLGGPGSGKGTQCAKIVENF   23 (183)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHc
Confidence            57899999999999999998864


No 423
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=87.84  E-value=0.44  Score=39.15  Aligned_cols=22  Identities=27%  Similarity=0.143  Sum_probs=18.9

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -|.++|...+|||+|+|+++..
T Consensus         3 ki~~~G~~~~GKTsli~~~~~~   24 (164)
T cd04175           3 KLVVLGSGGVGKSALTVQFVQG   24 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHhC
Confidence            4678899999999999999743


No 424
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=87.82  E-value=0.42  Score=40.68  Aligned_cols=21  Identities=33%  Similarity=0.417  Sum_probs=18.8

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|+.++|||.|+|+++..
T Consensus         3 i~v~G~~~vGKSsli~~~~~~   23 (188)
T cd04125           3 VVIIGDYGVGKSSLLKRFTED   23 (188)
T ss_pred             EEEECCCCCCHHHHHHHHhcC
Confidence            788999999999999999754


No 425
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2. The enzyme that catalyzes the final step in methanogenesis, methyl coenzyme M reductase, contains alpha, beta, and gamma chains. In older literature, the complex of alpha, beta, and gamma chains was termed component C, while this single chain protein was termed methyl coenzyme M reductase system component A2.
Probab=87.80  E-value=0.4  Score=48.00  Aligned_cols=24  Identities=29%  Similarity=0.340  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|++.+
T Consensus        27 e~~~iiG~nGsGKSTLl~~l~Gl~   50 (520)
T TIGR03269        27 EVLGILGRSGAGKSVLMHVLRGMD   50 (520)
T ss_pred             CEEEEECCCCCCHHHHHHHHhhcc
Confidence            368899999999999999999864


No 426
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.73  E-value=0.43  Score=43.69  Aligned_cols=24  Identities=29%  Similarity=0.238  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+|++.|.+.+
T Consensus        35 e~~~i~G~nGsGKSTLl~~l~Gl~   58 (261)
T PRK14263         35 EITGFIGPSGCGKSTVLRSLNRMN   58 (261)
T ss_pred             CEEEEECCCCCCHHHHHHHHHccc
Confidence            478899999999999999998764


No 427
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]
Probab=87.73  E-value=0.37  Score=48.70  Aligned_cols=25  Identities=36%  Similarity=0.523  Sum_probs=21.2

Q ss_pred             EEEEecccccChhHHHHHHHHhhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .|+|+|+.++|||+|+|.|+++...
T Consensus       357 ~vaiVG~sGsGKSTl~~LL~r~~~~  381 (567)
T COG1132         357 KVAIVGPSGSGKSTLIKLLLRLYDP  381 (567)
T ss_pred             EEEEECCCCCCHHHHHHHHhccCCC
Confidence            4558899999999999999998543


No 428
>PRK05541 adenylylsulfate kinase; Provisional
Probab=87.73  E-value=0.53  Score=40.01  Aligned_cols=25  Identities=20%  Similarity=0.309  Sum_probs=22.5

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .+|.++|+.++|||++++.|.+.+.
T Consensus         8 ~~I~i~G~~GsGKst~a~~l~~~l~   32 (176)
T PRK05541          8 YVIWITGLAGSGKTTIAKALYERLK   32 (176)
T ss_pred             CEEEEEcCCCCCHHHHHHHHHHHHH
Confidence            3888999999999999999998875


No 429
>cd01889 SelB_euk SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner.  This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and euk
Probab=87.73  E-value=0.42  Score=41.07  Aligned_cols=21  Identities=33%  Similarity=0.363  Sum_probs=19.1

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|...+|||+|+|+|.+.
T Consensus         3 i~i~G~~~~GKstLi~~l~~~   23 (192)
T cd01889           3 VGVLGHVDSGKTSLAKALSEI   23 (192)
T ss_pred             EEEEecCCCCHHHHHHHHHhc
Confidence            789999999999999999863


No 430
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.73  E-value=0.4  Score=44.64  Aligned_cols=25  Identities=32%  Similarity=0.394  Sum_probs=21.8

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      -+++|+|+.++|||+|++.|++.+.
T Consensus        34 e~~~i~G~nGsGKSTLl~~l~Gl~~   58 (290)
T PRK13634         34 SYVAIIGHTGSGKSTLLQHLNGLLQ   58 (290)
T ss_pred             CEEEEECCCCCcHHHHHHHHhcCCC
Confidence            3789999999999999999987643


No 431
>PRK10218 GTP-binding protein; Provisional
Probab=87.67  E-value=2.5  Score=44.05  Aligned_cols=24  Identities=25%  Similarity=0.394  Sum_probs=20.9

Q ss_pred             EEEEEEecccccChhHHHHHHHHh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |--|+|+|...+|||+|+++|+..
T Consensus         5 iRnIaIiGh~d~GKTTLv~~Ll~~   28 (607)
T PRK10218          5 LRNIAIIAHVDHGKTTLVDKLLQQ   28 (607)
T ss_pred             ceEEEEECCCCCcHHHHHHHHHHh
Confidence            556889999999999999999864


No 432
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.66  E-value=0.41  Score=45.78  Aligned_cols=24  Identities=29%  Similarity=0.212  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|++..
T Consensus       109 e~v~IvG~~GsGKSTLl~~L~g~~  132 (329)
T PRK14257        109 KVTAFIGPSGCGKSTFLRNLNQLN  132 (329)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccc
Confidence            468899999999999999998764


No 433
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional
Probab=87.65  E-value=0.38  Score=47.73  Aligned_cols=25  Identities=28%  Similarity=0.145  Sum_probs=21.7

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .+++|+|+.++|||+||+.|.+.+.
T Consensus        30 e~~~liG~nGsGKSTLl~~l~G~~~   54 (490)
T PRK10938         30 DSWAFVGANGSGKSALARALAGELP   54 (490)
T ss_pred             CEEEEECCCCCCHHHHHHHHhccCC
Confidence            4689999999999999999987653


No 434
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=87.65  E-value=0.38  Score=41.58  Aligned_cols=25  Identities=28%  Similarity=0.190  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .-|.|+|+.++|||+|+|+|.+...
T Consensus         6 ~kivv~G~~g~GKTtl~~~l~~~~~   30 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLNRLVGDEF   30 (219)
T ss_pred             EEEEEEcCCCccHHHHHHHHhcCcC
Confidence            5677889999999999999987643


