Query         psy5059
Match_columns 1036
No_of_seqs    402 out of 1544
Neff          6.4 
Searched_HMMs 46136
Date          Sat Aug 17 00:40:43 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5059.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5059hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0446|consensus              100.0  3E-101  6E-106  925.1  38.7  528   59-1035    4-637 (657)
  2 KOG0446|consensus              100.0 5.6E-54 1.2E-58  516.6  35.1  468    2-767    24-639 (657)
  3 smart00053 DYNc Dynamin, GTPas 100.0 1.3E-46 2.7E-51  405.2  23.0  180   60-298     2-182 (240)
  4 PF01031 Dynamin_M:  Dynamin ce 100.0 6.4E-42 1.4E-46  382.4  17.9  179  767-945    48-231 (295)
  5 COG1160 Predicted GTPases [Gen 100.0 5.2E-31 1.1E-35  298.7  15.6  252    7-470     3-358 (444)
  6 KOG0447|consensus              100.0 2.5E-29 5.4E-34  282.1  24.0  289   57-556   279-577 (980)
  7 smart00053 DYNc Dynamin, GTPas  99.9 2.2E-23 4.8E-28  225.1  13.5  204    4-425    23-238 (240)
  8 PF01031 Dynamin_M:  Dynamin ce  99.9 2.3E-21   5E-26  217.0  13.5  179  494-672    11-288 (295)
  9 TIGR03594 GTPase_EngA ribosome  99.8 4.2E-19 9.2E-24  208.5  19.3   78  369-469   273-350 (429)
 10 PRK03003 GTP-binding protein D  99.8 7.7E-19 1.7E-23  208.8  20.6   78  369-470   312-389 (472)
 11 smart00302 GED Dynamin GTPase   99.8 7.5E-20 1.6E-24  169.6   9.0   75  961-1035    2-76  (92)
 12 PRK09518 bifunctional cytidyla  99.8 6.5E-19 1.4E-23  218.8  19.9   78  369-470   551-628 (712)
 13 smart00302 GED Dynamin GTPase   99.8 1.4E-19   3E-24  167.8   9.0   78  691-768     2-79  (92)
 14 PRK00093 GTP-binding protein D  99.8 1.5E-18 3.3E-23  204.4  18.8   77  369-469   274-350 (435)
 15 PF00350 Dynamin_N:  Dynamin fa  99.8 9.9E-18 2.1E-22  171.1  14.7  166   86-316     1-166 (168)
 16 PF02212 GED:  Dynamin GTPase e  99.7 1.7E-16 3.6E-21  147.5   7.6   76  960-1035    1-76  (92)
 17 PF02212 GED:  Dynamin GTPase e  99.6 4.6E-16 9.9E-21  144.5   7.5   78  690-767     1-78  (92)
 18 PRK09866 hypothetical protein;  99.5 1.5E-10 3.3E-15  137.4  35.4   65   59-126    48-112 (741)
 19 COG0218 Predicted GTPase [Gene  99.4 1.8E-12   4E-17  134.6  12.4  108  321-458    81-192 (200)
 20 KOG0447|consensus               99.2   5E-11 1.1E-15  135.9  11.5   53  260-316   435-487 (980)
 21 TIGR00436 era GTP-binding prot  99.1 5.3E-10 1.1E-14  124.0  14.0   71  373-470   101-171 (270)
 22 COG0486 ThdF Predicted GTPase   99.1 5.5E-10 1.2E-14  128.7  14.3  130  217-463   246-376 (454)
 23 cd01895 EngA2 EngA2 subfamily.  99.1 1.1E-09 2.5E-14  110.5  14.8   70  370-461   104-173 (174)
 24 COG0699 Predicted GTPases (dyn  99.1 3.2E-09   7E-14  128.2  19.5  235  766-1034  171-530 (546)
 25 COG1160 Predicted GTPases [Gen  99.1   6E-10 1.3E-14  128.1  12.0  141  227-476    38-188 (444)
 26 PF02421 FeoB_N:  Ferrous iron   99.1 6.2E-10 1.3E-14  113.2  10.4   62  368-457    94-155 (156)
 27 TIGR03598 GTPase_YsxC ribosome  99.0 1.1E-09 2.3E-14  113.7  11.3   28   81-108    16-43  (179)
 28 PRK00454 engB GTP-binding prot  99.0 3.8E-09 8.3E-14  110.3  15.2   66  371-461   127-192 (196)
 29 COG1159 Era GTPase [General fu  99.0 2.6E-09 5.5E-14  117.1  13.9   74  371-470   106-179 (298)
 30 PRK00089 era GTPase Era; Revie  99.0 5.9E-09 1.3E-13  116.8  16.6   69  373-467   107-175 (292)
 31 cd01876 YihA_EngB The YihA (En  99.0 5.5E-09 1.2E-13  104.8  13.6   68  369-460   100-168 (170)
 32 PRK12298 obgE GTPase CgtA; Rev  98.9 5.5E-09 1.2E-13  121.5  13.3   25   83-107   159-183 (390)
 33 cd04171 SelB SelB subfamily.    98.9 1.2E-08 2.7E-13  102.6  12.9   56  380-459   105-162 (164)
 34 TIGR03156 GTP_HflX GTP-binding  98.9 2.3E-08 5.1E-13  114.9  16.6   28   81-108   187-214 (351)
 35 TIGR03594 GTPase_EngA ribosome  98.9 1.1E-08 2.3E-13  120.7  13.5  112  241-461    47-158 (429)
 36 cd04163 Era Era subfamily.  Er  98.9 1.9E-08 4.2E-13  100.4  13.1   63  371-459   103-165 (168)
 37 KOG1191|consensus               98.9 1.1E-09 2.4E-14  125.7   4.2   64  227-296   303-366 (531)
 38 PRK04213 GTP-binding protein;   98.8   4E-08 8.6E-13  103.5  14.7   27   82-108     8-34  (201)
 39 cd04165 GTPBP1_like GTPBP1-lik  98.8 2.8E-08   6E-13  107.4  13.5   89  369-461   128-221 (224)
 40 PRK03003 GTP-binding protein D  98.8 3.4E-08 7.4E-13  118.1  15.0   26   82-107    37-62  (472)
 41 cd01887 IF2_eIF5B IF2/eIF5B (i  98.8 4.4E-08 9.6E-13   99.2  13.0   25   84-108     1-25  (168)
 42 cd01898 Obg Obg subfamily.  Th  98.8 4.9E-08 1.1E-12   99.2  13.1   55  378-459   113-167 (170)
 43 PF00009 GTP_EFTU:  Elongation   98.8   3E-08 6.5E-13  103.8  11.2   73  369-462   112-186 (188)
 44 PRK11058 GTPase HflX; Provisio  98.8 6.2E-08 1.4E-12  114.0  15.1   28   81-108   195-222 (426)
 45 PRK12299 obgE GTPase CgtA; Rev  98.8 4.3E-08 9.2E-13  112.0  13.1   25   83-107   158-182 (335)
 46 PRK15494 era GTPase Era; Provi  98.8 9.1E-08   2E-12  109.7  15.7   69  374-470   155-223 (339)
 47 cd01878 HflX HflX subfamily.    98.8 1.3E-07 2.9E-12   99.9  15.5   28   81-108    39-66  (204)
 48 PRK00093 GTP-binding protein D  98.7   5E-08 1.1E-12  115.4  12.7   25   83-107     1-25  (435)
 49 cd01897 NOG NOG1 is a nucleola  98.7 1.9E-07   4E-12   94.9  14.7   25   84-108     1-25  (168)
 50 cd01894 EngA1 EngA1 subfamily.  98.7 1.2E-07 2.6E-12   94.5  13.0   57  371-458    97-153 (157)
 51 PRK09518 bifunctional cytidyla  98.7 5.8E-08 1.3E-12  121.6  13.1   25   83-107   275-299 (712)
 52 PRK12296 obgE GTPase CgtA; Rev  98.7 8.8E-08 1.9E-12  113.8  13.0   25   83-107   159-183 (500)
 53 PRK12297 obgE GTPase CgtA; Rev  98.7 1.4E-07 2.9E-12  110.7  14.2   24   84-107   159-182 (424)
 54 COG1084 Predicted GTPase [Gene  98.7 5.4E-07 1.2E-11   99.9  17.2   47   61-107   146-192 (346)
 55 cd04152 Arl4_Arl7 Arl4/Arl7 su  98.7 2.4E-07 5.2E-12   96.5  13.3   24   85-108     5-28  (183)
 56 cd01879 FeoB Ferrous iron tran  98.7 1.8E-07 3.9E-12   93.6  11.8   62  371-460    93-154 (158)
 57 cd04166 CysN_ATPS CysN_ATPS su  98.7 2.6E-07 5.6E-12   98.6  13.6   23   85-107     1-23  (208)
 58 cd00881 GTP_translation_factor  98.7 4.5E-07 9.7E-12   93.4  15.0   24   85-108     1-24  (189)
 59 cd01884 EF_Tu EF-Tu subfamily.  98.6 1.6E-07 3.4E-12   99.5  11.5   60  369-451   107-171 (195)
 60 TIGR02729 Obg_CgtA Obg family   98.6 1.9E-07 4.2E-12  106.5  12.9   25   83-107   157-181 (329)
 61 cd00880 Era_like Era (E. coli   98.6 4.2E-07   9E-12   89.4  13.6   65  372-460    97-161 (163)
 62 cd01890 LepA LepA subfamily.    98.6 3.5E-07 7.6E-12   94.0  13.5   58  377-460   117-174 (179)
 63 cd00878 Arf_Arl Arf (ADP-ribos  98.6   5E-07 1.1E-11   90.9  14.3   61  375-459    96-156 (158)
 64 cd01852 AIG1 AIG1 (avrRpt2-ind  98.6 2.2E-07 4.8E-12   98.0  11.8   24   85-108     2-25  (196)
 65 TIGR02528 EutP ethanolamine ut  98.6 2.8E-07   6E-12   91.3  11.4   23   85-107     2-24  (142)
 66 cd01868 Rab11_like Rab11-like.  98.6 3.9E-07 8.5E-12   92.4  12.3   25   84-108     4-28  (165)
 67 cd04159 Arl10_like Arl10-like   98.6   8E-07 1.7E-11   88.2  14.4   24   85-108     1-24  (159)
 68 cd04154 Arl2 Arl2 subfamily.    98.6   5E-07 1.1E-11   92.8  13.2   26   82-107    13-38  (173)
 69 cd00154 Rab Rab family.  Rab G  98.6 3.4E-07 7.3E-12   90.7  11.6   25   84-108     1-25  (159)
 70 cd01896 DRG The developmentall  98.6 1.5E-06 3.3E-11   94.6  17.6  171  241-459    47-222 (233)
 71 PRK05291 trmE tRNA modificatio  98.6 4.4E-07 9.5E-12  107.9  14.4   26   82-107   214-239 (449)
 72 PRK15467 ethanolamine utilizat  98.6 5.3E-07 1.1E-11   92.1  12.9   54  379-461    91-145 (158)
 73 PF01926 MMR_HSR1:  50S ribosom  98.6 3.6E-07 7.9E-12   87.8  10.8   23   85-107     1-23  (116)
 74 cd04160 Arfrp1 Arfrp1 subfamil  98.6   5E-07 1.1E-11   91.6  12.3   58  377-458   105-164 (167)
 75 cd01889 SelB_euk SelB subfamil  98.6 4.6E-07   1E-11   95.1  12.2   62  379-460   120-183 (192)
 76 cd04157 Arl6 Arl6 subfamily.    98.6 1.2E-06 2.5E-11   88.2  14.7   23   85-107     1-23  (162)
 77 cd04164 trmE TrmE (MnmE, ThdF,  98.6 1.1E-06 2.4E-11   87.4  14.2   24   85-108     3-26  (157)
 78 cd01861 Rab6 Rab6 subfamily.    98.6 9.8E-07 2.1E-11   88.8  13.8   24   85-108     2-25  (161)
 79 TIGR00450 mnmE_trmE_thdF tRNA   98.5 5.5E-07 1.2E-11  106.6  13.3   26   82-107   202-227 (442)
 80 cd04151 Arl1 Arl1 subfamily.    98.5 1.3E-06 2.8E-11   88.2  14.3   23   85-107     1-23  (158)
 81 cd04119 RJL RJL (RabJ-Like) su  98.5 8.8E-07 1.9E-11   89.3  13.0   24   85-108     2-25  (168)
 82 cd04145 M_R_Ras_like M-Ras/R-R  98.5 3.9E-07 8.5E-12   91.9  10.4   24   85-108     4-27  (164)
 83 cd01862 Rab7 Rab7 subfamily.    98.5 1.6E-06 3.4E-11   88.2  14.7   59  376-460   106-164 (172)
 84 cd01864 Rab19 Rab19 subfamily.  98.5 1.6E-06 3.4E-11   88.2  14.4   26   83-108     3-28  (165)
 85 cd01867 Rab8_Rab10_Rab13_like   98.5 1.2E-06 2.5E-11   89.5  13.3   26   83-108     3-28  (167)
 86 cd04142 RRP22 RRP22 subfamily.  98.5 9.6E-07 2.1E-11   93.6  13.0   24   85-108     2-25  (198)
 87 cd04114 Rab30 Rab30 subfamily.  98.5 7.3E-07 1.6E-11   90.6  11.6   26   83-108     7-32  (169)
 88 cd04104 p47_IIGP_like p47 (47-  98.5   4E-07 8.7E-12   96.3   9.8   25   84-108     2-26  (197)
 89 cd04138 H_N_K_Ras_like H-Ras/N  98.5   1E-06 2.2E-11   88.4  12.0   25   84-108     2-26  (162)
 90 cd01891 TypA_BipA TypA (tyrosi  98.5 9.2E-07   2E-11   93.0  12.2   21   85-105     4-24  (194)
 91 PF10662 PduV-EutP:  Ethanolami  98.5 5.6E-07 1.2E-11   90.1   9.9   54  379-459    89-142 (143)
 92 cd04116 Rab9 Rab9 subfamily.    98.5 1.3E-06 2.8E-11   89.1  12.7   26   83-108     5-30  (170)
 93 cd04136 Rap_like Rap-like subf  98.5   1E-06 2.2E-11   88.8  11.7   25   84-108     2-26  (163)
 94 cd04112 Rab26 Rab26 subfamily.  98.5 6.8E-07 1.5E-11   93.7  10.6   24   85-108     2-25  (191)
 95 cd01853 Toc34_like Toc34-like   98.5 7.3E-07 1.6E-11   97.9  11.1   42   60-108    15-56  (249)
 96 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  98.5 7.8E-07 1.7E-11   90.4  10.1   25   84-108     3-27  (166)
 97 CHL00071 tufA elongation facto  98.5 6.4E-07 1.4E-11  105.3  10.8   59  369-450   117-180 (409)
 98 cd04109 Rab28 Rab28 subfamily.  98.5 1.4E-06   3E-11   93.3  12.5   24   85-108     2-25  (215)
 99 cd01866 Rab2 Rab2 subfamily.    98.4 8.9E-07 1.9E-11   90.6  10.3   26   83-108     4-29  (168)
100 cd04168 TetM_like Tet(M)-like   98.4 1.6E-06 3.6E-11   94.5  12.8   93  371-463   108-235 (237)
101 cd04156 ARLTS1 ARLTS1 subfamil  98.4 2.1E-06 4.6E-11   86.4  12.8   24   85-108     1-24  (160)
102 smart00173 RAS Ras subfamily o  98.4 1.7E-06 3.7E-11   87.5  12.0   24   85-108     2-25  (164)
103 cd00879 Sar1 Sar1 subfamily.    98.4   3E-06 6.5E-11   88.3  14.2   27   82-108    18-44  (190)
104 cd04122 Rab14 Rab14 subfamily.  98.4   3E-06 6.4E-11   86.3  13.7   24   85-108     4-27  (166)
105 cd01863 Rab18 Rab18 subfamily.  98.4 3.3E-06 7.2E-11   85.1  13.6   24   85-108     2-25  (161)
106 cd04149 Arf6 Arf6 subfamily.    98.4 3.6E-06 7.7E-11   86.6  13.9   26   83-108     9-34  (168)
107 PRK09554 feoB ferrous iron tra  98.4 1.4E-06 3.1E-11  109.3  13.0   65  370-462   103-167 (772)
108 cd04113 Rab4 Rab4 subfamily.    98.4 3.8E-06 8.3E-11   84.8  13.8   24   85-108     2-25  (161)
109 cd01881 Obg_like The Obg-like   98.4 1.3E-06 2.7E-11   89.1  10.3   54  378-458   119-172 (176)
110 cd01865 Rab3 Rab3 subfamily.    98.4 4.3E-06 9.2E-11   85.2  14.0   24   85-108     3-26  (165)
111 cd04155 Arl3 Arl3 subfamily.    98.4 4.3E-06 9.2E-11   85.5  13.9   26   83-108    14-39  (173)
112 PRK12317 elongation factor 1-a  98.4 2.8E-06   6E-11  100.5  14.1   24   84-107     7-30  (425)
113 cd00876 Ras Ras family.  The R  98.4 4.4E-06 9.5E-11   83.5  13.5   24   85-108     1-24  (160)
114 cd01893 Miro1 Miro1 subfamily.  98.4   3E-06 6.4E-11   86.5  12.3   24   85-108     2-25  (166)
115 cd01899 Ygr210 Ygr210 subfamil  98.4 1.2E-05 2.5E-10   91.5  18.1   37   86-122     1-37  (318)
116 PRK10512 selenocysteinyl-tRNA-  98.4 2.3E-06 4.9E-11  105.3  12.9   59  379-461   103-164 (614)
117 PRK12736 elongation factor Tu;  98.4   3E-06 6.4E-11   99.3  13.3   24   84-107    13-36  (394)
118 TIGR00991 3a0901s02IAP34 GTP-b  98.4 2.8E-06   6E-11   95.3  12.3   42   59-107    21-62  (313)
119 cd04139 RalA_RalB RalA/RalB su  98.4   5E-06 1.1E-10   83.6  13.2   24   85-108     2-25  (164)
120 TIGR00475 selB selenocysteine-  98.4 1.8E-06 3.9E-11  105.7  11.8   22   86-107     3-24  (581)
121 cd04175 Rap1 Rap1 subgroup.  T  98.4 1.9E-06   4E-11   87.4   9.9   24   84-107     2-25  (164)
122 cd04170 EF-G_bact Elongation f  98.3 6.9E-06 1.5E-10   91.1  15.2   40  424-463   227-266 (268)
123 cd04106 Rab23_lke Rab23-like s  98.3 5.1E-06 1.1E-10   83.7  12.8   24   85-108     2-25  (162)
124 smart00178 SAR Sar1p-like memb  98.3 8.2E-06 1.8E-10   85.2  14.6   26   83-108    17-42  (184)
125 TIGR00487 IF-2 translation ini  98.3 4.5E-06 9.7E-11  102.0  14.3   27   82-108    86-112 (587)
126 cd04101 RabL4 RabL4 (Rab-like4  98.3 3.5E-06 7.5E-11   85.2  11.3   21   85-105     2-22  (164)
127 cd04153 Arl5_Arl8 Arl5/Arl8 su  98.3 8.1E-06 1.8E-10   84.2  14.2   26   83-108    15-40  (174)
128 cd04124 RabL2 RabL2 subfamily.  98.3 1.7E-06 3.8E-11   87.9   9.1   24   85-108     2-25  (161)
129 PLN03118 Rab family protein; P  98.3 3.1E-06 6.7E-11   90.3  11.3   25   84-108    15-39  (211)
130 KOG1423|consensus               98.3 7.1E-06 1.5E-10   90.0  13.9  145  235-466   114-274 (379)
131 cd01886 EF-G Elongation factor  98.3 6.8E-06 1.5E-10   91.4  14.3   40  424-463   229-268 (270)
132 cd01888 eIF2_gamma eIF2-gamma   98.3 3.2E-06 6.9E-11   89.9  11.1   60  380-463   138-199 (203)
133 cd04118 Rab24 Rab24 subfamily.  98.3 1.4E-06 3.1E-11   91.1   8.3   24   85-108     2-25  (193)
134 CHL00189 infB translation init  98.3 4.3E-06 9.3E-11  103.9  13.8   27   82-108   243-269 (742)
135 cd04143 Rhes_like Rhes_like su  98.3 5.3E-06 1.1E-10   91.1  13.1   24   85-108     2-25  (247)
136 PF00350 Dynamin_N:  Dynamin fa  98.3 5.7E-07 1.2E-11   91.8   5.2   45   10-54      1-45  (168)
137 cd04161 Arl2l1_Arl13_like Arl2  98.3   8E-06 1.7E-10   83.8  13.6   22   85-106     1-22  (167)
138 smart00177 ARF ARF-like small   98.3   9E-06   2E-10   84.1  14.1   22   83-104    13-34  (175)
139 TIGR00491 aIF-2 translation in  98.3 2.7E-06 5.9E-11  103.8  11.8   36   82-117     3-38  (590)
140 PLN03127 Elongation factor Tu;  98.3 3.8E-06 8.2E-11   99.7  12.7   25   82-106    60-84  (447)
141 cd04107 Rab32_Rab38 Rab38/Rab3  98.3 8.8E-06 1.9E-10   86.0  14.3   24   85-108     2-25  (201)
142 cd04176 Rap2 Rap2 subgroup.  T  98.3 1.1E-06 2.4E-11   88.8   6.9   24   85-108     3-26  (163)
143 cd01860 Rab5_related Rab5-rela  98.3 9.1E-06   2E-10   82.0  13.5   24   85-108     3-26  (163)
144 TIGR00231 small_GTP small GTP-  98.3 1.2E-05 2.6E-10   79.0  13.9   53  379-459   108-160 (161)
145 PRK05124 cysN sulfate adenylyl  98.3 5.7E-06 1.2E-10   99.0  13.6   27   81-107    25-51  (474)
146 cd04144 Ras2 Ras2 subfamily.    98.3 2.8E-06 6.1E-11   89.0   9.7   24   85-108     1-24  (190)
147 cd04158 ARD1 ARD1 subfamily.    98.3 1.1E-05 2.4E-10   82.7  13.9   24   85-108     1-24  (169)
148 cd04123 Rab21 Rab21 subfamily.  98.3 6.8E-06 1.5E-10   82.3  12.0   24   85-108     2-25  (162)
149 cd01883 EF1_alpha Eukaryotic e  98.3 7.6E-06 1.6E-10   88.1  13.1   21   86-106     2-22  (219)
150 cd04177 RSR1 RSR1 subgroup.  R  98.3 6.3E-06 1.4E-10   84.2  11.8   24   85-108     3-26  (168)
151 COG1163 DRG Predicted GTPase [  98.3 9.4E-06   2E-10   90.0  13.5  166  240-458   109-284 (365)
152 cd04127 Rab27A Rab27a subfamil  98.3 7.1E-06 1.5E-10   84.5  12.0   26   83-108     4-29  (180)
153 cd04120 Rab12 Rab12 subfamily.  98.3 1.1E-05 2.3E-10   86.1  13.7   24   85-108     2-25  (202)
154 cd04169 RF3 RF3 subfamily.  Pe  98.3 1.3E-05 2.8E-10   89.0  14.8   38  426-463   228-265 (267)
155 cd01850 CDC_Septin CDC/Septin.  98.3 1.4E-05   3E-10   89.3  14.7   25   85-109     6-30  (276)
156 cd04125 RabA_like RabA-like su  98.2 3.6E-06 7.7E-11   87.8   9.2   25   84-108     1-25  (188)
157 cd04147 Ras_dva Ras-dva subfam  98.2 9.6E-06 2.1E-10   85.6  12.5   24   85-108     1-24  (198)
158 smart00175 RAB Rab subfamily o  98.2 3.5E-06 7.7E-11   84.8   8.8   24   85-108     2-25  (164)
159 TIGR02034 CysN sulfate adenyly  98.2 5.3E-06 1.2E-10   97.5  11.6   23   85-107     2-24  (406)
160 cd04111 Rab39 Rab39 subfamily.  98.2 7.7E-06 1.7E-10   87.5  11.6   25   84-108     3-27  (211)
161 cd04140 ARHI_like ARHI subfami  98.2   6E-06 1.3E-10   84.1  10.2   24   85-108     3-26  (165)
162 cd04141 Rit_Rin_Ric Rit/Rin/Ri  98.2 7.3E-06 1.6E-10   84.6  10.9   24   85-108     4-27  (172)
163 cd04150 Arf1_5_like Arf1-Arf5-  98.2 2.1E-05 4.6E-10   80.0  14.0   37  240-289    43-79  (159)
164 cd00157 Rho Rho (Ras homology)  98.2 7.9E-06 1.7E-10   83.0  10.8   66  379-459   104-169 (171)
165 PLN00223 ADP-ribosylation fact  98.2   2E-05 4.3E-10   82.3  14.0   24   84-107    18-41  (181)