No 435
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional
Probab=87.63  E-value=0.42  Score=44.85  Aligned_cols=23  Identities=35%  Similarity=0.346  Sum_probs=20.8

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|++.+
T Consensus        73 ~~~IvG~nGsGKSTLl~~L~Gl~   95 (305)
T PRK14264         73 VTALIGPSGCGKSTFLRCLNRMN   95 (305)
T ss_pred             EEEEECCCCCCHHHHHHHHhccc
Confidence            78899999999999999998764


No 436
>PRK05433 GTP-binding protein LepA; Provisional
Probab=87.57  E-value=1.9  Score=44.71  Aligned_cols=24  Identities=29%  Similarity=0.360  Sum_probs=19.9

Q ss_pred             EEEEEEecccccChhHHHHHHHHh
Q psy5031          56 VVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        56 VaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |-=|+|+|....|||+|+++|+..
T Consensus         7 iRNi~IiGhvd~GKTTL~~rLl~~   30 (600)
T PRK05433          7 IRNFSIIAHIDHGKSTLADRLIEL   30 (600)
T ss_pred             CCEEEEECCCCCCHHHHHHHHHHh
Confidence            334678899999999999999865


No 437
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=87.56  E-value=0.45  Score=44.35  Aligned_cols=23  Identities=39%  Similarity=0.505  Sum_probs=20.9

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|.+.+
T Consensus        32 ~~~IvG~nGsGKSTLl~~L~gl~   54 (275)
T cd03289          32 RVGLLGRTGSGKSTLLSAFLRLL   54 (275)
T ss_pred             EEEEECCCCCCHHHHHHHHhhhc
Confidence            68899999999999999998875


No 438
>cd04129 Rho2 Rho2 subfamily.  Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction.  Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase.  Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall.  Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for proper intracellular localization via membrane attachment.  As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).
Probab=87.52  E-value=0.45  Score=40.72  Aligned_cols=21  Identities=24%  Similarity=0.249  Sum_probs=18.5

Q ss_pred             EEEEecccccChhHHHHHHHH
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      -|+|+|+.++|||+|+|++..
T Consensus         3 Ki~ivG~~g~GKStLl~~l~~   23 (187)
T cd04129           3 KLVIVGDGACGKTSLLSVFTL   23 (187)
T ss_pred             EEEEECCCCCCHHHHHHHHHh
Confidence            468899999999999999974


No 439
>PLN03108 Rab family protein; Provisional
Probab=87.52  E-value=0.45  Score=41.84  Aligned_cols=23  Identities=26%  Similarity=0.148  Sum_probs=19.7

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .=|.|+|+.++|||+|+|+|+..
T Consensus         7 ~kivivG~~gvGKStLi~~l~~~   29 (210)
T PLN03108          7 FKYIIIGDTGVGKSCLLLQFTDK   29 (210)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhC
Confidence            44678899999999999999754


No 440
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional
Probab=87.50  E-value=0.43  Score=45.44  Aligned_cols=23  Identities=17%  Similarity=0.273  Sum_probs=20.9

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|++.+
T Consensus        35 ~~~ivG~sGsGKSTLl~~i~Gl~   57 (330)
T PRK15093         35 IRGLVGESGSGKSLIAKAICGVT   57 (330)
T ss_pred             EEEEECCCCCCHHHHHHHHHccC
Confidence            68999999999999999998764


No 441
>PF00437 T2SE:  Type II/IV secretion system protein;  InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ]. These proteins are probably located in the cytoplasm and, on the basis of the presence of a conserved P-loop region IPR001687 from INTERPRO, bind ATP.; GO: 0005524 ATP binding, 0006810 transport, 0005622 intracellular; PDB: 1NLZ_C 2PT7_B 1OPX_A 1NLY_A 1G6O_B 2OAQ_2 2OAP_1 2JNQ_A 2JMZ_A 2GZA_B ....
Probab=87.46  E-value=0.54  Score=42.84  Aligned_cols=26  Identities=27%  Similarity=0.309  Sum_probs=22.6

Q ss_pred             EEEEEecccccChhHHHHHHHHhhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      ..|-|+|+.+||||++|+.+++++..
T Consensus       128 ~~ili~G~tGSGKTT~l~all~~i~~  153 (270)
T PF00437_consen  128 GNILISGPTGSGKTTLLNALLEEIPP  153 (270)
T ss_dssp             EEEEEEESTTSSHHHHHHHHHHHCHT
T ss_pred             eEEEEECCCccccchHHHHHhhhccc
Confidence            56778999999999999999998654


No 442
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional
Probab=87.44  E-value=0.42  Score=45.54  Aligned_cols=24  Identities=25%  Similarity=0.281  Sum_probs=21.5

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|++.+
T Consensus        34 e~~~lvG~sGsGKSTL~~~l~Gll   57 (326)
T PRK11022         34 EVVGIVGESGSGKSVSSLAIMGLI   57 (326)
T ss_pred             CEEEEECCCCChHHHHHHHHHcCC
Confidence            378999999999999999998865


No 443
>PRK00049 elongation factor Tu; Reviewed
Probab=87.43  E-value=1.8  Score=42.37  Aligned_cols=27  Identities=26%  Similarity=0.283  Sum_probs=23.9

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+|..-|+|+|...+|||+|+++|+..
T Consensus         9 ~~~~~ni~iiGhvd~GKSTL~~~L~~~   35 (396)
T PRK00049          9 TKPHVNVGTIGHVDHGKTTLTAAITKV   35 (396)
T ss_pred             CCCEEEEEEEeECCCCHHHHHHHHHHh
Confidence            467778999999999999999999864


No 444
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional
Probab=87.41  E-value=0.42  Score=44.15  Aligned_cols=23  Identities=26%  Similarity=0.346  Sum_probs=20.5

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|++.+
T Consensus        52 ~~~liG~NGsGKSTLlk~L~Gl~   74 (264)
T PRK13546         52 VIGLVGINGSGKSTLSNIIGGSL   74 (264)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCc
Confidence            68899999999999999998754


No 445
>cd01892 Miro2 Miro2 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the putative GTPase domain in the C terminus of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=87.40  E-value=0.61  Score=39.32  Aligned_cols=26  Identities=38%  Similarity=0.407  Sum_probs=22.8

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +++.-|.++|..++|||.|+++++..
T Consensus         2 ~~~~kv~~vG~~~vGKTsli~~~~~~   27 (169)
T cd01892           2 RNVFLCFVLGAKGSGKSALLRAFLGR   27 (169)
T ss_pred             CeEEEEEEECCCCCcHHHHHHHHhCC
Confidence            46888999999999999999999753


No 446
>PLN03127 Elongation factor Tu; Provisional
Probab=87.40  E-value=2.7  Score=42.04  Aligned_cols=29  Identities=24%  Similarity=0.327  Sum_probs=25.2

Q ss_pred             CCceEEEEEEecccccChhHHHHHHHHhh
Q psy5031          52 KDKHVVVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        52 ~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      ..+|.--|+|+|-.-+|||+|+++|..+.
T Consensus        57 ~~k~~~ni~iiGhvd~GKSTL~~~L~~~~   85 (447)
T PLN03127         57 RTKPHVNVGTIGHVDHGKTTLTAAITKVL   85 (447)
T ss_pred             cCCceEEEEEECcCCCCHHHHHHHHHhHH
Confidence            36778889999999999999999997653


No 447
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]
Probab=87.40  E-value=0.44  Score=44.67  Aligned_cols=44  Identities=27%  Similarity=0.342  Sum_probs=30.2

Q ss_pred             eEEeCH-HHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          34 KFILDY-EALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        34 ~l~ln~-eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .+..+. .||+.|-..  +.. . .+++|+||.++|||+|+..++.-+.
T Consensus        11 ~v~y~~~~vl~~i~l~--v~~-G-~~~~iiGPNGaGKSTLlK~iLGll~   55 (254)
T COG1121          11 TVSYGNRPVLEDISLS--VEK-G-EITALIGPNGAGKSTLLKAILGLLK   55 (254)
T ss_pred             EEEECCEeeeeccEEE--EcC-C-cEEEEECCCCCCHHHHHHHHhCCCc
Confidence            444442 366654331  212 2 6899999999999999999998654


No 448
>cd01673 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phosphorylation of deoxyribonucleosides to yield corresponding monophosphates (dNMPs). This family consists of various deoxynucleoside kinases including deoxyribo- cytidine (EC 2.7.1.74), guanosine (EC 2.7.1.113), adenosine (EC 2.7.1.76), and thymidine (EC 2.7.1.21) kinases. They are key enzymes in the salvage of deoxyribonucleosides originating from extra- or intracellular breakdown of DNA.
Probab=87.38  E-value=0.47  Score=40.82  Aligned_cols=23  Identities=35%  Similarity=0.404  Sum_probs=20.7

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +|+|.|.-++|||++++.|.+++
T Consensus         1 ~I~ieG~~GsGKSTl~~~L~~~~   23 (193)
T cd01673           1 VIVVEGNIGAGKSTLAKELAEHL   23 (193)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHh
Confidence            58899999999999999998874


No 449
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein.
Probab=87.32  E-value=0.46  Score=42.59  Aligned_cols=24  Identities=29%  Similarity=0.365  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+.+
T Consensus        27 e~~~l~G~nGsGKSTLl~~i~G~~   50 (237)
T TIGR00968        27 SLVALLGPSGSGKSTLLRIIAGLE   50 (237)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            378999999999999999998764


No 450
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1.  The cystic fibrosis transmembrane regulator (CFTR), the product of the gene mutated in patients with cystic fibrosis, has adapted the ABC transporter structural motif to form a tightly regulated anion channel at the apical surface of many epithelia.  Use of the term assembly of a functional ion channel implies the coming together of subunits, or at least smaller not-yet functional components of the active whole.  In fact, on the basis of current knowledge only the CFTR polypeptide itself is required to form an ATP- and protein kinase A-dependent low-conductance chloride channel of the type present in the apical membrane of many epithelial cells.  CFTR displays the typical organization (IM-ABC)2 and carries a characteristic hydrophilic R-domain that separates IM1-ABC1 from IM2-ABC2.
Probab=87.19  E-value=0.45  Score=44.53  Aligned_cols=24  Identities=25%  Similarity=0.450  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|++.+
T Consensus        64 e~~~liG~NGsGKSTLl~~I~Gl~   87 (282)
T cd03291          64 EMLAITGSTGSGKTSLLMLILGEL   87 (282)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998753


No 451
>cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP).  It is responsible for the export the majority of Gram-negative bacterial exoenzymes and toxins. PulE is a cytoplasmic protein of the GSP, which contains an ATP binding site and a tetracysteine motif. This subgroup also includes PillB and HofB.
Probab=87.19  E-value=0.47  Score=44.06  Aligned_cols=45  Identities=29%  Similarity=0.232  Sum_probs=30.8

Q ss_pred             eEEeCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          34 KFILDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        34 ~l~ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      ++-+.++-++.+..   ....+=.+|-|+|+.+||||++|+.+++++.
T Consensus        61 ~lg~~~~~~~~l~~---~~~~~~GlilisG~tGSGKTT~l~all~~i~  105 (264)
T cd01129          61 KLGLKPENLEIFRK---LLEKPHGIILVTGPTGSGKTTTLYSALSELN  105 (264)
T ss_pred             HcCCCHHHHHHHHH---HHhcCCCEEEEECCCCCcHHHHHHHHHhhhC
Confidence            34455555554432   1233446789999999999999999988753


No 452
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional
Probab=87.18  E-value=0.43  Score=46.25  Aligned_cols=24  Identities=29%  Similarity=0.263  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|++.+
T Consensus        30 e~~~l~G~nGsGKSTLL~~iaGl~   53 (369)
T PRK11000         30 EFVVFVGPSGCGKSTLLRMIAGLE   53 (369)
T ss_pred             CEEEEECCCCCcHHHHHHHHhCCC
Confidence            368999999999999999998764


No 453
>PRK15467 ethanolamine utilization protein EutP; Provisional
Probab=87.18  E-value=0.39  Score=40.51  Aligned_cols=20  Identities=30%  Similarity=0.476  Sum_probs=18.2

Q ss_pred             EEEecccccChhHHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~   78 (281)
                      |.++|..++|||+|+|.|.+
T Consensus         4 i~~iG~~~~GKstl~~~l~~   23 (158)
T PRK15467          4 IAFVGAVGAGKTTLFNALQG   23 (158)
T ss_pred             EEEECCCCCCHHHHHHHHcC
Confidence            78899999999999999864