166 PLN03110 Rab GTPase; Provision  98.2 8.9E-06 1.9E-10   87.3  11.7   26   83-108    12-37  (216)
167 PRK00049 elongation factor Tu;  98.2 1.1E-05 2.3E-10   94.7  13.3   23   84-106    13-35  (396)
168 PTZ00133 ADP-ribosylation fact  98.2   2E-05 4.3E-10   82.3  13.9   24   84-107    18-41  (182)
169 PRK12735 elongation factor Tu;  98.2 1.1E-05 2.4E-10   94.5  13.4   23   84-106    13-35  (396)
170 TIGR01393 lepA GTP-binding pro  98.2 1.1E-05 2.3E-10   99.2  13.6   58  378-461   121-178 (595)
171 PRK05306 infB translation init  98.2 8.6E-06 1.9E-10  102.0  13.0   26   82-107   289-314 (787)
172 cd04110 Rab35 Rab35 subfamily.  98.2 7.7E-06 1.7E-10   86.5  10.7   26   83-108     6-31  (199)
173 cd04115 Rab33B_Rab33A Rab33B/R  98.2 7.7E-06 1.7E-10   83.8  10.4   25   84-108     3-27  (170)
174 cd04108 Rab36_Rab34 Rab34/Rab3  98.2 9.4E-06   2E-10   83.6  10.9   24   85-108     2-25  (170)
175 cd04132 Rho4_like Rho4-like su  98.2 1.7E-05 3.7E-10   82.4  12.7   24   85-108     2-25  (187)
176 PF04548 AIG1:  AIG1 family;  I  98.2 1.1E-05 2.4E-10   86.6  11.2   27   85-111     2-28  (212)
177 PRK05506 bifunctional sulfate   98.2 2.1E-05 4.5E-10   97.6  14.9   25   83-107    24-48  (632)
178 smart00174 RHO Rho (Ras homolo  98.1 2.5E-05 5.4E-10   79.9  12.7   23   86-108     1-23  (174)
179 COG3596 Predicted GTPase [Gene  98.1 1.6E-05 3.5E-10   86.6  11.6  139  239-464    85-223 (296)
180 cd01882 BMS1 Bms1.  Bms1 is an  98.1 1.6E-05 3.4E-10   86.2  11.6   57  370-449   123-182 (225)
181 TIGR00485 EF-Tu translation el  98.1 1.9E-05 4.2E-10   92.5  13.1   23   84-106    13-35  (394)
182 PTZ00369 Ras-like protein; Pro  98.1 1.3E-05 2.8E-10   83.9  10.4   26   83-108     5-30  (189)
183 cd01870 RhoA_like RhoA-like su  98.1 3.9E-05 8.5E-10   78.5  13.4   25   84-108     2-26  (175)
184 PLN03126 Elongation factor Tu;  98.1 1.5E-05 3.4E-10   95.2  11.8   24   84-107    82-105 (478)
185 cd04162 Arl9_Arfrp2_like Arl9/  98.1 3.2E-05 6.9E-10   79.2  12.5   24   85-108     1-24  (164)
186 PLN03108 Rab family protein; P  98.1 1.7E-05 3.6E-10   84.8  10.8   25   84-108     7-31  (210)
187 cd04135 Tc10 TC10 subfamily.    98.1 1.6E-05 3.6E-10   81.2  10.2   24   85-108     2-25  (174)
188 cd04146 RERG_RasL11_like RERG/  98.1   1E-05 2.2E-10   82.3   8.4   24   85-108     1-24  (165)
189 cd04137 RheB Rheb (Ras Homolog  98.1 4.9E-05 1.1E-09   78.3  13.7   24   85-108     3-26  (180)
190 cd04117 Rab15 Rab15 subfamily.  98.1 2.9E-05 6.3E-10   79.0  11.7   24   85-108     2-25  (161)
191 cd04134 Rho3 Rho3 subfamily.    98.0 3.9E-05 8.4E-10   80.4  12.3   24   85-108     2-25  (189)
192 cd04130 Wrch_1 Wrch-1 subfamil  98.0 2.1E-05 4.5E-10   80.8  10.0   24   85-108     2-25  (173)
193 cd04148 RGK RGK subfamily.  Th  98.0 1.6E-05 3.4E-10   85.8   9.4   24   85-108     2-25  (221)
194 cd04128 Spg1 Spg1p.  Spg1p (se  98.0 7.3E-05 1.6E-09   78.1  14.2   24   85-108     2-25  (182)
195 PRK00007 elongation factor G;   98.0 2.1E-05 4.5E-10   98.5  11.7   55  369-448   117-171 (693)
196 PLN03071 GTP-binding nuclear p  98.0 1.4E-05   3E-10   86.2   8.8   26   83-108    13-38  (219)
197 cd04173 Rnd2_Rho7 Rnd2/Rho7 su  98.0 8.5E-05 1.8E-09   80.4  14.9   24   85-108     3-26  (222)
198 PRK04004 translation initiatio  98.0 2.6E-05 5.6E-10   95.6  12.2   27   81-107     4-30  (586)
199 PRK12739 elongation factor G;   98.0 2.3E-05 4.9E-10   98.2  11.0   37  426-462   241-277 (691)
200 cd00877 Ran Ran (Ras-related n  98.0 2.4E-05 5.3E-10   80.1   9.3   24   85-108     2-25  (166)
201 TIGR00437 feoB ferrous iron tr  98.0 2.7E-05 5.8E-10   95.6  11.0   65  369-461    89-153 (591)
202 cd04126 Rab20 Rab20 subfamily.  98.0  0.0001 2.2E-09   79.6  14.1   24   85-108     2-25  (220)
203 PRK09602 translation-associate  98.0 8.7E-05 1.9E-09   86.9  14.1   39   84-122     2-40  (396)
204 cd04121 Rab40 Rab40 subfamily.  97.9 2.9E-05 6.2E-10   81.9   9.0   26   83-108     6-31  (189)
205 TIGR00993 3a0901s04IAP86 chlor  97.9 5.5E-05 1.2E-09   91.4  12.3   25   84-108   119-143 (763)
206 cd01874 Cdc42 Cdc42 subfamily.  97.9 9.5E-05 2.1E-09   76.6  12.3   24   85-108     3-26  (175)
207 cd01892 Miro2 Miro2 subfamily.  97.9 3.6E-05 7.7E-10   79.2   9.1   25   84-108     5-29  (169)
208 PRK05433 GTP-binding protein L  97.9 9.5E-05 2.1E-09   91.0  14.2   23   84-106     8-30  (600)
209 cd00882 Ras_like_GTPase Ras-li  97.9   6E-05 1.3E-09   72.8  10.2   61  372-458    95-155 (157)
210 TIGR00483 EF-1_alpha translati  97.9 0.00012 2.6E-09   86.8  14.7   23   84-106     8-30  (426)
211 COG0370 FeoB Fe2+ transport sy  97.9 3.7E-05 8.1E-10   92.9  10.3   68  369-464    98-165 (653)
212 cd01871 Rac1_like Rac1-like su  97.9 0.00011 2.4E-09   76.0  12.6   24   85-108     3-26  (174)
213 cd04172 Rnd3_RhoE_Rho8 Rnd3/Rh  97.9  0.0002 4.3E-09   75.0  14.5   25   84-108     6-30  (182)
214 cd04174 Rnd1_Rho6 Rnd1/Rho6 su  97.9 6.5E-05 1.4E-09   81.8  10.8   26   83-108    13-38  (232)
215 TIGR01394 TypA_BipA GTP-bindin  97.9 6.4E-05 1.4E-09   92.3  11.8   21   85-105     3-23  (594)
216 KOG1489|consensus               97.9 8.8E-05 1.9E-09   82.1  11.5   51  381-460   314-364 (366)
217 TIGR00484 EF-G translation elo  97.9  0.0001 2.3E-09   92.4  13.6   35  428-462   244-278 (689)
218 cd01875 RhoG RhoG subfamily.    97.8 0.00024 5.2E-09   74.7  14.0   25   84-108     4-28  (191)
219 cd04131 Rnd Rnd subfamily.  Th  97.8 0.00019 4.1E-09   74.8  13.0   24   85-108     3-26  (178)
220 PF02421 FeoB_N:  Ferrous iron   97.8 2.2E-05 4.7E-10   80.2   5.7   23    9-31      2-24  (156)
221 cd04105 SR_beta Signal recogni  97.8 0.00018 3.8E-09   76.7  13.0   25   84-108     1-25  (203)
222 PRK00741 prfC peptide chain re  97.8 0.00017 3.7E-09   87.4  14.4   94  370-463   122-274 (526)
223 PRK09435 membrane ATPase/prote  97.8 0.00013 2.7E-09   83.4  12.5   57  383-463   198-260 (332)
224 PRK10218 GTP-binding protein;   97.8   6E-05 1.3E-09   92.5  10.5   24   83-106     5-28  (607)
225 TIGR03680 eif2g_arch translati  97.8 0.00011 2.4E-09   86.5  12.1   58  380-461   135-194 (406)
226 PTZ00141 elongation factor 1-   97.8 9.6E-05 2.1E-09   88.0  11.5   60  371-452   136-202 (446)
227 PRK04000 translation initiatio  97.8 0.00018   4E-09   84.8  13.2   58  380-461   140-199 (411)
228 cd04167 Snu114p Snu114p subfam  97.8 9.7E-05 2.1E-09   79.1   9.8   24   85-108     2-25  (213)
229 PRK13351 elongation factor G;   97.8 0.00035 7.6E-09   87.7  15.9   30  433-462   248-277 (687)
230 COG2262 HflX GTPases [General   97.7 0.00037   8E-09   80.0  14.0   62  368-461   293-354 (411)
231 KOG0094|consensus               97.7 0.00032   7E-09   72.9  11.2   63  374-463   123-185 (221)
232 cd01885 EF2 EF2 (for archaea a  97.7 0.00027   6E-09   76.5  11.4   21   86-106     3-23  (222)
233 cd04133 Rop_like Rop subfamily  97.7 0.00027 5.8E-09   73.7  10.6   24   85-108     3-26  (176)
234 KOG0448|consensus               97.7 0.00021 4.5E-09   85.8  10.7   42   83-124   109-150 (749)
235 smart00176 RAN Ran (Ras-relate  97.6 0.00019 4.1E-09   76.5   9.0   37  240-289    43-79  (200)
236 cd01858 NGP_1 NGP-1.  Autoanti  97.6 7.1E-05 1.5E-09   76.1   5.5   23   85-107   104-126 (157)
237 PRK12740 elongation factor G;   97.6  0.0005 1.1E-08   86.1  13.6   34  429-462   228-261 (668)
238 COG1100 GTPase SAR1 and relate  97.6  0.0011 2.3E-08   70.6  14.1   25   84-108     6-30  (219)
239 PF00071 Ras:  Ras family;  Int  97.6 0.00064 1.4E-08   68.5  11.5   24   85-108     1-24  (162)
240 PTZ00327 eukaryotic translatio  97.6 0.00066 1.4E-08   81.0  13.2   57  380-460   172-230 (460)
241 PF00025 Arf:  ADP-ribosylation  97.5 0.00024 5.2E-09   73.8   8.4   58  377-458   113-171 (175)
242 COG4917 EutP Ethanolamine util  97.5 0.00024 5.2E-09   68.9   7.3   28   85-112     3-30  (148)
243 PF05049 IIGP:  Interferon-indu  97.5 0.00013 2.8E-09   84.1   6.7   44   61-107    16-59  (376)
244 COG0218 Predicted GTPase [Gene  97.5 7.8E-05 1.7E-09   78.3   4.3   36    6-41     23-58  (200)
245 cd01857 HSR1_MMR1 HSR1/MMR1.    97.4 0.00027 5.9E-09   70.7   6.7   60   43-108    43-108 (141)
246 KOG2486|consensus               97.4 0.00044 9.5E-09   75.5   8.6   60  336-396   204-265 (320)
247 COG0536 Obg Predicted GTPase [  97.4  0.0015 3.3E-08   73.4  12.3   57  379-461   275-331 (369)
248 cd04129 Rho2 Rho2 subfamily.    97.4  0.0013 2.8E-08   68.7  11.3   24   85-108     3-26  (187)
249 TIGR00073 hypB hydrogenase acc  97.3  0.0029 6.3E-08   67.5  13.5   57  379-460   148-204 (207)
250 COG1159 Era GTPase [General fu  97.3 0.00035 7.6E-09   77.4   6.4   83    9-95      8-100 (298)
251 TIGR00503 prfC peptide chain r  97.3  0.0022 4.9E-08   77.9  13.8   32  432-463   244-275 (527)
252 KOG0078|consensus               97.3  0.0012 2.7E-08   69.6   9.8   65  371-462   109-174 (207)
253 cd04103 Centaurin_gamma Centau  97.3  0.0017 3.7E-08   66.2  10.7   24   85-108     2-25  (158)
254 COG2229 Predicted GTPase [Gene  97.3  0.0047   1E-07   64.0  13.6   77  353-458    95-173 (187)
255 cd01900 YchF YchF subfamily.    97.2 0.00061 1.3E-08   76.0   7.0   37   86-122     1-37  (274)
256 PLN00043 elongation factor 1-a  97.1  0.0024 5.2E-08   76.2  11.0   21   85-105     9-29  (447)
257 KOG1490|consensus               97.1  0.0029 6.4E-08   73.9  11.0   40   66-105   151-190 (620)
258 cd04102 RabL3 RabL3 (Rab-like3  97.1  0.0022 4.8E-08   68.5   9.5   24   85-108     2-25  (202)
259 cd01873 RhoBTB RhoBTB subfamil  97.1  0.0025 5.3E-08   67.6   9.6   23   85-107     4-27  (195)
260 TIGR03596 GTPase_YlqF ribosome  97.0  0.0011 2.4E-08   74.1   7.0   24   84-107   119-142 (276)
261 PTZ00258 GTP-binding protein;   97.0  0.0013 2.7E-08   76.8   7.6   42   82-123    20-61  (390)
262 PF08477 Miro:  Miro-like prote  97.0 0.00032   7E-09   67.2   2.1   24   85-108     1-24  (119)
263 cd01855 YqeH YqeH.  YqeH is an  97.0 0.00077 1.7E-08   70.7   4.9   24   84-107   128-151 (190)
264 PRK12289 GTPase RsgA; Reviewed  96.9  0.0021 4.5E-08   74.3   8.0   23   85-107   174-196 (352)
265 PF01926 MMR_HSR1:  50S ribosom  96.9 0.00098 2.1E-08   64.0   4.3   36    9-44      1-37  (116)
266 cd01856 YlqF YlqF.  Proteins o  96.9  0.0017 3.7E-08   67.1   6.3   25   84-108   116-140 (171)
267 PRK09601 GTP-binding protein Y  96.9  0.0023 4.9E-08   73.9   7.7   38   84-121     3-40  (364)
268 cd04178 Nucleostemin_like Nucl  96.8 0.00072 1.6E-08   70.3   3.2   24   84-107   118-141 (172)
269 PRK09563 rbgA GTPase YlqF; Rev  96.8  0.0018 3.8E-08   72.9   6.5   24   84-107   122-145 (287)
270 PLN00116 translation elongatio  96.8  0.0076 1.6E-07   77.4  13.0   26   82-107    18-43  (843)
271 KOG0084|consensus               96.8  0.0059 1.3E-07   63.9   9.6  119  233-461    51-171 (205)
272 TIGR00490 aEF-2 translation el  96.8  0.0045 9.7E-08   78.2  10.1   24   82-105    18-41  (720)
273 TIGR03156 GTP_HflX GTP-binding  96.8  0.0014 3.1E-08   75.7   5.1   44    6-49    188-231 (351)
274 PTZ00416 elongation factor 2;   96.7  0.0068 1.5E-07   77.7  11.4   25   83-107    19-43  (836)
275 cd04104 p47_IIGP_like p47 (47-  96.6  0.0048   1E-07   65.3   7.6   23    9-31      3-25  (197)
276 PRK00454 engB GTP-binding prot  96.6  0.0016 3.5E-08   67.9   3.9   32    6-37     23-54  (196)
277 cd01878 HflX HflX subfamily.    96.6   0.002 4.3E-08   68.1   4.5   39    6-44     40-78  (204)
278 PRK07560 elongation factor EF-  96.6  0.0085 1.8E-07   75.9  10.8   25   82-106    19-43  (731)
279 PLN00023 GTP-binding protein;   96.6  0.0081 1.8E-07   68.3   9.5   29   80-108    18-46  (334)
280 PRK11058 GTPase HflX; Provisio  96.6   0.002 4.4E-08   76.3   4.9   41    6-46    196-236 (426)
281 TIGR00157 ribosome small subun  96.6  0.0072 1.6E-07   66.5   8.7   24   84-107   121-144 (245)
282 TIGR02836 spore_IV_A stage IV   96.6   0.037   8E-07   64.5  14.4   51  342-392   137-193 (492)
283 PRK12288 GTPase RsgA; Reviewed  96.6  0.0082 1.8E-07   69.3   9.3   24   84-107   206-229 (347)
284 KOG1191|consensus               96.5  0.0018 3.9E-08   75.7   3.8   42    8-50    269-312 (531)
285 PRK04213 GTP-binding protein;   96.5   0.003 6.5E-08   66.5   4.9   40    6-45      8-47  (201)
286 COG0486 ThdF Predicted GTPase   96.5  0.0015 3.3E-08   76.3   2.9   23    9-31    219-241 (454)
287 cd01858 NGP_1 NGP-1.  Autoanti  96.5  0.0018   4E-08   65.8   3.1   26    9-34    104-129 (157)
288 TIGR00101 ureG urease accessor  96.4   0.044 9.5E-07   58.4  13.5   53  383-460   141-193 (199)
289 KOG1423|consensus               96.4  0.0042 9.1E-08   68.9   5.7   66    9-74     74-151 (379)
290 cd01859 MJ1464 MJ1464.  This f  96.4  0.0073 1.6E-07   61.2   7.1   96  337-463     1-96  (156)
291 PF09439 SRPRB:  Signal recogni  96.4  0.0041 8.8E-08   65.2   5.3   25   83-107     3-27  (181)
292 cd01852 AIG1 AIG1 (avrRpt2-ind  96.4  0.0024 5.3E-08   67.4   3.6   28    9-36      2-29  (196)
293 cd01898 Obg Obg subfamily.  Th  96.4  0.0029 6.2E-08   64.2   3.7   24    9-32      2-25  (170)
294 cd01859 MJ1464 MJ1464.  This f  96.4  0.0064 1.4E-07   61.6   6.2   25   83-107   101-125 (156)
295 TIGR00750 lao LAO/AO transport  96.3   0.046   1E-06   62.0  13.6   25   82-106    33-57  (300)
296 cd01897 NOG NOG1 is a nucleola  96.3  0.0036 7.9E-08   63.4   4.3   25    8-32      1-25  (168)
297 cd01900 YchF YchF subfamily.    96.3  0.0026 5.7E-08   71.0   3.2   37   10-46      1-37  (274)
298 cd01861 Rab6 Rab6 subfamily.    96.3  0.0044 9.6E-08   62.2   4.4   28    9-36      2-29  (161)
299 TIGR02528 EutP ethanolamine ut  96.3   0.003 6.6E-08   62.4   3.2   24    9-32      2-25  (142)
300 PTZ00258 GTP-binding protein;   96.3  0.0036 7.8E-08   73.0   4.2   43    8-50     22-64  (390)
301 PTZ00132 GTP-binding nuclear p  96.2    0.04 8.6E-07   58.9  11.6  152   85-460    11-165 (215)
302 cd01849 YlqF_related_GTPase Yl  96.2  0.0052 1.1E-07   62.4   4.6   44    6-49     99-143 (155)
303 PRK12298 obgE GTPase CgtA; Rev  96.2  0.0048   1E-07   72.4   4.9   45    7-51    159-203 (390)
304 cd01887 IF2_eIF5B IF2/eIF5B (i  96.2  0.0033 7.1E-08   63.5   3.1   27    8-34      1-27  (168)
305 cd04178 Nucleostemin_like Nucl  96.2  0.0034 7.3E-08   65.4   3.1   27    8-34    118-144 (172)
306 KOG0091|consensus               96.2    0.13 2.8E-06   52.5  13.9   24   85-108    10-33  (213)
307 PRK09601 GTP-binding protein Y  96.1  0.0046 9.9E-08   71.4   4.2   39    8-46      3-41  (364)
308 KOG0092|consensus               96.1  0.0082 1.8E-07   62.6   5.3   25   84-108     6-30  (200)
309 cd04159 Arl10_like Arl10-like   96.0  0.0041   9E-08   61.4   2.9   24    9-32      1-24  (159)
310 cd01868 Rab11_like Rab11-like.  96.0  0.0072 1.6E-07   61.1   4.6   29    8-36      4-32  (165)
311 PRK09602 translation-associate  96.0  0.0054 1.2E-07   72.0   4.1   41    8-48      2-42  (396)
312 PRK09866 hypothetical protein;  96.0  0.0064 1.4E-07   73.9   4.5   43    8-50     70-112 (741)
313 TIGR00436 era GTP-binding prot  95.9  0.0048   1E-07   68.7   2.9   24    9-32      2-25  (270)
314 COG1084 Predicted GTPase [Gene  95.9  0.0054 1.2E-07   68.9   3.0   27    5-31    166-192 (346)
315 COG0378 HypB Ni2+-binding GTPa  95.8   0.039 8.5E-07   58.1   8.8   52  383-459   146-197 (202)
316 PRK00089 era GTPase Era; Revie  95.8  0.0098 2.1E-07   66.8   4.8   25    9-33      7-31  (292)
317 cd01854 YjeQ_engC YjeQ/EngC.    95.8   0.022 4.7E-07   64.2   7.6  109   41-270   108-243 (287)
318 cd04163 Era Era subfamily.  Er  95.8   0.011 2.4E-07   58.7   4.7   29    7-35      3-31  (168)
319 PRK11889 flhF flagellar biosyn  95.8    0.06 1.3E-06   62.8  11.0   23   84-106   242-264 (436)
320 cd01866 Rab2 Rab2 subfamily.    95.8    0.01 2.3E-07   60.5   4.5   30    8-37      5-34  (168)
321 KOG0090|consensus               95.7   0.074 1.6E-06   56.6  10.6   23  376-398   142-164 (238)
322 cd04119 RJL RJL (RabJ-Like) su  95.7  0.0072 1.6E-07   60.7   3.2   25    9-33      2-26  (168)
323 cd01876 YihA_EngB The YihA (En  95.7  0.0075 1.6E-07   60.2   3.3   31    9-39      1-31  (170)
324 KOG1707|consensus               95.7   0.017 3.8E-07   68.9   6.6  159   85-461    11-173 (625)
325 PF08477 Miro:  Miro-like prote  95.7  0.0068 1.5E-07   57.9   2.8   25    9-33      1-25  (119)
326 COG5256 TEF1 Translation elong  95.7   0.019 4.1E-07   66.4   6.7   20   85-104     9-28  (428)
327 COG0532 InfB Translation initi  95.7   0.086 1.9E-06   62.9  12.3   69  365-459    96-166 (509)
328 cd00154 Rab Rab family.  Rab G  95.7   0.012 2.6E-07   58.0   4.5   27    9-35      2-28  (159)
329 PRK15467 ethanolamine utilizat  95.7  0.0078 1.7E-07   61.4   3.1   23    9-31      3-25  (158)
330 PRK10416 signal recognition pa  95.7   0.066 1.4E-06   61.2  10.8   22    9-30    116-137 (318)
331 cd01899 Ygr210 Ygr210 subfamil  95.6  0.0085 1.8E-07   68.4   3.5   37   10-46      1-37  (318)
332 cd04138 H_N_K_Ras_like H-Ras/N  95.6  0.0082 1.8E-07   59.9   3.1   26    8-33      2-27  (162)
333 COG1161 Predicted GTPases [Gen  95.6  0.0077 1.7E-07   68.9   3.1   23   10-32    135-157 (322)
334 PF00448 SRP54:  SRP54-type pro  95.6     0.1 2.2E-06   55.5  11.2   23    9-31      3-25  (196)
335 cd01862 Rab7 Rab7 subfamily.    95.5   0.014 2.9E-07   59.3   4.4   28    9-36      2-29  (172)
336 cd04171 SelB SelB subfamily.    95.5  0.0079 1.7E-07   60.3   2.5   22    9-30      2-23  (164)
337 cd01895 EngA2 EngA2 subfamily.  95.5   0.013 2.9E-07   58.9   4.1   28    7-34      2-29  (174)
338 cd01867 Rab8_Rab10_Rab13_like   95.5  0.0096 2.1E-07   60.7   3.1   27    7-33      3-29  (167)
339 cd01855 YqeH YqeH.  YqeH is an  95.5   0.012 2.6E-07   61.7   3.8   25    8-32    128-152 (190)
340 cd01857 HSR1_MMR1 HSR1/MMR1.    95.5   0.017 3.6E-07   57.8   4.6   26    9-34     85-110 (141)
341 PF03029 ATP_bind_1:  Conserved  95.5   0.038 8.1E-07   60.6   7.7   72  378-460   155-234 (238)
342 COG0541 Ffh Signal recognition  95.4    0.18   4E-06   59.0  13.4   43  239-288   181-223 (451)
343 KOG0075|consensus               95.4   0.056 1.2E-06   54.2   7.9   37  242-291    66-102 (186)
344 TIGR01425 SRP54_euk signal rec  95.4   0.081 1.8E-06   62.6  10.8   32  379-410   239-270 (429)
345 TIGR03598 GTPase_YsxC ribosome  95.4   0.014   3E-07   60.6   3.9   30    6-35     17-46  (179)
346 COG1161 Predicted GTPases [Gen  95.4   0.013 2.7E-07   67.2   3.9   23   85-107   134-156 (322)
347 TIGR03596 GTPase_YlqF ribosome  95.4   0.016 3.4E-07   64.9   4.6   42    8-49    119-161 (276)
348 COG1163 DRG Predicted GTPase [  95.4   0.015 3.2E-07   65.3   4.2   23    9-31     65-87  (365)
349 cd04114 Rab30 Rab30 subfamily.  95.4   0.016 3.5E-07   58.7   4.2   29    7-35      7-35  (169)
350 cd01860 Rab5_related Rab5-rela  95.4   0.012 2.6E-07   59.2   3.2   26    9-34      3-28  (163)
351 smart00173 RAS Ras subfamily o  95.4   0.012 2.5E-07   59.4   3.1   25    9-33      2-26  (164)
352 PRK12296 obgE GTPase CgtA; Rev  95.3   0.016 3.4E-07   69.8   4.6   25    7-31    159-183 (500)
353 cd01863 Rab18 Rab18 subfamily.  95.3   0.015 3.2E-07   58.5   3.7   26    9-34      2-27  (161)
354 smart00175 RAB Rab subfamily o  95.3   0.018   4E-07   57.7   4.3   27    9-35      2-28  (164)
355 cd01851 GBP Guanylate-binding   95.2   0.014 3.1E-07   63.2   3.6   24    7-30      7-30  (224)
356 cd01865 Rab3 Rab3 subfamily.    95.2   0.014   3E-07   59.3   3.2   25    9-33      3-27  (165)
357 PF00009 GTP_EFTU:  Elongation   95.2   0.043 9.4E-07   57.4   6.9   61   42-105   122-184 (188)
358 PRK12299 obgE GTPase CgtA; Rev  95.2   0.021 4.5E-07   65.8   4.7   44    7-50    158-201 (335)
359 PF00735 Septin:  Septin;  Inte  95.2   0.022 4.8E-07   63.9   4.9   25   85-109     6-30  (281)
360 KOG0094|consensus               95.2   0.036 7.8E-07   58.1   5.9   51    5-56     20-82  (221)
361 PRK14974 cell division protein  95.2    0.33 7.1E-06   56.0  14.4   21    9-29    142-162 (336)
362 TIGR02729 Obg_CgtA Obg family   95.1   0.019   4E-07   66.0   4.2   25    7-31    157-181 (329)
363 PRK09563 rbgA GTPase YlqF; Rev  95.1    0.02 4.4E-07   64.4   4.4   39    8-46    122-161 (287)
364 PF03193 DUF258:  Protein of un  95.1   0.019 4.2E-07   59.1   3.7   27    8-34     36-62  (161)
365 cd01849 YlqF_related_GTPase Yl  95.1   0.022 4.7E-07   57.8   4.1   44   82-125    99-143 (155)
366 cd04157 Arl6 Arl6 subfamily.    95.1   0.015 3.3E-07   58.3   2.9   23    9-31      1-23  (162)
367 cd04140 ARHI_like ARHI subfami  95.1   0.016 3.5E-07   58.8   3.2   24    9-32      3-26  (165)
368 cd01853 Toc34_like Toc34-like   95.0   0.018   4E-07   63.5   3.7   29    7-35     31-59  (249)
369 PRK12297 obgE GTPase CgtA; Rev  95.0    0.02 4.3E-07   67.8   4.1   25    7-31    158-182 (424)
370 cd04136 Rap_like Rap-like subf  95.0   0.016 3.6E-07   58.1   3.0   25    8-32      2-26  (163)
371 cd04156 ARLTS1 ARLTS1 subfamil  95.0   0.016 3.5E-07   58.1   2.9   24    9-32      1-24  (160)
372 cd04154 Arl2 Arl2 subfamily.    95.0   0.017 3.8E-07   59.2   3.1   25    7-31     14-38  (173)
373 cd04142 RRP22 RRP22 subfamily.  95.0   0.017 3.7E-07   61.3   3.1   24    9-32      2-25  (198)
374 TIGR00231 small_GTP small GTP-  95.0    0.03 6.6E-07   54.6   4.7   25    8-32      2-26  (161)
375 cd01896 DRG The developmentall  94.9   0.023   5E-07   62.0   4.1   23    9-31      2-24  (233)
376 cd01884 EF_Tu EF-Tu subfamily.  94.9   0.098 2.1E-06   55.6   8.7   22    8-29      3-24  (195)
377 cd04123 Rab21 Rab21 subfamily.  94.9   0.022 4.9E-07   56.8   3.6   26    9-34      2-27  (162)
378 KOG0080|consensus               94.9   0.097 2.1E-06   53.2   7.9   26   83-108    11-36  (209)
379 cd01869 Rab1_Ypt1 Rab1/Ypt1 su  94.9    0.02 4.3E-07   58.1   3.2   25    8-32      3-27  (166)
380 COG2262 HflX GTPases [General   94.8   0.016 3.5E-07   66.9   2.7   27    5-31    190-216 (411)
381 cd04106 Rab23_lke Rab23-like s  94.8   0.021 4.5E-07   57.4   3.2   25    9-33      2-26  (162)
382 cd00879 Sar1 Sar1 subfamily.    94.8   0.031 6.8E-07   58.1   4.5   27    6-32     18-44  (190)
383 COG3276 SelB Selenocysteine-sp  94.8    0.16 3.6E-06   59.3  10.6   57  375-456    98-155 (447)
384 KOG1145|consensus               94.8    0.22 4.9E-06   59.3  11.8   64  366-457   243-310 (683)
385 cd04122 Rab14 Rab14 subfamily.  94.8   0.022 4.7E-07   57.9   3.2   26    9-34      4-29  (166)
386 cd04118 Rab24 Rab24 subfamily.  94.8    0.02 4.3E-07   59.8   3.0   25    9-33      2-26  (193)
387 cd04116 Rab9 Rab9 subfamily.    94.8   0.022 4.7E-07   58.0   3.2   28    7-34      5-32  (170)
388 PRK12288 GTPase RsgA; Reviewed  94.8   0.021 4.6E-07   66.0   3.5   25    9-33    207-231 (347)
389 cd04113 Rab4 Rab4 subfamily.    94.8   0.025 5.4E-07   57.0   3.6   28    9-36      2-29  (161)
390 KOG1424|consensus               94.8   0.018 3.9E-07   67.9   2.7   22    8-29    315-336 (562)
391 PRK10463 hydrogenase nickel in  94.8    0.38 8.2E-06   54.2  13.1  189   64-460    90-286 (290)
392 cd04162 Arl9_Arfrp2_like Arl9/  94.7   0.022 4.7E-07   58.3   3.0   24    9-32      1-24  (164)
393 cd00881 GTP_translation_factor  94.7    0.02 4.4E-07   58.7   2.8   27    9-35      1-27  (189)
394 cd01856 YlqF YlqF.  Proteins o  94.7   0.032 6.9E-07   57.7   4.3   27    8-34    116-142 (171)
395 cd00878 Arf_Arl Arf (ADP-ribos  94.7   0.021 4.5E-07   57.3   2.9   23    9-31      1-23  (158)
396 PRK13768 GTPase; Provisional    94.7   0.091   2E-06   58.1   8.0  137  313-463    98-247 (253)
397 cd01851 GBP Guanylate-binding   94.6   0.022 4.7E-07   61.9   2.9   35   83-118     7-45  (224)
398 cd04117 Rab15 Rab15 subfamily.  94.6   0.025 5.5E-07   57.4   3.2   26    9-34      2-27  (161)
399 cd00876 Ras Ras family.  The R  94.6   0.023 5.1E-07   56.5   2.9   24    9-32      1-24  (160)
400 cd04139 RalA_RalB RalA/RalB su  94.6   0.025 5.4E-07   56.7   3.1   25    9-33      2-26  (164)
401 cd04145 M_R_Ras_like M-Ras/R-R  94.6   0.024 5.2E-07   57.0   3.0   24    9-32      4-27  (164)
402 cd01864 Rab19 Rab19 subfamily.  94.6   0.025 5.5E-07   57.3   3.2   26    7-32      3-28  (165)
403 cd04155 Arl3 Arl3 subfamily.    94.6   0.025 5.5E-07   57.6   3.2   26    7-32     14-39  (173)
404 cd04124 RabL2 RabL2 subfamily.  94.6   0.026 5.6E-07   57.2   3.1   26    9-34      2-27  (161)
405 PRK15494 era GTPase Era; Provi  94.6   0.022 4.7E-07   65.7   2.9   24    9-32     54-77  (339)
406 cd04160 Arfrp1 Arfrp1 subfamil  94.6   0.021 4.6E-07   57.7   2.5   21   10-30      2-22  (167)
407 cd01881 Obg_like The Obg-like   94.5   0.021 4.5E-07   58.1   2.2   21   12-32      1-21  (176)
408 PRK12289 GTPase RsgA; Reviewed  94.5   0.034 7.5E-07   64.3   4.2   26    9-34    174-199 (352)
409 TIGR00157 ribosome small subun  94.5   0.036 7.7E-07   61.1   4.2   25    8-32    121-145 (245)
410 COG0370 FeoB Fe2+ transport sy  94.5   0.068 1.5E-06   65.5   6.7   34  900-936   589-622 (653)
411 KOG0410|consensus               94.5   0.027 5.9E-07   63.0   3.1   35    2-36    173-207 (410)
412 cd04177 RSR1 RSR1 subgroup.  R  94.4   0.027 5.9E-07   57.4   3.0   25    9-33      3-27  (168)
413 smart00178 SAR Sar1p-like memb  94.4   0.029 6.4E-07   58.5   3.2   25    8-32     18-42  (184)
414 TIGR00991 3a0901s02IAP34 GTP-b  94.4   0.029 6.3E-07   63.5   3.3   27    5-31     36-62  (313)
415 PRK14845 translation initiatio  94.4    0.17 3.6E-06   66.0  10.4   24  435-458   645-668 (1049)
416 KOG2203|consensus               94.4   0.025 5.4E-07   66.8   2.7   30    5-34     35-64  (772)
417 cd01892 Miro2 Miro2 subfamily.  94.4    0.03 6.6E-07   57.5   3.1   26    8-33      5-30  (169)
418 PF04548 AIG1:  AIG1 family;  I  94.3   0.038 8.2E-07   59.4   3.9   29    9-37      2-30  (212)
419 PRK05291 trmE tRNA modificatio  94.3   0.046   1E-06   65.4   5.0   25    8-32    216-240 (449)
420 cd00157 Rho Rho (Ras homology)  94.3    0.03 6.5E-07   56.7   2.9   24    9-32      2-25  (171)
421 cd04108 Rab36_Rab34 Rab34/Rab3  94.3   0.033 7.1E-07   57.3   3.2   25    9-33      2-26  (170)
422 smart00174 RHO Rho (Ras homolo  94.3   0.027 5.8E-07   57.5   2.5   23   10-32      1-23  (174)
423 cd04115 Rab33B_Rab33A Rab33B/R  94.3   0.033 7.1E-07   57.0   3.2   25    8-32      3-27  (170)
424 cd04112 Rab26 Rab26 subfamily.  94.3   0.033 7.1E-07   58.4   3.2   25    9-33      2-26  (191)
425 TIGR00450 mnmE_trmE_thdF tRNA   94.3   0.043 9.3E-07   65.5   4.5   26    7-32    203-228 (442)
426 cd04152 Arl4_Arl7 Arl4/Arl7 su  94.3   0.033 7.2E-07   58.0   3.2   25    9-33      5-29  (183)
427 cd04176 Rap2 Rap2 subgroup.  T  94.2   0.034 7.5E-07   56.0   3.2   25    9-33      3-27  (163)
428 cd04107 Rab32_Rab38 Rab38/Rab3  94.2   0.034 7.4E-07   58.7   3.2   25    9-33      2-26  (201)
429 cd04127 Rab27A Rab27a subfamil  94.2   0.035 7.6E-07   57.0   3.2   27    8-34      5-31  (180)
430 cd04175 Rap1 Rap1 subgroup.  T  94.2   0.035 7.6E-07   56.1   3.1   24    9-32      3-26  (164)
431 PRK12317 elongation factor 1-a  94.2    0.18   4E-06   59.9   9.6   20    9-28      8-27  (425)
432 KOG0395|consensus               94.1    0.12 2.7E-06   55.0   7.2   26   83-108     3-28  (196)
433 cd04146 RERG_RasL11_like RERG/  94.1   0.036 7.7E-07   56.2   2.9   24    9-32      1-24  (165)
434 TIGR03597 GTPase_YqeH ribosome  94.1   0.035 7.7E-07   64.5   3.2   23    9-31    156-178 (360)
435 PRK13796 GTPase YqeH; Provisio  94.1   0.032   7E-07   65.0   2.9   35   10-44    163-197 (365)
436 cd04109 Rab28 Rab28 subfamily.  94.0   0.037 8.1E-07   59.3   3.1   24    9-32      2-25  (215)
437 cd00877 Ran Ran (Ras-related n  94.0   0.038 8.3E-07   56.5   3.0   24    9-32      2-25  (166)
438 cd04125 RabA_like RabA-like su  94.0   0.042   9E-07   57.2   3.4   25    9-33      2-26  (188)
439 PRK14723 flhF flagellar biosyn  94.0    0.21 4.6E-06   62.9   9.9   28  384-411   328-355 (767)
440 COG3840 ThiQ ABC-type thiamine  93.9    0.05 1.1E-06   56.8   3.4   25    9-34     27-51  (231)
441 cd01893 Miro1 Miro1 subfamily.  93.9   0.042 9.1E-07   55.9   3.0   24    9-32      2-25  (166)
442 cd04110 Rab35 Rab35 subfamily.  93.8   0.043 9.3E-07   58.0   3.0   26    7-32      6-31  (199)
443 cd04137 RheB Rheb (Ras Homolog  93.8   0.042 9.1E-07   56.5   2.9   24    9-32      3-26  (180)
444 cd04158 ARD1 ARD1 subfamily.    93.8   0.045 9.8E-07   56.0   3.0   24    9-32      1-24  (169)
445 PRK12726 flagellar biosynthesi  93.7    0.32 6.9E-06   56.7   9.9   23   84-106   207-229 (407)
446 cd04149 Arf6 Arf6 subfamily.    93.7   0.048   1E-06   56.0   3.0   27    6-32      8-34  (168)
447 cd04132 Rho4_like Rho4-like su  93.7   0.046 9.9E-07   56.7   2.9   24    9-32      2-25  (187)
448 COG3596 Predicted GTPase [Gene  93.7   0.051 1.1E-06   60.0   3.2   41    8-48     39-81  (296)
449 cd04135 Tc10 TC10 subfamily.    93.6   0.051 1.1E-06   55.4   3.2   25    9-33      2-26  (174)
450 cd04111 Rab39 Rab39 subfamily.  93.6    0.05 1.1E-06   58.3   3.2   26    8-33      3-28  (211)
451 PRK06731 flhF flagellar biosyn  93.6    0.27 5.9E-06   54.9   9.1   25   82-106    74-98  (270)
452 cd04164 trmE TrmE (MnmE, ThdF,  93.6   0.069 1.5E-06   52.8   4.0   25    9-33      3-27  (157)
453 cd01870 RhoA_like RhoA-like su  93.6   0.055 1.2E-06   55.2   3.3   25    8-32      2-26  (175)
454 cd04147 Ras_dva Ras-dva subfam  93.6    0.05 1.1E-06   57.4   3.0   24    9-32      1-24  (198)
455 COG0481 LepA Membrane GTPase L  93.5    0.22 4.8E-06   58.6   8.2   58  377-460   126-183 (603)
456 cd04153 Arl5_Arl8 Arl5/Arl8 su  93.5   0.055 1.2E-06   55.7   3.1   26    7-32     15-40  (174)
457 TIGR03597 GTPase_YqeH ribosome  93.5    0.29 6.3E-06   57.0   9.4   99  336-461    51-151 (360)
458 PRK12723 flagellar biosynthesi  93.5     0.2 4.4E-06   58.8   8.0   28  384-411   317-344 (388)
459 cd04144 Ras2 Ras2 subfamily.    93.4   0.053 1.2E-06   56.7   2.9   24    9-32      1-24  (190)
460 TIGR00993 3a0901s04IAP86 chlor  93.3   0.089 1.9E-06   64.6   4.8   27    9-35    120-146 (763)
461 COG1162 Predicted GTPases [Gen  93.3    0.14 3.1E-06   57.6   6.0   77   87-270   168-246 (301)
462 PLN03108 Rab family protein; P  93.2   0.063 1.4E-06   57.4   3.1   27    8-34      7-33  (210)
463 cd04151 Arl1 Arl1 subfamily.    93.2   0.062 1.3E-06   54.1   2.8   23    9-31      1-23  (158)
464 KOG1954|consensus               93.2    0.43 9.3E-06   54.5   9.5   27   82-108    57-83  (532)
465 cd04101 RabL4 RabL4 (Rab-like4  93.1   0.064 1.4E-06   54.0   2.8   21    9-29      2-22  (164)
466 cd04141 Rit_Rin_Ric Rit/Rin/Ri  93.1   0.066 1.4E-06   55.2   3.0   24    9-32      4-27  (172)
467 PTZ00369 Ras-like protein; Pro  93.1   0.067 1.5E-06   55.9   3.1   26    7-32      5-30  (189)
468 cd04134 Rho3 Rho3 subfamily.    93.1   0.069 1.5E-06   55.9   3.1   24    9-32      2-25  (189)
469 TIGR00491 aIF-2 translation in  93.1   0.071 1.5E-06   65.8   3.6   34    6-39      3-36  (590)
470 KOG0093|consensus               93.1     0.3 6.5E-06   49.1   7.2   42  241-295    70-111 (193)
471 cd01890 LepA LepA subfamily.    93.1   0.053 1.1E-06   55.6   2.1   22    9-30      2-23  (179)
472 cd00880 Era_like Era (E. coli   93.0   0.081 1.8E-06   51.6   3.3   22   12-33      1-22  (163)
473 KOG1489|consensus               93.0    0.11 2.4E-06   58.3   4.5   22    8-29    197-218 (366)
474 TIGR00064 ftsY signal recognit  93.0    0.61 1.3E-05   52.3  10.6   22   85-106    74-95  (272)
475 cd04161 Arl2l1_Arl13_like Arl2  93.0   0.065 1.4E-06   54.8   2.7   22    9-30      1-22  (167)
476 COG0480 FusA Translation elong  92.9    0.56 1.2E-05   58.9  11.2   27  369-395   118-144 (697)
477 PRK14721 flhF flagellar biosyn  92.9    0.27 5.8E-06   58.3   7.8   23   84-106   192-214 (420)
478 PF00005 ABC_tran:  ABC transpo  92.8    0.07 1.5E-06   52.5   2.6   23    9-31     13-35  (137)
479 PLN03110 Rab GTPase; Provision  92.8   0.074 1.6E-06   57.1   3.0   25    8-32     13-37  (216)
480 KOG0462|consensus               92.8    0.36 7.8E-06   57.7   8.7   82  353-461   152-233 (650)
481 KOG2486|consensus               92.8   0.029 6.3E-07   61.8  -0.3   98    7-106   136-261 (320)
482 cd04148 RGK RGK subfamily.  Th  92.8   0.079 1.7E-06   57.2   3.1   24    9-32      2-25  (221)
483 cd01894 EngA1 EngA1 subfamily.  92.7   0.052 1.1E-06   53.8   1.5   20   11-30      1-20  (157)
484 PLN03118 Rab family protein; P  92.7    0.08 1.7E-06   56.4   3.0   24    9-32     16-39  (211)
485 PF03205 MobB:  Molybdopterin g  92.7   0.077 1.7E-06   53.4   2.7   23    8-30      1-23  (140)
486 PRK09554 feoB ferrous iron tra  92.7    0.12 2.5E-06   65.9   4.9   33  900-935   655-688 (772)
487 cd04120 Rab12 Rab12 subfamily.  92.7   0.085 1.8E-06   56.3   3.2   25    9-33      2-26  (202)
488 PRK00098 GTPase RsgA; Reviewed  92.7   0.086 1.9E-06   59.7   3.3   29    9-37    166-194 (298)
489 TIGR01360 aden_kin_iso1 adenyl  92.6   0.084 1.8E-06   54.7   3.0   23    6-28      2-24  (188)
490 PTZ00141 elongation factor 1-   92.6     0.4 8.8E-06   57.4   9.0   79   43-121   146-238 (446)
491 cd04103 Centaurin_gamma Centau  92.6   0.091   2E-06   53.5   3.1   26    9-34      2-27  (158)
492 COG0699 Predicted GTPases (dyn  92.5     1.7 3.7E-05   52.8  14.6  147  618-765   321-531 (546)
493 cd00882 Ras_like_GTPase Ras-li  92.5   0.058 1.3E-06   51.8   1.5   21   12-32      1-21  (157)
494 cd01879 FeoB Ferrous iron tran  92.5   0.097 2.1E-06   52.1   3.2   22   12-33      1-22  (158)
495 PF00071 Ras:  Ras family;  Int  92.5   0.088 1.9E-06   52.9   2.9   24    9-32      1-24  (162)
496 KOG2655|consensus               92.5    0.66 1.4E-05   53.6  10.1  214   86-510    24-256 (366)
497 cd01874 Cdc42 Cdc42 subfamily.  92.5   0.096 2.1E-06   54.2   3.2   24    9-32      3-26  (175)
498 PF03308 ArgK:  ArgK protein;    92.5    0.81 1.7E-05   50.6  10.3  186   70-461    16-228 (266)
499 COG0012 Predicted GTPase, prob  92.5    0.11 2.3E-06   59.9   3.7   24    8-31      3-26  (372)
500 COG1100 GTPase SAR1 and relate  92.5   0.088 1.9E-06   55.9   2.9   25    9-33      7-31  (219)