No 454
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=87.14  E-value=0.5  Score=40.67  Aligned_cols=22  Identities=45%  Similarity=0.495  Sum_probs=19.4

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+.++|...+|||+|+|.|+..
T Consensus       129 ~~~~~G~~nvGKStliN~l~~~  150 (190)
T cd01855         129 DVYVVGATNVGKSTLINALLKK  150 (190)
T ss_pred             cEEEEcCCCCCHHHHHHHHHHh
Confidence            4678899999999999999875


No 455
>PRK13633 cobalt transporter ATP-binding subunit; Provisional
Probab=87.11  E-value=0.45  Score=43.93  Aligned_cols=24  Identities=17%  Similarity=0.221  Sum_probs=21.3

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +++|+|+.++|||+|++.|.+.+.
T Consensus        38 ~~~l~G~nGsGKSTLl~~l~Gl~~   61 (280)
T PRK13633         38 FLVILGRNGSGKSTIAKHMNALLI   61 (280)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCC
Confidence            789999999999999999987643


No 456
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=87.06  E-value=0.52  Score=39.19  Aligned_cols=21  Identities=33%  Similarity=0.259  Sum_probs=18.8

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.++|+.++|||.|+|++.+.
T Consensus         4 i~liG~~~~GKTsli~~~~~~   24 (168)
T cd04177           4 IVVLGAGGVGKSALTVQFVQN   24 (168)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            688999999999999999754


No 457
>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=87.04  E-value=0.48  Score=42.24  Aligned_cols=20  Identities=25%  Similarity=0.189  Sum_probs=19.0

Q ss_pred             EEEEecccccChhHHHHHHH
Q psy5031          58 VVSVAGAFRKGKSFLLDFLL   77 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll   77 (281)
                      +++|+||.++|||+||..|.
T Consensus        25 ~~~i~GpNGsGKStll~ai~   44 (243)
T cd03272          25 HNVVVGRNGSGKSNFFAAIR   44 (243)
T ss_pred             cEEEECCCCCCHHHHHHHHH
Confidence            88899999999999999997


No 458
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=87.01  E-value=0.46  Score=43.75  Aligned_cols=23  Identities=26%  Similarity=0.304  Sum_probs=20.9

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|.+.+
T Consensus        30 ~~~l~G~nGsGKSTLl~~i~Gl~   52 (275)
T PRK13639         30 MVALLGPNGAGKSTLFLHFNGIL   52 (275)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            88999999999999999998754


No 459
>KOG2655|consensus
Probab=86.99  E-value=1.6  Score=43.03  Aligned_cols=21  Identities=29%  Similarity=0.327  Sum_probs=17.8

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +=|+|+.++|||+|+|-|...
T Consensus        24 lmvvG~sGlGKsTfiNsLf~~   44 (366)
T KOG2655|consen   24 LMVVGESGLGKSTFINSLFLT   44 (366)
T ss_pred             EEEecCCCccHHHHHHHHHhh
Confidence            457899999999999998644


No 460
>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes.  The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch.  Members of the MutS family possess C-terminal domain with a conserved ATPase activity that belongs to the ATP binding cassette (ABC) superfamily.  MutS homologs (MSH) have been identified in most prokaryotic and all eukaryotic organisms examined.  Prokaryotes have two homologs (MutS1 and MutS2), whereas seven MSH proteins (MSH1 to MSH7) have been identified in eukaryotes.  The homodimer MutS1 and heterodimers MSH2-MSH3 and MSH2-MSH6 are primarily involved in mitotic mismatch repair, whereas MSH4-MSH5 is involved in resolution of Holliday junctions during meiosis.  All members of the MutS family contain the highly conserved Walker A/B ATPase domain, and many share a common mechanism of action.  MutS1, MSH2-MSH3, MSH2-MSH6, and MSH4-MSH5 dimerize to form slid
Probab=86.86  E-value=0.52  Score=41.78  Aligned_cols=23  Identities=22%  Similarity=0.154  Sum_probs=20.7

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      -++.|.||.++|||+||+.+...
T Consensus        26 ~~~~ltGpNg~GKSTllr~i~~~   48 (199)
T cd03283          26 NGILITGSNMSGKSTFLRTIGVN   48 (199)
T ss_pred             cEEEEECCCCCChHHHHHHHHHH
Confidence            58889999999999999999754


No 461
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]
Probab=86.85  E-value=0.46  Score=43.26  Aligned_cols=29  Identities=21%  Similarity=0.203  Sum_probs=24.8

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .|=-|++|+|..+||||+||+.|...+..
T Consensus        30 ~PGeVLgiVGESGSGKtTLL~~is~rl~p   58 (258)
T COG4107          30 YPGEVLGIVGESGSGKTTLLKCISGRLTP   58 (258)
T ss_pred             cCCcEEEEEecCCCcHHhHHHHHhcccCC
Confidence            35568999999999999999999877644


No 462
>cd04128 Spg1 Spg1p.  Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase.  Spg1p is an essential gene that localizes to the spindle pole bodies.  When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p.  Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p.  The existence of a SIN-related pathway in plants has been proposed.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP.  Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are
Probab=86.85  E-value=2.2  Score=36.66  Aligned_cols=21  Identities=19%  Similarity=0.237  Sum_probs=18.3

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.++|..+.|||.|+++++..
T Consensus         3 i~vlG~~~vGKTsLi~~~~~~   23 (182)
T cd04128           3 IGLLGDAQIGKTSLMVKYVEG   23 (182)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678899999999999999754


No 463
>PRK14737 gmk guanylate kinase; Provisional
Probab=86.84  E-value=0.94  Score=39.82  Aligned_cols=22  Identities=23%  Similarity=0.306  Sum_probs=19.8

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +|-|+||.++|||+|+++|+..
T Consensus         6 ~ivl~GpsG~GK~tl~~~l~~~   27 (186)
T PRK14737          6 LFIISSVAGGGKSTIIQALLEE   27 (186)
T ss_pred             EEEEECCCCCCHHHHHHHHHhc
Confidence            5778999999999999999865


No 464
>PRK13900 type IV secretion system ATPase VirB11; Provisional
Probab=86.80  E-value=0.5  Score=45.50  Aligned_cols=24  Identities=21%  Similarity=0.337  Sum_probs=21.3