No 1  
>KOG0446|consensus
Probab=100.00  E-value=3e-101  Score=925.09  Aligned_cols=528  Identities=47%  Similarity=0.699  Sum_probs=473.7

Q ss_pred             hhhhHHHHHHHHHhhhhcC-CCCCCCCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhh
Q psy5059          59 KRTAAAVINKLQDVFNTVG-TDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRT  137 (1036)
Q Consensus        59 ~~~~~~l~~kL~~~~~~~g-~~~i~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~  137 (1036)
                      ++.+++++|++|+.|..+| ...+++|+|||||+||||||||||+++|++|||||+|+|||||+++||.+.....     
T Consensus         4 ~~~li~~vn~lqd~~~~l~~~~~i~lP~I~vvG~QSsGKSSvLE~lvG~~flpRg~givTRrPlvlqL~~~~~~~-----   78 (657)
T KOG0446|consen    4 MRLLIPLSNPLQDKLEILGSSSFIPLPQIVVVGGQSSGKSSVLESLVGFVFLPRGVGIVTRRPLILQLSIVAGGD-----   78 (657)
T ss_pred             hhhccccchHHHHHHHHhcCCCcccCCceEEecCCCCcchhHHHHhhccccccccccceecccceeecccccCCc-----
Confidence            5678899999999999999 6789999999999999999999999999999999999999999999999864321     