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      -|-|+|+.+||||+|||.|++++.
T Consensus       162 nili~G~tgSGKTTll~aL~~~ip  185 (332)
T PRK13900        162 NIIISGGTSTGKTTFTNAALREIP  185 (332)
T ss_pred             cEEEECCCCCCHHHHHHHHHhhCC
Confidence            477899999999999999998854


No 465
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein. This model represents the ATP-binding cassette (ABC) protein of the three subunit molybdate ABC transporter. The three proteins of this complex are homologous to proteins of the sulfate ABC transporter. Molybdenum may be used in nitrogenases of nitrogen-fixing bacteria and in molybdopterin cofactors. In some cases, molybdate may be transported by a sulfate transporter rather than by a specific molybdate transporter.
Probab=86.79  E-value=0.48  Score=45.53  Aligned_cols=25  Identities=20%  Similarity=0.297  Sum_probs=21.7

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      -+++|+|+.++|||+||+.|++.+.
T Consensus        24 ei~~l~G~nGsGKSTLl~~iaGl~~   48 (354)
T TIGR02142        24 GVTAIFGRSGSGKTTLIRLIAGLTR   48 (354)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCCC
Confidence            3789999999999999999987643


No 466
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules.  The nucleotide-binding domain shows the highest similarity between all members of the family.  ABC transporters are a subset of nucleotide hydrolases that contain a signature motif, Q-loop, and H-loop/switch region, in addition to, the Walker A motif/P-loop and Walker B motif commonly found in a number of ATP- and GTP-binding and hydrolyzing proteins.
Probab=86.75  E-value=0.53  Score=39.26  Aligned_cols=24  Identities=29%  Similarity=0.405  Sum_probs=20.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+.+
T Consensus        26 ~~~~i~G~nGsGKStll~~l~g~~   49 (157)
T cd00267          26 EIVALVGPNGSGKSTLLRAIAGLL   49 (157)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            478899999999999999997653


No 467
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional
Probab=86.74  E-value=0.5  Score=43.78  Aligned_cols=24  Identities=29%  Similarity=0.356  Sum_probs=21.4

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +++|+|+.++|||+|++.|.+.+.
T Consensus        34 ~~~i~G~nGaGKSTLl~~i~Gl~~   57 (283)
T PRK13636         34 VTAILGGNGAGKSTLFQNLNGILK   57 (283)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCC
Confidence            789999999999999999987643


No 468
>smart00053 DYNc Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and  plasma membrane following an exocytic event.
Probab=86.74  E-value=0.44  Score=43.98  Aligned_cols=22  Identities=27%  Similarity=0.391  Sum_probs=20.2

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .|+|+|++.+|||+|||.+++.
T Consensus        28 ~i~vvG~~~~GKSt~l~~i~g~   49 (240)
T smart00053       28 QIAVVGGQSAGKSSVLENFVGR   49 (240)
T ss_pred             eEEEEcCCCccHHHHHHHHhCC
Confidence            5889999999999999999875


No 469
>PRK14738 gmk guanylate kinase; Provisional
Probab=86.73  E-value=0.87  Score=40.33  Aligned_cols=23  Identities=22%  Similarity=0.307  Sum_probs=19.4

Q ss_pred             EEEEEecccccChhHHHHHHHHh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+|.|+||.++|||+|+++|...
T Consensus        14 ~~ivi~GpsG~GK~tl~~~L~~~   36 (206)
T PRK14738         14 LLVVISGPSGVGKDAVLARMRER   36 (206)
T ss_pred             eEEEEECcCCCCHHHHHHHHHhc
Confidence            45677999999999999999643


No 470
>TIGR00041 DTMP_kinase thymidylate kinase. Function: phosphorylation of DTMP to form DTDP in both de novo and salvage pathways of DTTP synthesis. Catalytic activity: ATP + thymidine 5'-phosphate = ADP + thymidine 5'-diphosphate.
Probab=86.72  E-value=0.68  Score=39.71  Aligned_cols=25  Identities=16%  Similarity=0.267  Sum_probs=22.4

Q ss_pred             EEEEecccccChhHHHHHHHHhhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      +|+|.|+-++|||++++.|...+..
T Consensus         5 ~IvieG~~GsGKsT~~~~L~~~l~~   29 (195)
T TIGR00041         5 FIVIEGIDGAGKTTQANLLKKLLQE   29 (195)
T ss_pred             EEEEECCCCCCHHHHHHHHHHHHHH
Confidence            6899999999999999999988754


No 471
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G.  On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group
Probab=86.69  E-value=0.54  Score=43.01  Aligned_cols=21  Identities=29%  Similarity=0.390  Sum_probs=19.2

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |+|+|..++|||+|+|+|+..
T Consensus         2 i~ivG~~gsGKStL~~~Ll~~   22 (268)
T cd04170           2 IALVGHSGSGKTTLAEALLYA   22 (268)
T ss_pred             EEEECCCCCCHHHHHHHHHHh
Confidence            689999999999999999865


No 472
>PLN03071 GTP-binding nuclear protein Ran; Provisional
Probab=86.67  E-value=2.3  Score=37.83  Aligned_cols=26  Identities=15%  Similarity=0.086  Sum_probs=21.0

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      .+-.-|.|+|...+|||+|+++++..
T Consensus        11 ~~~~Ki~vvG~~gvGKTsli~~~~~~   36 (219)
T PLN03071         11 YPSFKLVIVGDGGTGKTTFVKRHLTG   36 (219)
T ss_pred             CCceEEEEECcCCCCHHHHHHHHhhC
Confidence            44556789999999999999998643


No 473
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]
Probab=86.61  E-value=0.51  Score=44.17  Aligned_cols=26  Identities=23%  Similarity=0.226  Sum_probs=22.9

Q ss_pred             EEEEEecccccChhHHHHHHHHhhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      .+++|+|+.++|||+|++.|+.....
T Consensus        34 e~lgivGeSGsGKSTL~r~l~Gl~~p   59 (252)
T COG1124          34 ETLGIVGESGSGKSTLARLLAGLEKP   59 (252)
T ss_pred             CEEEEEcCCCCCHHHHHHHHhcccCC
Confidence            57999999999999999999987544


No 474
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional
Probab=86.60  E-value=0.5  Score=45.67  Aligned_cols=24  Identities=25%  Similarity=0.346  Sum_probs=21.5

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      .+++|+|+.++|||+||+.|++.+
T Consensus        29 e~~~llGpsGsGKSTLLr~IaGl~   52 (353)
T PRK10851         29 QMVALLGPSGSGKTTLLRIIAGLE   52 (353)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998764


No 475
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldA is an ABC transporter ATP-binding protein (pfam00005) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockouts of GldA abolish the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. Bacteroidetes with members of this protein family appear to have all of the genes associated with gliding motility.
Probab=86.59  E-value=0.51  Score=44.17  Aligned_cols=24  Identities=25%  Similarity=0.419  Sum_probs=21.2

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++++|+.++|||+||+.|++-+
T Consensus        29 ei~~l~G~NGaGKTTLl~~l~Gl~   52 (301)
T TIGR03522        29 RIVGFLGPNGAGKSTTMKIITGYL   52 (301)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCCC
Confidence            378999999999999999998754


No 476
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit. This model describes the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea. This transport system belong to the larger ATP-Binding Cassette (ABC) transporter superfamily. The characteristic feature of these transporter is the obligatory coupling of ATP hydrolysis to substrate translocation. The minimal configuration of bacterial ABC transport system: an ATPase or ATP binding subunit; An integral membrane protein; a hydrophilic polypetpide, which likely functions as substrate binding protein. Functionally, this transport system is involved in osmoregulation. Under conditions of stress, the organism recruits these transport system to accumulate glycine betaine and other solutes which offer osmo-protection. It has been demonstrated that glycine betaine uptake is accompanied by symport with sodium ions. The locus has been named variously as proU or opuA. A gene library from L.lact
Probab=86.58  E-value=0.47  Score=46.21  Aligned_cols=24  Identities=25%  Similarity=0.376  Sum_probs=21.2

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +++|+|+.++|||+||+.|++...
T Consensus        21 i~~l~G~sGsGKSTLLr~L~Gl~~   44 (363)
T TIGR01186        21 IFVIMGLSGSGKSTTVRMLNRLIE   44 (363)
T ss_pred             EEEEECCCCChHHHHHHHHhCCCC
Confidence            678999999999999999987653


No 477
>PRK09554 feoB ferrous iron transport protein B; Reviewed
Probab=86.57  E-value=1  Score=48.21  Aligned_cols=21  Identities=24%  Similarity=0.379  Sum_probs=18.8

Q ss_pred             EEEEecccccChhHHHHHHHH
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      .|+++|...+|||+|.|+|.+
T Consensus         5 ~IaLvG~pNvGKSTLfN~Ltg   25 (772)
T PRK09554          5 TIGLIGNPNSGKTTLFNQLTG   25 (772)
T ss_pred             EEEEECCCCCCHHHHHHHHhC
Confidence            488999999999999999953


No 478
>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends. They cleave ends sealed by hairpin structures and are thought to play a role in removing protein bound to DNA termini.
Probab=86.46  E-value=0.54  Score=41.61  Aligned_cols=22  Identities=27%  Similarity=0.353  Sum_probs=19.4

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +++|+|+.++|||+||+.|..-
T Consensus        30 ~~~i~G~NGsGKSTll~~i~~~   51 (213)
T cd03279          30 LFLICGPTGAGKSTILDAITYA   51 (213)
T ss_pred             EEEEECCCCCCHHHHHHHheee
Confidence            7889999999999999998643


No 479
>PRK10762 D-ribose transporter ATP binding protein; Provisional
Probab=86.45  E-value=0.47  Score=47.37  Aligned_cols=25  Identities=24%  Similarity=0.340  Sum_probs=21.8

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      -+++|+|+.++|||+||+.|.+.+.
T Consensus        31 e~~~l~G~NGsGKSTLl~~l~G~~~   55 (501)
T PRK10762         31 RVMALVGENGAGKSTMMKVLTGIYT   55 (501)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCCCC
Confidence            4789999999999999999987653


No 480
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=86.45  E-value=0.34  Score=39.80  Aligned_cols=19  Identities=37%  Similarity=0.363  Sum_probs=16.9

Q ss_pred             EecccccChhHHHHHHHHh
Q psy5031          61 VAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        61 I~G~~RtGKSfLLN~Ll~~   79 (281)
                      ++|+.++|||+|+|+|...
T Consensus         1 iiG~~~~GKStll~~l~~~   19 (176)
T cd01881           1 LVGLPNVGKSTLLNALTNA   19 (176)
T ss_pred             CCCCCCCcHHHHHHHHhcC
Confidence            5799999999999999754


No 481
>COG0486 ThdF Predicted GTPase [General function prediction only]
Probab=86.44  E-value=0.44  Score=48.01  Aligned_cols=24  Identities=38%  Similarity=0.318  Sum_probs=20.6

Q ss_pred             EEEecccccChhHHHHHHHHhhhh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      |+|+|+...|||.|||.|+++-.+
T Consensus       220 vvIiG~PNvGKSSLLNaL~~~d~A  243 (454)
T COG0486         220 VVIIGRPNVGKSSLLNALLGRDRA  243 (454)
T ss_pred             EEEECCCCCcHHHHHHHHhcCCce
Confidence            468899999999999999987443


No 482
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=86.43  E-value=0.48  Score=47.36  Aligned_cols=24  Identities=33%  Similarity=0.390  Sum_probs=21.3

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+|++.|.+.+
T Consensus        32 e~~~l~G~nGsGKSTLl~~l~Gl~   55 (506)
T PRK13549         32 EIVSLCGENGAGKSTLMKVLSGVY   55 (506)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCCC
Confidence            478999999999999999998764


No 483
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]
Probab=86.40  E-value=0.49  Score=44.19  Aligned_cols=24  Identities=25%  Similarity=0.189  Sum_probs=21.4

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -|-+|+||.+||||+|.+.|....
T Consensus        31 EvhaiMGPNGsGKSTLa~~i~G~p   54 (251)
T COG0396          31 EVHAIMGPNGSGKSTLAYTIMGHP   54 (251)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            467899999999999999998764


No 484
>PRK00889 adenylylsulfate kinase; Provisional
Probab=86.37  E-value=0.75  Score=39.05  Aligned_cols=28  Identities=21%  Similarity=0.134  Sum_probs=24.0