Q ss_pred             hccCCCCcccccccc-ccccccccchhhhhhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHHHH
Q psy5059         138 AAAGTMDLDAWGQFL-HTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDET  216 (1036)
Q Consensus       138 ~~~~~~~~~~w~~~~-~~~~~~~~df~~~r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~~  216 (1036)
                              .+|++|+ |++.+.|.||+                                           +++++|+.++
T Consensus        79 --------~e~~~f~~h~~~~~~~D~~-------------------------------------------~vrkeI~~et  107 (657)
T KOG0446|consen   79 --------EEEASFLTHDKKKRFTDFE-------------------------------------------EVRKEIRSET  107 (657)
T ss_pred             --------ccchhccccccccccCCHH-------------------------------------------HHHHHHHhhH
Confidence                    2566666 65555555554                                           4555556667


Q ss_pred             HHhcCCCCCcCCCcEEEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccch
Q psy5059         217 ERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSE  296 (1036)
Q Consensus       217 ~~~~g~~~~~S~d~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~  296 (1036)
                      +++.|.++|+|+.+|.|+|++|++++||+|||||++++|+++||+|++.+|++|++.||++++||||+|.+||+|+++|+
T Consensus       108 ~~~~g~~kgiS~~pI~L~i~s~~v~~lTLvDlPG~tkvpv~dqp~di~~qI~~mi~~yi~~~~~iILav~~an~d~ats~  187 (657)
T KOG0446|consen  108 DRITGSNKGISPVPITLKIFSALVANLTLVDLPGLTKVPVADQPDDIEEEIKSMIEEYIEKPNRIILAVTPANSDIATSP  187 (657)
T ss_pred             HHhcCCCCCcCCCCceeeecCCCCchhhhcCCCCCcccccCCCCccHHHHHHHHHHHhccccchhhhhccchhhhhhcCH
Confidence            77777888999999999999999999999999999999999999999999999999999999999999999999999987


Q ss_pred             hhhhhhhcCCCCCcccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhcc
Q psy5059         297 SLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETD  376 (1036)
Q Consensus       297 al~l~r~~Dp~g~RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d  376 (1036)
                      |                                                                       +++|++||
T Consensus       188 a-----------------------------------------------------------------------lkiarevD  196 (657)
T KOG0446|consen  188 A-----------------------------------------------------------------------LVVAREVD  196 (657)
T ss_pred             H-----------------------------------------------------------------------HHHHHhhC
Confidence            5                                                                       45555555


Q ss_pred             ccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHH
Q psy5059         377 VDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLK  456 (1036)
Q Consensus       377 ~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~  456 (1036)
                      |.|.|||||+||||+||+||+++++|.|++||+++                                             
T Consensus       197 p~g~RTigvitK~DlmdkGt~~~~~L~g~~~~l~~---------------------------------------------  231 (657)
T KOG0446|consen  197 PGGSRTLEVITKFDFMDKGTNAVTRLVGRPITLKV---------------------------------------------  231 (657)
T ss_pred             CCccchhHHhhhHHhhhcCCcceeeecCCcccccc---------------------------------------------
Confidence            55666666888999999999988777777777664                                             


Q ss_pred             HhhhcCcCCCceeeeecccccccccchHHHHhcCcceeeeecEEEEEcCChhhhhhccCHHHHHHHHHHHhhcccccccc
Q psy5059         457 LAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRKYPTLAS  536 (1036)
Q Consensus       457 la~~vd~~g~RtIgVlTK~Dlmd~gt~~~~il~g~~~~L~LG~~~V~NRs~~di~~~~s~~~al~~E~~fF~~~~~~l~~  536 (1036)
                                                               ||++|+||+|+|+..++++.+++.+|..||.        
T Consensus       232 -----------------------------------------g~v~vvnR~q~di~~~k~~~~al~~e~~~f~--------  262 (657)
T KOG0446|consen  232 -----------------------------------------GYVGVVNRSQSIIDFKKSILEALNDEVPSFE--------  262 (657)
T ss_pred             -----------------------------------------ceeeeeccchhhhhhhhhHHHHHHhhhhhhh--------
Confidence                                                     6777899999999999999999999988874        


Q ss_pred             ccChHHHHHHHHHHHHHHHHhhchhHHHHHHHHHHHHHHHHHhcCCCCchhHHHHHHHHHHHHHHhhhhccccchhHHHh
Q psy5059         537 RNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVEENGIFKFIE  616 (1036)
Q Consensus       537 ~~G~~~L~~~L~~iL~~hIr~~LP~l~~~I~~~l~~~e~~L~~lG~~~~~~~~~L~~~~~~F~~~~~~~le~~~i~~~~e  616 (1036)
                                                                                                      
T Consensus       263 --------------------------------------------------------------------------------  262 (657)
T KOG0446|consen  263 --------------------------------------------------------------------------------  262 (657)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hccChhHHHHHHHHHHHHHHhhcchhHHHHHHHHHHHHhhhccCCCCccchhchhhhhhhhhhHHhhhhcchhhhhhhHH
Q psy5059         617 SKKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVPSLIKSAEEDYQRRTLSEKEKRDCD  696 (1036)
Q Consensus       617 ~~r~p~L~~rI~evv~~lL~~~~~~~~~~i~~li~~E~~yint~hpdf~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  696 (1036)
                                                                                                      
T Consensus       263 --------------------------------------------------------------------------------  262 (657)
T KOG0446|consen  263 --------------------------------------------------------------------------------  262 (657)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             HHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHhhcccchHHhhhcCHHHHHhhhhhhccCCcchhhcc
Q psy5059         697 VIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEASDTKYPTLASRN  776 (1036)
Q Consensus       697 ~i~~~~~sYf~iv~k~~~d~vPk~i~~~lv~~~~~~l~~~l~~~l~~~~~~~~ll~E~~~ia~rR~~~~~~~y~~~~~r~  776 (1036)
                                                                                          +||.|++++++|
T Consensus       263 --------------------------------------------------------------------~~p~y~~~~~~~  274 (657)
T KOG0446|consen  263 --------------------------------------------------------------------SVPSYPILLTIS  274 (657)
T ss_pred             --------------------------------------------------------------------cccccccccccc
Confidence                                                                                356899999999


Q ss_pred             chHHHHHHHHHHHHHHHHhhchhhHHHHHHHHHHHHHHHhhcC--CCCcchHHHHHHHHHHHHHhhcccccccccccccc
Q psy5059         777 GTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYG--EDVSDKSQTLLQIITKFASAYCSTVEGTARNIETT  854 (1036)
Q Consensus       777 G~~~L~~~Ln~~L~~hi~~~LP~l~~~i~~~l~~~~~~l~~~~--d~~~~~~~~lL~~i~~F~~~f~~~I~G~~~~~~~~  854 (1036)
                      |+|||++.||++|.+||+++||+|+++|+.++.+++++|+.||  ++...+...++++++.|+.+|+..++|.++.+.+.
T Consensus       275 g~p~La~~L~~~l~~hi~~~lP~l~~~i~~~~~~~~~el~~~g~~~~~~~~~~~ll~~i~~~~~~~~~~v~g~~~~~~~~  354 (657)
T KOG0446|consen  275 GVPYLALLLPGYLQSHIRDQLPELKTKINKLLEKYQDELNRIGAVDVDLANSAALLAIIREDPRGLRTGVIGKLDLVPTK  354 (657)
T ss_pred             CcchHHHHHHHHHHHHHHhcCcHHHHHHHHHHHHHHHHHHHhcccCCccchhhHHHHHHHHHHHHHHHhhcccccccchh
Confidence            9999999999999999999999999999999999999999999  77778999999999999999999999998876699