Q ss_pred             eEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          55 HVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        55 pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      +-.+|.++|+.++|||+++..|.+.+..
T Consensus         3 ~g~~i~~~G~~GsGKST~a~~la~~l~~   30 (175)
T PRK00889          3 RGVTVWFTGLSGAGKTTIARALAEKLRE   30 (175)
T ss_pred             CCeEEEEECCCCCCHHHHHHHHHHHHHH
Confidence            3458999999999999999999988743


No 485
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional
Probab=86.28  E-value=0.51  Score=47.45  Aligned_cols=24  Identities=25%  Similarity=0.333  Sum_probs=21.3

Q ss_pred             EEEEecccccChhHHHHHHHHhhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +++|+|+.++|||+||+.|++.+.
T Consensus        37 ~~~iiG~nGsGKSTLl~~i~G~~~   60 (529)
T PRK15134         37 TLALVGESGSGKSVTALSILRLLP   60 (529)
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCC
Confidence            688999999999999999987653


No 486
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed
Probab=86.25  E-value=0.5  Score=47.91  Aligned_cols=24  Identities=29%  Similarity=0.509  Sum_probs=20.6

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      ..++|+|+.++|||+|++.|++..
T Consensus       377 ~~vaIvG~SGsGKSTL~~lL~g~~  400 (588)
T PRK11174        377 QRIALVGPSGAGKTSLLNALLGFL  400 (588)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCC
Confidence            456788999999999999998864


No 487
>TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members of this protein family are Hda (Homologous to DnaA). These proteins are about half the length of DnaA and homologous over length of Hda. In the model species Escherichia coli, the initiation of DNA replication requires DnaA bound to ATP rather than ADP; Hda helps facilitate the conversion of DnaA-ATP to DnaA-ADP.
Probab=86.25  E-value=0.8  Score=40.01  Aligned_cols=43  Identities=21%  Similarity=0.078  Sum_probs=29.9

Q ss_pred             eCHHHHHHHHcccCCCCceEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          37 LDYEALERILLQDHVKDKHVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        37 ln~eal~~il~~~~~~~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      -|..+++.+..-  .....-..|-++|+.+||||+|+..+.++..
T Consensus        21 ~~~~~~~~l~~~--~~~~~~~~lll~G~~G~GKT~la~~~~~~~~   63 (226)
T TIGR03420        21 GNAELLAALRQL--AAGKGDRFLYLWGESGSGKSHLLQAACAAAE   63 (226)
T ss_pred             CcHHHHHHHHHH--HhcCCCCeEEEECCCCCCHHHHHHHHHHHHH
Confidence            355677665442  1123345677899999999999999988754


No 488
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional
Probab=86.23  E-value=0.53  Score=45.27  Aligned_cols=23  Identities=17%  Similarity=0.307  Sum_probs=20.9

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+||+.|++.+
T Consensus        26 ~~~l~G~nGsGKSTLl~~iaGl~   48 (352)
T PRK11144         26 ITAIFGRSGAGKTSLINAISGLT   48 (352)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCC
Confidence            78999999999999999998764


No 489
>PRK14730 coaE dephospho-CoA kinase; Provisional
Probab=86.22  E-value=0.68  Score=40.91  Aligned_cols=22  Identities=23%  Similarity=0.434  Sum_probs=20.3

Q ss_pred             EEEEecccccChhHHHHHHHHh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      +|+|+|+.+||||++.++|...
T Consensus         3 ~i~itG~~gsGKst~~~~l~~~   24 (195)
T PRK14730          3 RIGLTGGIASGKSTVGNYLAQQ   24 (195)
T ss_pred             EEEEECCCCCCHHHHHHHHHHh
Confidence            5999999999999999999875


No 490
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=86.13  E-value=0.55  Score=39.33  Aligned_cols=20  Identities=30%  Similarity=0.205  Sum_probs=17.8

Q ss_pred             EEEecccccChhHHHHHHHH
Q psy5031          59 VSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~   78 (281)
                      |.++|+.++|||.|+|+|..
T Consensus         2 vvlvG~~~~GKTsl~~~l~~   21 (169)
T cd04158           2 VVTLGLDGAGKTTILFKLKQ   21 (169)
T ss_pred             EEEECCCCCCHHHHHHHHhc
Confidence            56899999999999999964


No 491
>cd01893 Miro1 Miro1 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the N-terminal GTPase domain of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=86.12  E-value=0.63  Score=38.66  Aligned_cols=21  Identities=29%  Similarity=0.254  Sum_probs=18.5

Q ss_pred             EEEecccccChhHHHHHHHHh
Q psy5031          59 VSVAGAFRKGKSFLLDFLLRY   79 (281)
Q Consensus        59 VsI~G~~RtGKSfLLN~Ll~~   79 (281)
                      |.|+|...+|||.|+|++...
T Consensus         3 v~ivG~~~vGKTsl~~~l~~~   23 (166)
T cd01893           3 IVLIGDEGVGKSSLIMSLVSE   23 (166)
T ss_pred             EEEECCCCCCHHHHHHHHHhC
Confidence            678899999999999999764


No 492
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) catalyzes the phosphorylation of dephosphocoenzyme A (dCoA) to yield CoA, which is the final step in CoA biosynthesis.
Probab=86.11  E-value=0.56  Score=40.42  Aligned_cols=21  Identities=24%  Similarity=0.499  Sum_probs=19.6

Q ss_pred             EEEEecccccChhHHHHHHHH
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      +|+|.|..++|||++++.|..
T Consensus         1 ii~itG~~gsGKst~~~~l~~   21 (179)
T cd02022           1 IIGLTGGIGSGKSTVAKLLKE   21 (179)
T ss_pred             CEEEECCCCCCHHHHHHHHHH
Confidence            589999999999999999976


No 493
>PF07724 AAA_2:  AAA domain (Cdc48 subfamily);  InterPro: IPR013093 ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids []. The highly conserved nature of this module across taxa suggests that it has a key cellular role. Members of the family are involved in diverse cellular functions including gene expression, peroxisome assembly and vesicle mediated transport. Although the role of ATPase AAA-2 domain is not, as yet, clear, the AAA+ superfamily of proteins to which the AAA ATPases belong has a chaperone-like function in the assembly, operation or disassembly of proteins []. Some of these ATPases function as a chaperone subunit of a proteasome-like degradation complex. This ATPase family includes some proteins not detected by IPR003959 from INTERPRO.; GO: 0005524 ATP binding; PDB: 1R6B_X 1KSF_X 3PXI_C 1KYI_T 1G3I_S 1OFH_B 1OFI_A 1G41_A 1IM2_A 1HQY_E ....
Probab=86.06  E-value=0.72  Score=40.13  Aligned_cols=28  Identities=21%  Similarity=0.140  Sum_probs=25.5