Q ss_pred             ccccceeehhhhhhhhhhhccccCCCCCCCHHHHHHHHHhccCCCCCCCCChhHHHHHHHHHHHHhhccHHHHHHHHHHH
Q psy5059         855 ELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQRCVELVHEE  934 (1036)
Q Consensus       855 el~GGAri~~iF~~~F~~~i~~~~p~~~l~~~dIr~aI~n~~G~~~~lfvp~~aFe~Lvk~qI~~l~~Psl~cvdlV~~E  934 (1036)
                      +++|||||+|+||++|+..+.+++|++++++.+|+++|.|++|++++||+|+.|||.+|++||+++++||++||++|++|
T Consensus       355 elsggari~~~F~~~f~~~i~~i~~~~~~~~~~i~~~i~~~~G~~~~lf~p~~afe~lvk~~i~~l~~p~l~~v~~v~~e  434 (657)
T KOG0446|consen  355 ALSGGARINYPFHGGFPGVIKKLPPDRKLLGQNIEKLVSEASGIRPSLFVPESSFESLVKGQIQSLRDPSLKCVEEVHRE  434 (657)
T ss_pred             cccchhhhhhhhhhccchhhhcCCcchhhhHHHHHHHHHhccCCCccccCChHHHHHHHHHHHHHHhhhHHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhccC--C-CC-----------------------------------------C--------------------
Q psy5059         935 MQRIIQHCEKEG--N-IP-----------------------------------------A--------------------  950 (1036)
Q Consensus       935 L~~i~~~~~~~~--~-~p-----------------------------------------~--------------------  950 (1036)
                      |.+++++|....  . ||                                         .                    
T Consensus       435 l~~~~~~~~~~~~l~rfp~l~~~~~~~~~~~~~~~~~~t~~~v~~~i~~e~~yinT~h~df~~~~~~al~~~~~~~~~~~  514 (657)
T KOG0446|consen  435 LVRIVADSIRATELKRFPVLYSELVEIASSLIAEGLDETKKAVKNLIDLEQSYLNTDHPDFRSLTDSALSSVTSPSIAAM  514 (657)
T ss_pred             HHHHHHHHhhhHHHHHhHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHhcCcChhhhhhHHHHHHHhhccccccc
Confidence            999999999852  1 10                                         0                    


Q ss_pred             --------CC---------------C--------------CCCCCHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHH
Q psy5059         951 --------TT---------------S--------------SRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMH  993 (1036)
Q Consensus       951 --------~~---------------~--------------~~~~~~~e~~q~~~i~~lv~sYf~Iv~k~i~D~VPK~Im~  993 (1036)
                              .+               .              ...+++++..+++.|+.++.|||+||+++|+|.|||+|||
T Consensus       515 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~sY~~iv~~~i~d~vpk~i~~  594 (657)
T KOG0446|consen  515 KLISAQLLKEELGECNSALKAIKNAVGSIRLDPSDIVLSRALVLKKRECKETEEISSCPESYLNIVSDKLVDTVPKALNH  594 (657)
T ss_pred             ccccccccccccccccchhhhhcchhhhhhhcccchhhhhhhhcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence                    00               0              0235888889999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHhcC-ccchhHHhcCCHHHHHHhhhhc
Q psy5059         994 FLVNYVKDNLQSELVTHLYK-ADSASELLNESEWVAQRRKEST 1035 (1036)
Q Consensus       994 ~lVn~~~~~l~~~L~~~Ly~-~~~~~~Ll~E~~~i~~~R~~~~ 1035 (1036)
                      +|||.+++.|+++|+++||. .+.++.||+|+|.++++|++|+
T Consensus       595 ~lv~~~k~~l~~~l~~~L~~~~~~~~~ll~E~~~i~~~R~~~~  637 (657)
T KOG0446|consen  595 ELLNEFKDDLPNELDQRLYAGDEQLESLLKEDPRIKRRRELQQ  637 (657)
T ss_pred             HHHHHHHHHHHHHHHHHHHhchhHHHHHHccCHHHHHHHHHHH
Confidence            99999999999999999999 9999999999999999999985


No 2  
>KOG0446|consensus
Probab=100.00  E-value=5.6e-54  Score=516.56  Aligned_cols=468  Identities=35%  Similarity=0.508  Sum_probs=336.8

Q ss_pred             CCCCCCCeEEEeccCCCchHHHHHhhhcCCcccccCCccccccEEEeeccCCCchhhhhhhHHHHHHHHHhhhhcCCCCC
Q psy5059           2 TDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAVINKLQDVFNTVGTDAI   81 (1036)
Q Consensus         2 ~~~~~lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~l~l~~~~~~~~~~~~~~~l~~kL~~~~~~~g~~~i   81 (1036)
                      ++.++||+|||||+||||||||+|++||++|+|||+|+|||||+||||.+....+.+...                    
T Consensus        24 ~~~i~lP~I~vvG~QSsGKSSvLE~lvG~~flpRg~givTRrPlvlqL~~~~~~~~e~~~--------------------   83 (657)
T KOG0446|consen   24 SSFIPLPQIVVVGGQSSGKSSVLESLVGFVFLPRGVGIVTRRPLILQLSIVAGGDEEEAS--------------------   83 (657)
T ss_pred             CCcccCCceEEecCCCCcchhHHHHhhccccccccccceecccceeecccccCCcccchh--------------------
Confidence            467999999999999999999999999999999999999999999999998653211000                    


Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhccCCCCccccccccccccccccc
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRD  161 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~d  161 (1036)
                                                |+       |         |.+...         ..+++              .
T Consensus        84 --------------------------f~-------~---------h~~~~~---------~~D~~--------------~   98 (657)
T KOG0446|consen   84 --------------------------FL-------T---------HDKKKR---------FTDFE--------------E   98 (657)
T ss_pred             --------------------------cc-------c---------cccccc---------cCCHH--------------H
Confidence                                      00       0         000000         00000              0


Q ss_pred             hhhhhhhhhHHHHHhhccCCCcccccc--ccccccc----------ccCCcccCChhHHHHHHHHHHHHhcCCCCCcCCC
Q psy5059         162 FDDIRREIEDETERLAGKNKGICTMDL--DAWGQFL----------HTKDKVFRDFDDIRREIEDETERLAGKNKGICSE  229 (1036)
Q Consensus       162 f~~~r~ei~~e~~r~~~~~~~i~~~~~--~~~~~f~----------~~~~~~~~~~~~I~~~I~~~~~~~~g~~~~~S~d  229 (1036)
                      ..   +||++|+++++|.++|+++.++  ..++.-+          .++.++.+++.+|..+|+.+...+...     ++
T Consensus        99 vr---keI~~et~~~~g~~kgiS~~pI~L~i~s~~v~~lTLvDlPG~tkvpv~dqp~di~~qI~~mi~~yi~~-----~~  170 (657)
T KOG0446|consen   99 VR---KEIRSETDRITGSNKGISPVPITLKIFSALVANLTLVDLPGLTKVPVADQPDDIEEEIKSMIEEYIEK-----PN  170 (657)
T ss_pred             HH---HHHHhhHHHhcCCCCCcCCCCceeeecCCCCchhhhcCCCCCcccccCCCCccHHHHHHHHHHHhccc-----cc
Confidence            11   4789999999999999998775  3443332          355688999999999999988887665     56


Q ss_pred             cEEEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCCCCC
Q psy5059         230 PIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGR  309 (1036)
Q Consensus       230 ~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp~g~  309 (1036)
                      +|.+.|..            -                            |     +.-|++|+..-     |+++||+|.
T Consensus       171 ~iILav~~------------a----------------------------n-----~d~ats~alki-----arevDp~g~  200 (657)
T KOG0446|consen  171 RIILAVTP------------A----------------------------N-----SDIATSPALVV-----AREVDPGGS  200 (657)
T ss_pred             hhhhhccc------------h----------------------------h-----hhhhcCHHHHH-----HHhhCCCcc
Confidence            66666632            1                            1     23355555443     589999999


Q ss_pred             cccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCceEEEEecc
Q psy5059         310 RTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKI  389 (1036)
Q Consensus       310 RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~  389 (1036)
                      |||||++    |.=..+++..                                    ..-.|.+...+.-.+-+||+|+.
T Consensus       201 RTigvit----K~DlmdkGt~------------------------------------~~~~L~g~~~~l~~g~v~vvnR~  240 (657)
T KOG0446|consen  201 RTLEVIT----KFDFMDKGTN------------------------------------AVTRLVGRPITLKVGYVGVVNRS  240 (657)
T ss_pred             chhHHhh----hHHhhhcCCc------------------------------------ceeeecCCccccccceeeeeccc
Confidence            9999985    1111111111                                    00114555566666667766552


Q ss_pred             cccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhhcCcCCCcee
Q psy5059         390 DLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTL  469 (1036)
Q Consensus       390 Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd~~g~RtI  469 (1036)
                      =.-                    +.+.+                                    -...|..         
T Consensus       241 q~d--------------------i~~~k------------------------------------~~~~al~---------  255 (657)
T KOG0446|consen  241 QSI--------------------IDFKK------------------------------------SILEALN---------  255 (657)
T ss_pred             hhh--------------------hhhhh------------------------------------hHHHHHH---------
Confidence            110                    00000                                    0000000         


Q ss_pred             eeecccccccccchHHHHhcCcceeeeecEEEEEcCChhhhhhccCHHHHHHHHHHHhhccccccccccChHHHHHHHHH
Q psy5059         470 AVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRKYPTLASRNGTLYLAKTLNR  549 (1036)
Q Consensus       470 gVlTK~Dlmd~gt~~~~il~g~~~~L~LG~~~V~NRs~~di~~~~s~~~al~~E~~fF~~~~~~l~~~~G~~~L~~~L~~  549 (1036)
                                   ++.                                ........     |+.+..++|+++|++.|+.
T Consensus       256 -------------~e~--------------------------------~~f~~~p~-----y~~~~~~~g~p~La~~L~~  285 (657)
T KOG0446|consen  256 -------------DEV--------------------------------PSFESVPS-----YPILLTISGVPYLALLLPG  285 (657)
T ss_pred             -------------hhh--------------------------------hhhhcccc-----ccccccccCcchHHHHHHH
Confidence                         000                                00001111     2456667999999999999


Q ss_pred             HHHHHHHhhchhHHHHHHHHHHHHHHHHHhcC--CCCchhHHHHHHHHHHHHHHhhhhcccc----------------ch
Q psy5059         550 LLMHHIRDCLPDLKTRVNVMISQFQTLLNSYG--EDVSDKSQTLLQIITKFASAYCSTVEEN----------------GI  611 (1036)
Q Consensus       550 iL~~hIr~~LP~l~~~I~~~l~~~e~~L~~lG--~~~~~~~~~L~~~~~~F~~~~~~~le~~----------------~i  611 (1036)
                      .|..||++++|.+++.|+..+.+++++|+++|  ++.......|++++++|...+|..+++.                ++
T Consensus       286 ~l~~hi~~~lP~l~~~i~~~~~~~~~el~~~g~~~~~~~~~~~ll~~i~~~~~~~~~~v~g~~~~~~~~elsggari~~~  365 (657)
T KOG0446|consen  286 YLQSHIRDQLPELKTKINKLLEKYQDELNRIGAVDVDLANSAALLAIIREDPRGLRTGVIGKLDLVPTKALSGGARINYP  365 (657)
T ss_pred             HHHHHHHhcCcHHHHHHHHHHHHHHHHHHHhcccCCccchhhHHHHHHHHHHHHHHHhhcccccccchhcccchhhhhhh
Confidence            99999999999999999999999999999999  4445556788999999988887765321                11


Q ss_pred             hH-----------------------------------------H--------------------------------H---
Q psy5059         612 FK-----------------------------------------F--------------------------------I---  615 (1036)
Q Consensus       612 ~~-----------------------------------------~--------------------------------~---  615 (1036)
                      |+                                         |                                +   
T Consensus       366 F~~~f~~~i~~i~~~~~~~~~~i~~~i~~~~G~~~~lf~p~~afe~lvk~~i~~l~~p~l~~v~~v~~el~~~~~~~~~~  445 (657)
T KOG0446|consen  366 FHGGFPGVIKKLPPDRKLLGQNIEKLVSEASGIRPSLFVPESSFESLVKGQIQSLRDPSLKCVEEVHRELVRIVADSIRA  445 (657)
T ss_pred             hhhccchhhhcCCcchhhhHHHHHHHHHhccCCCccccCChHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHhhh
Confidence            10                                         0                                0   


Q ss_pred             -hhccChhHHHHHHHHHHHHHHhhcchhHHHHHHHHHHHHhhhccCCCCccchhc-hhhhhhh---------------hh
Q psy5059         616 -ESKKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAA-LVPSLIK---------------SA  678 (1036)
Q Consensus       616 -e~~r~p~L~~rI~evv~~lL~~~~~~~~~~i~~li~~E~~yint~hpdf~~~~~-~~~~~~~---------------~~  678 (1036)
                       +..|||.|++++.+++.+++++++.++++||.++|+||.+||||.||||.++.+ ++.....               ..
T Consensus       446 ~~l~rfp~l~~~~~~~~~~~~~~~~~~t~~~v~~~i~~e~~yinT~h~df~~~~~~al~~~~~~~~~~~~~~~~~~~~~~  525 (657)
T KOG0446|consen  446 TELKRFPVLYSELVEIASSLIAEGLDETKKAVKNLIDLEQSYLNTDHPDFRSLTDSALSSVTSPSIAAMKLISAQLLKEE  525 (657)
T ss_pred             HHHHHhHHHHHHHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHhcCcChhhhhhHHHHHHHhhcccccccccccccccccc
Confidence             125899999999999999999999999999999999999999999999999885 3322211               00


Q ss_pred             ---h----HHhh-----------------hhcchhhhhhhHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHH
Q psy5059         679 ---E----EDYQ-----------------RRTLSEKEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQ  734 (1036)
Q Consensus       679 ---~----~~~~-----------------~~~~~~~~~~~~~~i~~~~~sYf~iv~k~~~d~vPk~i~~~lv~~~~~~l~  734 (1036)
                         .    ..+.                 ...+++++..+++.|+.++.|||+||+|+|.|+|||+|||+|||+++++||
T Consensus       526 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~sY~~iv~~~i~d~vpk~i~~~lv~~~k~~l~  605 (657)
T KOG0446|consen  526 LGECNSALKAIKNAVGSIRLDPSDIVLSRALVLKKRECKETEEISSCPESYLNIVSDKLVDTVPKALNHELLNEFKDDLP  605 (657)
T ss_pred             cccccchhhhhcchhhhhhhcccchhhhhhhhcchhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence               0    0000                 124567778899999999999999999999999999999999999999999


Q ss_pred             HHHHHHhhc-ccchHHhhhcCHHHHHhhhhhhcc
Q psy5059         735 SELVTHLYK-ADSASELLNESEWVAQRRKEASDT  767 (1036)
Q Consensus       735 ~~l~~~l~~-~~~~~~ll~E~~~ia~rR~~~~~~  767 (1036)
                      ++|+++||+ .+.+++||+|+|.+++||+.+..+
T Consensus       606 ~~l~~~L~~~~~~~~~ll~E~~~i~~~R~~~~~~  639 (657)
T KOG0446|consen  606 NELDQRLYAGDEQLESLLKEDPRIKRRRELQQKR  639 (657)
T ss_pred             HHHHHHHHhchhHHHHHHccCHHHHHHHHHHHHH
Confidence            999999999 999999999999999999988765


No 3  
>smart00053 DYNc Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and  plasma membrane following an exocytic event.
Probab=100.00  E-value=1.3e-46  Score=405.19  Aligned_cols=180  Identities=58%  Similarity=0.940  Sum_probs=157.9

Q ss_pred             hhhHHHHHHHHHhhhhcCC-CCCCCCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhh
Q psy5059          60 RTAAAVINKLQDVFNTVGT-DAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTA  138 (1036)
Q Consensus        60 ~~~~~l~~kL~~~~~~~g~-~~i~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~  138 (1036)
                      ..+++++|+|+++++.+|. +.+++|+|||||+||||||||||+|+|.+|+|++.|+|||||++|+|++.+.        
T Consensus         2 ~~~~~l~~~i~~l~~~~G~~~~i~~p~i~vvG~~~~GKSt~l~~i~g~~~~~~~~g~~t~~p~~i~l~~~~~--------   73 (240)
T smart00053        2 EKLIPLVNKLQDAFSALGQEKDLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLINSST--------   73 (240)
T ss_pred             ccHHHHHHHHHHHHHHcCCCCCCCCCeEEEEcCCCccHHHHHHHHhCCCccccCCCcccccceEEEccCCCC--------
Confidence            4688999999999878885 6799999999999999999999999999999999999999999999987432        


Q ss_pred             ccCCCCccccccccccccccccchhhhhhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHHHHHH
Q psy5059         139 AAGTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETER  218 (1036)
Q Consensus       139 ~~~~~~~~~w~~~~~~~~~~~~df~~~r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~~~~  218 (1036)
                              +|++|++.                                           ++..+.+|+++++.|+.+++.
T Consensus        74 --------~~~~~~~~-------------------------------------------~~~~~~~~~~v~~~i~~~~~~  102 (240)
T smart00053       74 --------EYAEFLHC-------------------------------------------KGKKFTDFDEVRNEIEAETDR  102 (240)
T ss_pred             --------cceEEEec-------------------------------------------CCcccCCHHHHHHHHHHHHHH
Confidence                    35555443                                           334456777888888888888


Q ss_pred             hcCCCCCcCCCcEEEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhh
Q psy5059         219 LAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESL  298 (1036)
Q Consensus       219 ~~g~~~~~S~d~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al  298 (1036)
                      +.|.+++||+++|.|+|+||++|+|+||||||+++.+.++|+.++.+++++|++.||+++++|||+|++|++|+++++++
T Consensus       103 ~~~~~~~~s~~~i~l~i~~p~~~~ltLIDlPGl~~~~~~~~~~~~~~~i~~lv~~yi~~~~~IIL~Vvda~~d~~~~d~l  182 (240)
T smart00053      103 VTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVAVGDQPPDIEEQIKDMIKQFISKEECLILAVTPANVDLANSDAL  182 (240)
T ss_pred             hcCCCCcccCcceEEEEeCCCCCceEEEeCCCccccccCCccHHHHHHHHHHHHHHHhCccCeEEEEEECCCCCCchhHH
Confidence            88999999999999999999999999999999998888888888999999999999999999999999999998887633


No 4  
>PF01031 Dynamin_M:  Dynamin central region;  InterPro: IPR000375 Dynamin is a microtubule-associated force-producing protein of 100 Kd which is involved in the production of microtubule bundles. At the N terminus of dynamin is a GTPase domain (see IPR001401 from INTERPRO), and at the C terminus is a PH domain (see IPR001849 from INTERPRO). Between these two domains lies a central region of unknown function, which this entry represents.; GO: 0005525 GTP binding; PDB: 3ZVR_A 2AKA_B 2X2F_D 2X2E_D 3SNH_A 3ZYS_D 3ZYC_D 1JWY_B 1JX2_B 3SZR_A ....
Probab=100.00  E-value=6.4e-42  Score=382.38  Aligned_cols=179  Identities=42%  Similarity=0.687  Sum_probs=160.2

Q ss_pred             cCCcchhhccchHHHHHHHHHHHHHHHHhhchhhHHHHHHHHHHHHHHHhhcCCCCc----chHHHHHHHHHHHHHhhcc
Q psy5059         767 TKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVS----DKSQTLLQIITKFASAYCS  842 (1036)
Q Consensus       767 ~~y~~~~~r~G~~~L~~~Ln~~L~~hi~~~LP~l~~~i~~~l~~~~~~l~~~~d~~~----~~~~~lL~~i~~F~~~f~~  842 (1036)
                      |.|..+++||||++|+++||+.|++||+++||+|+.+|+.+|++++++|+.||++++    ++...|++++++|+..|.+
T Consensus        48 ~~~~~~~~~~G~~~L~~~L~~~L~~~I~~~LP~l~~~I~~~l~~~~~eL~~lG~~~~~~~~~~~~~l~~~~~~f~~~~~~  127 (295)
T PF01031_consen   48 PWYSSPADRCGTPALRKRLSELLVEHIRKSLPSLKSEIQKKLQEAEKELKRLGPPRPETPEEQRAYLLQIISKFSRIFKD  127 (295)
T ss_dssp             TTTGGGGGGSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTHHHCSSSCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             cccCCcccccchHHHHHHHHHHHHHHHHHhCcHHHHHHHHHHHHHHHHHHHhCCCCCCCHHHHHHHHHHHHHHHHHHHHH
Confidence            356667889999999999999999999999999999999999999999999998775    7899999999999999999


Q ss_pred             ccccccc-cccccccccceeehhhhhhhhhhhccccCCCCCCCHHHHHHHHHhccCCCCCCCCChhHHHHHHHHHHHHhh
Q psy5059         843 TVEGTAR-NIETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLE  921 (1036)
Q Consensus       843 ~I~G~~~-~~~~~el~GGAri~~iF~~~F~~~i~~~~p~~~l~~~dIr~aI~n~~G~~~~lfvp~~aFe~Lvk~qI~~l~  921 (1036)
                      .|+|... ...+.++.|||||+++|+++|...+.+++|+++++++||+++|+|++|+++|+|+|+.|||.||++||++|+
T Consensus       128 ~i~G~~~~~~~~~~l~~~ari~~~f~~~~~~~~~~~~~~~~~~~~eI~~~i~~~~G~elp~f~p~~afe~Li~~~i~~l~  207 (295)
T PF01031_consen  128 AIDGEYSDEFSTNELRGGARIRYIFNEWFDKFLEKIDPFEDLSDEEIRTAIRNSRGRELPGFVPESAFESLIRKQIEKLE  207 (295)
T ss_dssp             HHTT-------TTS--HHHHHHHHHHHHHHHHHHHTSHHHHHHHHHHHHHHHH--S-SSS-SCCHHHHHHHHHHHHHTTH
T ss_pred             HhcCCccccccccccchhhHHHHHHHhhhhhhhhhhccccchhHHHHHHHHHhhcccccccchhHHHHHHHHHHHHHHHH
Confidence            9999887 589999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccHHHHHHHHHHHHHHHHHHHhcc
Q psy5059         922 EPSQRCVELVHEEMQRIIQHCEKE  945 (1036)
Q Consensus       922 ~Psl~cvdlV~~EL~~i~~~~~~~  945 (1036)
                      +||++||+.|+++|.+++.+|..+
T Consensus       208 ~Pa~~cv~~V~~~l~~i~~~~~~~  231 (295)
T PF01031_consen  208 EPALQCVEEVHEELQRIVEQVLEK  231 (295)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHCH
T ss_pred             hHHHHHHHHHHHHHHHHHHhhcch
Confidence            999999999999999999998753


No 5  
>COG1160 Predicted GTPases [General function prediction only]
Probab=99.97  E-value=5.2e-31  Score=298.74  Aligned_cols=252  Identities=20%  Similarity=0.311  Sum_probs=214.2

Q ss_pred             CCeEEEeccCCCchHHHHHhhhc-----CCccc-----------------------------------------------
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVG-----KSFLP-----------------------------------------------   34 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g-----~~~~p-----------------------------------------------   34 (1036)
                      .|.||+||+||||||||||+|+|     +++.|                                               
T Consensus         3 ~~~VAIVGRPNVGKSTLFNRL~g~r~AIV~D~pGvTRDr~y~~~~~~~~~f~lIDTgGl~~~~~~~l~~~i~~Qa~~Ai~   82 (444)
T COG1160           3 TPVVAIVGRPNVGKSTLFNRLTGRRIAIVSDTPGVTRDRIYGDAEWLGREFILIDTGGLDDGDEDELQELIREQALIAIE   82 (444)
T ss_pred             CCEEEEECCCCCcHHHHHHHHhCCeeeEeecCCCCccCCccceeEEcCceEEEEECCCCCcCCchHHHHHHHHHHHHHHH
Confidence            39999999999999999999999     77778                                               


Q ss_pred             --------------------------ccCCccccccEEEeeccCCCch---------------------hhhhhhHHHHH
Q psy5059          35 --------------------------RGIGIVTRRPLILQLYYCPKDD---------------------REKRTAAAVIN   67 (1036)
Q Consensus        35 --------------------------r~~~~~trrpl~l~l~~~~~~~---------------------~~~~~~~~l~~   67 (1036)
                                                |..+    +|++|++||+++..                     .|++++.+|+|
T Consensus        83 eADvilfvVD~~~Git~~D~~ia~~Lr~~~----kpviLvvNK~D~~~~e~~~~efyslG~g~~~~ISA~Hg~Gi~dLld  158 (444)
T COG1160          83 EADVILFVVDGREGITPADEEIAKILRRSK----KPVILVVNKIDNLKAEELAYEFYSLGFGEPVPISAEHGRGIGDLLD  158 (444)
T ss_pred             hCCEEEEEEeCCCCCCHHHHHHHHHHHhcC----CCEEEEEEcccCchhhhhHHHHHhcCCCCceEeehhhccCHHHHHH
Confidence                                      4333    59999999999843                     67889999999


Q ss_pred             HHHHhhhhcCC--CC---CCCCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhccCC
Q psy5059          68 KLQDVFNTVGT--DA---IQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGT  142 (1036)
Q Consensus        68 kL~~~~~~~g~--~~---i~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~~~  142 (1036)
                      .+-..++ ...  ..   .+..+|+++|.+++|||||+++|+|.+-                                  
T Consensus       159 ~v~~~l~-~~e~~~~~~~~~~ikiaiiGrPNvGKSsLiN~ilgeeR----------------------------------  203 (444)
T COG1160         159 AVLELLP-PDEEEEEEEETDPIKIAIIGRPNVGKSSLINAILGEER----------------------------------  203 (444)
T ss_pred             HHHhhcC-CcccccccccCCceEEEEEeCCCCCchHHHHHhccCce----------------------------------
Confidence            9999874 221  11   2468999999999999999999998871                                  


Q ss_pred             CCccccccccccccccccchhhhhhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHHHHHHhcCC
Q psy5059         143 MDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGK  222 (1036)
Q Consensus       143 ~~~~~w~~~~~~~~~~~~df~~~r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~~~~~~g~  222 (1036)
                                                                                             ..++..+|+
T Consensus       204 -----------------------------------------------------------------------~Iv~~~aGT  212 (444)
T COG1160         204 -----------------------------------------------------------------------VIVSDIAGT  212 (444)
T ss_pred             -----------------------------------------------------------------------EEecCCCCc
Confidence                                                                                   002234455


Q ss_pred             CCCcCCCcEEEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhh
Q psy5059         223 NKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAK  302 (1036)
Q Consensus       223 ~~~~S~d~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r  302 (1036)
                          |.|+|...+.. +.-.+.||||.|+.+..+-.+..+..+.+|.+  +.|...+ ++++|.+|...+..||      
T Consensus       213 ----TRD~I~~~~e~-~~~~~~liDTAGiRrk~ki~e~~E~~Sv~rt~--~aI~~a~-vvllviDa~~~~~~qD------  278 (444)
T COG1160         213 ----TRDSIDIEFER-DGRKYVLIDTAGIRRKGKITESVEKYSVARTL--KAIERAD-VVLLVIDATEGISEQD------  278 (444)
T ss_pred             ----cccceeeeEEE-CCeEEEEEECCCCCcccccccceEEEeehhhH--hHHhhcC-EEEEEEECCCCchHHH------
Confidence                78999999986 67889999999999988877777777777777  7888888 7888888998888887      


Q ss_pred             hcCCCCCcccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCce
Q psy5059         303 ETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRT  382 (1036)
Q Consensus       303 ~~Dp~g~RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rt  382 (1036)
                                                                                        +++|+.+...|+..
T Consensus       279 ------------------------------------------------------------------~~ia~~i~~~g~~~  292 (444)
T COG1160         279 ------------------------------------------------------------------LRIAGLIEEAGRGI  292 (444)
T ss_pred             ------------------------------------------------------------------HHHHHHHHHcCCCe
Confidence                                                                              88999999999999


Q ss_pred             EEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhhcC
Q psy5059         383 LAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETD  462 (1036)
Q Consensus       383 i~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd  462 (1036)
                      |+|+||||++++.+..+                      +.++..++.+++|+.|+|+++|||+++++.+++++.+.+++
T Consensus       293 vIvvNKWDl~~~~~~~~----------------------~~~k~~i~~~l~~l~~a~i~~iSA~~~~~i~~l~~~i~~~~  350 (444)
T COG1160         293 VIVVNKWDLVEEDEATM----------------------EEFKKKLRRKLPFLDFAPIVFISALTGQGLDKLFEAIKEIY  350 (444)
T ss_pred             EEEEEccccCCchhhHH----------------------HHHHHHHHHHhccccCCeEEEEEecCCCChHHHHHHHHHHH
Confidence            99999999999866665                      88999999999999999999999999999999999999999


Q ss_pred             cCCCceee
Q psy5059         463 VDGRRTLA  470 (1036)
Q Consensus       463 ~~g~RtIg  470 (1036)
                      ....++++
T Consensus       351 ~~~~~ri~  358 (444)
T COG1160         351 ECATRRIS  358 (444)
T ss_pred             HHhccccC
Confidence            88887775


No 6  
>KOG0447|consensus
Probab=99.97  E-value=2.5e-29  Score=282.06  Aligned_cols=289  Identities=29%  Similarity=0.446  Sum_probs=200.6

Q ss_pred             hhhhhhHHHHHHHHHhhhhcCC---CCCCCCceEEeCcCCCChhhHHhhhcCCCcCccccc-ccccCceEEEEeeCCCCc
Q psy5059          57 REKRTAAAVINKLQDVFNTVGT---DAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIG-IVTRRPLILQLYYCPKDD  132 (1036)
Q Consensus        57 ~~~~~~~~l~~kL~~~~~~~g~---~~i~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G-~cTR~Pl~l~l~~~~~~~  132 (1036)
                      .-.+.++++....-|+++.-..   ..-.||++|||||||+||+||||.|+.-.++|||+| +.||.|..+.|...|-..
T Consensus       279 klKkSLIDMYSEVLD~Ls~YD~sYnt~DhLPRVVVVGDQSaGKTSVLEmiAqARIFPRGSGEMMTRaPVKVTLsEGPyHV  358 (980)
T KOG0447|consen  279 KLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIFPRGSGEMMTRSPVKVTLSEGPHHV  358 (980)
T ss_pred             HHHHHHHHHHHHHHHHHhcccccccccccCceEEEEcCccccchHHHHHHHHhccCcCCCcceeccCCeEEEeccCcchh
Confidence            3445777888888777774332   234599999999999999999999999999999999 999999999998754311


Q ss_pred             hhhhhhccCCCCccccccccccccccccchhhhhhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHH
Q psy5059         133 REKRTAAAGTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREI  212 (1036)
Q Consensus       133 ~~~~~~~~~~~~~~~w~~~~~~~~~~~~df~~~r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I  212 (1036)
                      .                        -|+|.+                            .+|-.+   +..|+.+++.++
T Consensus       359 A------------------------qFrDSs----------------------------REfDLT---KE~DLq~LR~e~  383 (980)
T KOG0447|consen  359 A------------------------LFKDSS----------------------------REFDLT---KEEDLAALRHEI  383 (980)
T ss_pred             h------------------------hhcccc----------------------------cccccc---chhHHHHHHHHH
Confidence            0                        011110                            112222   346778888888


Q ss_pred             HHHHHHhcCCCCCcCCCcEEEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEecccccc
Q psy5059         213 EDETERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDM  292 (1036)
Q Consensus       213 ~~~~~~~~g~~~~~S~d~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~  292 (1036)
                      +-.+..-...++.+|+.+|.+.+.||+.+.+.||||||++..-+.+-..|..+-|-.|                      
T Consensus       384 E~RMr~sVr~GkTVSnEvIsltVKGPgLqRMVLVDLPGvIsTvT~dMA~dTKd~I~~m----------------------  441 (980)
T KOG0447|consen  384 ELRMRKNVKEGCTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSI----------------------  441 (980)
T ss_pred             HHHHHhcccCCcccccceEEEeecCCCcceeEEecCCchhhhhcccccccchHHHHHH----------------------
Confidence            8777766777899999999999999999999999999997644433333333344444                      


Q ss_pred             ccchhhhhhhhcCCCCCcccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHh
Q psy5059         293 ATSESLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLA  372 (1036)
Q Consensus       293 ~~s~al~l~r~~Dp~g~RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la  372 (1036)
                                                                       .+.|+.||||||||+-++.+|+|.|-..-|.
T Consensus       442 -------------------------------------------------sKayM~NPNAIILCIQDGSVDAERSnVTDLV  472 (980)
T KOG0447|consen  442 -------------------------------------------------SKAYMQNPNAIILCIQDGSVDAERSIVTDLV  472 (980)
T ss_pred             -------------------------------------------------HHHHhcCCCeEEEEeccCCcchhhhhHHHHH
Confidence                                                             4555555555555555555556666667788