Q ss_pred             ceEEEEEEecccccChhHHHHHHHHhhh
Q psy5031          54 KHVVVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        54 ~pVaVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      +|++++=.+||.++||++|+..|.+++.
T Consensus         1 ~p~~~~ll~GpsGvGKT~la~~la~~l~   28 (171)
T PF07724_consen    1 RPKSNFLLAGPSGVGKTELAKALAELLF   28 (171)
T ss_dssp             S-SEEEEEESSTTSSHHHHHHHHHHHHT
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHhc
Confidence            5889999999999999999999999987


No 494
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional
Probab=86.05  E-value=0.53  Score=47.25  Aligned_cols=25  Identities=24%  Similarity=0.302  Sum_probs=21.7

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .+++|+|+.++|||+||+.|.+.+.
T Consensus        38 e~~~liG~NGsGKSTLl~~l~Gl~~   62 (510)
T PRK15439         38 EVHALLGGNGAGKSTLMKIIAGIVP   62 (510)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCCC
Confidence            4689999999999999999987643


No 495
>PRK10261 glutathione transporter ATP-binding protein; Provisional
Probab=86.02  E-value=0.5  Score=48.83  Aligned_cols=25  Identities=24%  Similarity=0.343  Sum_probs=22.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      -+++|+|+.++|||+||+.|++.+.
T Consensus        43 e~~~lvG~nGsGKSTLl~~l~Gll~   67 (623)
T PRK10261         43 ETLAIVGESGSGKSVTALALMRLLE   67 (623)
T ss_pred             CEEEEECCCCChHHHHHHHHHcCCC
Confidence            4789999999999999999998754


No 496
>PRK08356 hypothetical protein; Provisional
Probab=86.01  E-value=0.62  Score=40.65  Aligned_cols=21  Identities=29%  Similarity=0.531  Sum_probs=19.1

Q ss_pred             EEEEecccccChhHHHHHHHH
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLR   78 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~   78 (281)
                      +|.|+|+.++|||++.++|..
T Consensus         7 ~i~~~G~~gsGK~t~a~~l~~   27 (195)
T PRK08356          7 IVGVVGKIAAGKTTVAKFFEE   27 (195)
T ss_pred             EEEEECCCCCCHHHHHHHHHH
Confidence            688999999999999999953


No 497
>TIGR00750 lao LAO/AO transport system ATPase. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however.
Probab=85.97  E-value=1.1  Score=42.14  Aligned_cols=30  Identities=27%  Similarity=0.213  Sum_probs=25.6

Q ss_pred             CceEEEEEEecccccChhHHHHHHHHhhhh
Q psy5031          53 DKHVVVVSVAGAFRKGKSFLLDFLLRYMNF   82 (281)
Q Consensus        53 ~~pVaVVsI~G~~RtGKSfLLN~Ll~~l~~   82 (281)
                      ..+--+|.|+|+.++|||+|++.+...+..
T Consensus        31 ~~~~~~i~i~G~~G~GKttl~~~l~~~~~~   60 (300)
T TIGR00750        31 TGNAHRVGITGTPGAGKSTLLEALGMELRR   60 (300)
T ss_pred             cCCceEEEEECCCCCCHHHHHHHHHHHHHH
Confidence            456788899999999999999999987643


No 498
>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains.  Amino-acid sequence homology of SMC proteins between species is largely confined to the amino- and carboxy-terminal globular domains.  The amino-terminal domain contains a 'Walker A' nucleotide-binding domain (GxxGxGKS/T, in the single-letter amino-acid code), which by mutational studies has been shown to be essential in several proteins.  The carboxy-terminal domain contains a sequence (the DA-box) that resembles a 'Walker B' motif, and a motif with homology to the signature sequence of the ATP-binding cassette (ABC) family of ATPases.  The sequence homology within the carboxy-terminal domain is relatively high within the SMC1-SMC4 group, whereas SMC5 and SMC6 show some divergence in both of these sequences.  In eukaryotic cells, the proteins are found as heterodimers of SMC1 paired with SMC3, SMC2 with SMC4, and SMC5 with SMC6 (fo
Probab=85.91  E-value=0.64  Score=42.10  Aligned_cols=25  Identities=24%  Similarity=0.280  Sum_probs=21.7

Q ss_pred             EEEEEecccccChhHHHHHHHHhhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYMN   81 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l~   81 (281)
                      .+++|+|+.++|||.||..|..-+.
T Consensus        26 ~~~~IvG~NGsGKStll~Ai~~ll~   50 (251)
T cd03273          26 QFNAITGLNGSGKSNILDAICFVLG   50 (251)
T ss_pred             CeEEEECCCCCCHHHHHHHHHHHhc
Confidence            4788999999999999999976653


No 499
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein. Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005).
Probab=85.87  E-value=0.52  Score=46.89  Aligned_cols=24  Identities=29%  Similarity=0.335  Sum_probs=21.1

Q ss_pred             EEEEEecccccChhHHHHHHHHhh
Q psy5031          57 VVVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        57 aVVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      -+++|+|+.++|||+||+.|.+.+
T Consensus        28 e~~~liG~nGsGKSTLl~~i~G~~   51 (500)
T TIGR02633        28 ECVGLCGENGAGKSTLMKILSGVY   51 (500)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCC
Confidence            378899999999999999998754


No 500
>PRK13549 xylose transporter ATP-binding subunit; Provisional
Probab=85.78  E-value=0.53  Score=47.04  Aligned_cols=23  Identities=22%  Similarity=0.440  Sum_probs=21.0

Q ss_pred             EEEEecccccChhHHHHHHHHhh
Q psy5031          58 VVSVAGAFRKGKSFLLDFLLRYM   80 (281)
Q Consensus        58 VVsI~G~~RtGKSfLLN~Ll~~l   80 (281)
                      +++|+|+.++|||+|++.|++.+
T Consensus       290 ~~~l~G~NGsGKSTLlk~i~Gl~  312 (506)
T PRK13549        290 ILGIAGLVGAGRTELVQCLFGAY  312 (506)
T ss_pred             EEEEeCCCCCCHHHHHHHHhCCC
Confidence            78999999999999999998764


Done!