Q ss_pred             hhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhH
Q psy5059         373 KETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATS  452 (1036)
Q Consensus       373 ~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~q  452 (1036)
                      -..||.|+|||.|+||.|+.++.-.                                                       
T Consensus       473 sq~DP~GrRTIfVLTKVDlAEknlA-------------------------------------------------------  497 (980)
T KOG0447|consen  473 SQMDPHGRRTIFVLTKVDLAEKNVA-------------------------------------------------------  497 (980)
T ss_pred             HhcCCCCCeeEEEEeecchhhhccC-------------------------------------------------------
Confidence            8888888889999999998754210                                                       


Q ss_pred             HHHHHhhhcCcCCCceeeeecccccccccchHHHHhcCcceeee-ecEEEEEcCChhhhhhccCHHHHHHHHHHHhhcc-
Q psy5059         453 ESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVK-LGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRK-  530 (1036)
Q Consensus       453 eil~la~~vd~~g~RtIgVlTK~Dlmd~gt~~~~il~g~~~~L~-LG~~~V~NRs~~di~~~~s~~~al~~E~~fF~~~-  530 (1036)
                                           -||      ....++.|+..|++ ||||+|+.-..   +.+.++..-.+-|+.||.+. 
T Consensus       498 ---------------------~Pd------RI~kIleGKLFPMKALGYfaVVTGrG---nssdSIdaIR~YEE~FF~nSk  547 (980)
T KOG0447|consen  498 ---------------------SPS------RIQQIIEGKLFPMKALGYFAVVTGKG---NSSESIEAIREYEEEFFQNSK  547 (980)
T ss_pred             ---------------------CHH------HHHHHHhcCccchhhcceeEEEecCC---CcchhHHHHHHHHHHHhhhhH
Confidence                                 111      23568899999996 79999987422   22345666678899999862 


Q ss_pred             -cc-c-c-ccccChHHHHHHHHHHHHHHHH
Q psy5059         531 -YP-T-L-ASRNGTLYLAKTLNRLLMHHIR  556 (1036)
Q Consensus       531 -~~-~-l-~~~~G~~~L~~~L~~iL~~hIr  556 (1036)
                       +. . + ++.+.+.+|.-..+..+-..+|
T Consensus       548 Ll~~~vlkphQvTtRNlSLAVSDcFWkMVR  577 (980)
T KOG0447|consen  548 LLKTSMLKAHQVTTRNLSLAVSDCFWKMVR  577 (980)
T ss_pred             HHHhhccchhhhcccchhHHHHHHHHHHHH
Confidence             21 1 2 4555666666666666655555


No 7  
>smart00053 DYNc Dynamin, GTPase. Large GTPases that mediate vesicle trafficking. Dynamin participates in the endocytic uptake of receptors, associated ligands, and  plasma membrane following an exocytic event.
Probab=99.90  E-value=2.2e-23  Score=225.10  Aligned_cols=204  Identities=42%  Similarity=0.650  Sum_probs=144.1

Q ss_pred             CCCCCeEEEeccCCCchHHHHHhhhcCCcccccCCccccccEEEeeccCCCchhhhhhhHHHHHHHHHhhhhcCCCCCCC
Q psy5059           4 AIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAVINKLQDVFNTVGTDAIQL   83 (1036)
Q Consensus         4 ~~~lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~l~l~~~~~~~~~~~~~~~l~~kL~~~~~~~g~~~i~l   83 (1036)
                      .+++|+|||||.||+|||||+|+|.|.+|+|++.|.|||+|+.+++.+.......                         
T Consensus        23 ~i~~p~i~vvG~~~~GKSt~l~~i~g~~~~~~~~g~~t~~p~~i~l~~~~~~~~~-------------------------   77 (240)
T smart00053       23 DLDLPQIAVVGGQSAGKSSVLENFVGRDFLPRGSGIVTRRPLILQLINSSTEYAE-------------------------   77 (240)
T ss_pred             CCCCCeEEEEcCCCccHHHHHHHHhCCCccccCCCcccccceEEEccCCCCcceE-------------------------
Confidence            4899999999999999999999999999999999999999999999875331100                         


Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhccCCCCccccccccccccccccchh
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFD  163 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~df~  163 (1036)
                                              |+              ..   +..                          .+.+|.
T Consensus        78 ------------------------~~--------------~~---~~~--------------------------~~~~~~   90 (240)
T smart00053       78 ------------------------FL--------------HC---KGK--------------------------KFTDFD   90 (240)
T ss_pred             ------------------------EE--------------ec---CCc--------------------------ccCCHH
Confidence                                    00              00   000                          124788


Q ss_pred             hhhhhhhHHHHHhhccCCCcccccc--cccccc------cccCCccc----CChhHHHHHHHHHHHHhcCCCCCcCCCcE
Q psy5059         164 DIRREIEDETERLAGKNKGICTMDL--DAWGQF------LHTKDKVF----RDFDDIRREIEDETERLAGKNKGICSEPI  231 (1036)
Q Consensus       164 ~~r~ei~~e~~r~~~~~~~i~~~~~--~~~~~f------~~~~~~~~----~~~~~I~~~I~~~~~~~~g~~~~~S~d~I  231 (1036)
                      +++.+|+.+++++++.++++++..+  +.+++.      ..+||...    .+..++.+.+++.+..+...     ++.|
T Consensus        91 ~v~~~i~~~~~~~~~~~~~~s~~~i~l~i~~p~~~~ltLIDlPGl~~~~~~~~~~~~~~~i~~lv~~yi~~-----~~~I  165 (240)
T smart00053       91 EVRNEIEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVAVGDQPPDIEEQIKDMIKQFISK-----EECL  165 (240)
T ss_pred             HHHHHHHHHHHHhcCCCCcccCcceEEEEeCCCCCceEEEeCCCccccccCCccHHHHHHHHHHHHHHHhC-----ccCe
Confidence            9999999999999998888876543  233322      12444321    22355667777777666554     4446


Q ss_pred             EEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCCCCCcc
Q psy5059         232 ILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRT  311 (1036)
Q Consensus       232 ~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp~g~RT  311 (1036)
                      .|-+....         -|+       .+.|..+.++                                           
T Consensus       166 IL~Vvda~---------~d~-------~~~d~l~ia~-------------------------------------------  186 (240)
T smart00053      166 ILAVTPAN---------VDL-------ANSDALKLAK-------------------------------------------  186 (240)
T ss_pred             EEEEEECC---------CCC-------CchhHHHHHH-------------------------------------------
Confidence            66664211         011       1122211111                                           


Q ss_pred             cceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCceEEEEecccc
Q psy5059         312 LDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDL  391 (1036)
Q Consensus       312 igvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~Dl  391 (1036)
                                                                                    ++|+.|+|||||+||+|.
T Consensus       187 --------------------------------------------------------------~ld~~~~rti~ViTK~D~  204 (240)
T smart00053      187 --------------------------------------------------------------EVDPQGERTIGVITKLDL  204 (240)
T ss_pred             --------------------------------------------------------------HHHHcCCcEEEEEECCCC
Confidence                                                                          246789999999999999


Q ss_pred             cCCCchhhhhhcCcccccccccccccchHHHHHH
Q psy5059         392 MDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIK  425 (1036)
Q Consensus       392 ~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~  425 (1036)
                      +++|+++.++|.|+.+||+|||++++++.+++++
T Consensus       205 ~~~~~~~~~~~~~~~~~l~~g~~~v~nr~~~d~~  238 (240)
T smart00053      205 MDEGTDARDILENKLLPLRRGYIGVVNRSQKDIE  238 (240)
T ss_pred             CCccHHHHHHHhCCccccCCCEEEEECCChHHhh
Confidence            9999999999999999999999999997776553


No 8  
>PF01031 Dynamin_M:  Dynamin central region;  InterPro: IPR000375 Dynamin is a microtubule-associated force-producing protein of 100 Kd which is involved in the production of microtubule bundles. At the N terminus of dynamin is a GTPase domain (see IPR001401 from INTERPRO), and at the C terminus is a PH domain (see IPR001849 from INTERPRO). Between these two domains lies a central region of unknown function, which this entry represents.; GO: 0005525 GTP binding; PDB: 3ZVR_A 2AKA_B 2X2F_D 2X2E_D 3SNH_A 3ZYS_D 3ZYC_D 1JWY_B 1JX2_B 3SZR_A ....
Probab=99.85  E-value=2.3e-21  Score=216.99  Aligned_cols=179  Identities=41%  Similarity=0.636  Sum_probs=147.2

Q ss_pred             eeeecEEEEEcCChhhhhhccCHHHHHHHHHHHhhcc--ccccccccChHHHHHHHHHHHHHHHHhhchhHHHHHHHHHH
Q psy5059         494 PVKLGIIGVVNRSQQDIIDNKSIKDAIKDEAAFLQRK--YPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMIS  571 (1036)
Q Consensus       494 ~L~LG~~~V~NRs~~di~~~~s~~~al~~E~~fF~~~--~~~l~~~~G~~~L~~~L~~iL~~hIr~~LP~l~~~I~~~l~  571 (1036)
                      ||+||||+|+||||+|+.++.|+.+++.+|..||.++  |+..++++||++|+.+|+++|.+||+++||.|+.+|+..+.
T Consensus        11 pLklGy~~V~nrsq~di~~~~s~~~a~~~E~~fF~~~~~~~~~~~~~G~~~L~~~L~~~L~~~I~~~LP~l~~~I~~~l~   90 (295)
T PF01031_consen   11 PLKLGYVGVKNRSQQDINDGKSIEEARQKEKEFFSNHPWYSSPADRCGTPALRKRLSELLVEHIRKSLPSLKSEIQKKLQ   90 (295)
T ss_dssp             --TT-EEEE--S-HHHHHTTEEHHHHHHHHHHHHHHSTTTGGGGGGSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ccCCCeEEEecCCccccccCCCHHHHHHHHHHHHhcccccCCcccccchHHHHHHHHHHHHHHHHHhCcHHHHHHHHHHH
Confidence            3445899999999999999999999999999999886  88888999999999999999999999999999999999999


Q ss_pred             HHHHHHHhcCCCCc----hhHHHHHHHHHHHHHHhhhhccccch-----------------hH-----------------
Q psy5059         572 QFQTLLNSYGEDVS----DKSQTLLQIITKFASAYCSTVEENGI-----------------FK-----------------  613 (1036)
Q Consensus       572 ~~e~~L~~lG~~~~----~~~~~L~~~~~~F~~~~~~~le~~~i-----------------~~-----------------  613 (1036)
                      +++.+|++||++++    +.+.+|++++++|++.+...++|.+-                 |+                 
T Consensus        91 ~~~~eL~~lG~~~~~~~~~~~~~l~~~~~~f~~~~~~~i~G~~~~~~~~~~l~~~ari~~~f~~~~~~~~~~~~~~~~~~  170 (295)
T PF01031_consen   91 EAEKELKRLGPPRPETPEEQRAYLLQIISKFSRIFKDAIDGEYSDEFSTNELRGGARIRYIFNEWFDKFLEKIDPFEDLS  170 (295)
T ss_dssp             HHHHHHHTHHHCSSSCHHHHHHHHHHHHHHHHHHHHHHHTT-------TTS--HHHHHHHHHHHHHHHHHHHTSHHHHHH
T ss_pred             HHHHHHHHhCCCCCCCHHHHHHHHHHHHHHHHHHHHHHhcCCccccccccccchhhHHHHHHHhhhhhhhhhhccccchh
Confidence            99999999999988    45679999999999888777654321                 10                 


Q ss_pred             ------------------------H-------H----------------------------hhccChhHHHHHHHHHHHH
Q psy5059         614 ------------------------F-------I----------------------------ESKKNPALHERIVEVVTQL  634 (1036)
Q Consensus       614 ------------------------~-------~----------------------------e~~r~p~L~~rI~evv~~l  634 (1036)
                                              |       +                            +..+||.|++++.+++.++
T Consensus       171 ~~eI~~~i~~~~G~elp~f~p~~afe~Li~~~i~~l~~Pa~~cv~~V~~~l~~i~~~~~~~~~~~fp~L~~~i~~~v~~~  250 (295)
T PF01031_consen  171 DEEIRTAIRNSRGRELPGFVPESAFESLIRKQIEKLEEPALQCVEEVHEELQRIVEQVLEKEFERFPNLKEAIKEAVQQL  250 (295)
T ss_dssp             HHHHHHHHHH--S-SSS-SCCHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHHHCHHHTTSHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHhhcccccccchhHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHhhcchhcCCchHHHHHHHHHHHHH
Confidence                                    0       0                            1258999999999999999


Q ss_pred             HHhhcchhHHHHHHHHHHHHhhhccCCCCccchhchhh
Q psy5059         635 LRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVP  672 (1036)
Q Consensus       635 L~~~~~~~~~~i~~li~~E~~yint~hpdf~~~~~~~~  672 (1036)
                      +.++..+|.+||+++|+||.+||||+||||.++.....
T Consensus       251 l~~~~~~a~~~i~~li~~E~~~i~T~~~~f~~~~~~~~  288 (295)
T PF01031_consen  251 LEECREPAKEMIENLIDMELSYINTQHPDFLGELQAIR  288 (295)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTTS--TTSTT--TTS----
T ss_pred             HHHHHHHHHHHHHHHHHHhcccCCCCCHHHHHHHHHHH
Confidence            99999999999999999999999999999999865554


No 9  
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=99.81  E-value=4.2e-19  Score=208.53  Aligned_cols=78  Identities=18%  Similarity=0.195  Sum_probs=61.7

Q ss_pred             HHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccch
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTD  448 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td  448 (1036)
                      .++++.+...|.+.|.|+||||+.+ ..+..                      +.+.+.+...+.+..++++.++||+++
T Consensus       273 ~~~~~~~~~~~~~iiiv~NK~Dl~~-~~~~~----------------------~~~~~~~~~~~~~~~~~~vi~~SA~~g  329 (429)
T TIGR03594       273 LRIAGLILEAGKALVIVVNKWDLVK-DEKTR----------------------EEFKKELRRKLPFLDFAPIVFISALTG  329 (429)
T ss_pred             HHHHHHHHHcCCcEEEEEECcccCC-CHHHH----------------------HHHHHHHHHhcccCCCCceEEEeCCCC
Confidence            4566777778999999999999983 22222                      566777888888899999999999999


Q ss_pred             hhhHHHHHHhhhcCcCCCcee
Q psy5059         449 MATSESLKLAKETDVDGRRTL  469 (1036)
Q Consensus       449 ~~~qeil~la~~vd~~g~RtI  469 (1036)
                      .++.++++.+........+++
T Consensus       330 ~~v~~l~~~i~~~~~~~~~~i  350 (429)
T TIGR03594       330 QGVDKLLDAIDEVYENANRRI  350 (429)
T ss_pred             CCHHHHHHHHHHHHHHhcCcC
Confidence            999999998877765554444


No 10 
>PRK03003 GTP-binding protein Der; Reviewed
Probab=99.81  E-value=7.7e-19  Score=208.77  Aligned_cols=78  Identities=12%  Similarity=0.051  Sum_probs=61.0

Q ss_pred             HHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccch
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTD  448 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td  448 (1036)
                      ++++..+...|.++|.|+||||+.++...                        ..+...+...+.+..++|...+||+++
T Consensus       312 ~~~~~~~~~~~~piIiV~NK~Dl~~~~~~------------------------~~~~~~i~~~l~~~~~~~~~~~SAk~g  367 (472)
T PRK03003        312 QRVLSMVIEAGRALVLAFNKWDLVDEDRR------------------------YYLEREIDRELAQVPWAPRVNISAKTG  367 (472)
T ss_pred             HHHHHHHHHcCCCEEEEEECcccCChhHH------------------------HHHHHHHHHhcccCCCCCEEEEECCCC
Confidence            34566666689999999999999753211                        345566777788888899999999999


Q ss_pred             hhhHHHHHHhhhcCcCCCceee
Q psy5059         449 MATSESLKLAKETDVDGRRTLA  470 (1036)
Q Consensus       449 ~~~qeil~la~~vd~~g~RtIg  470 (1036)
                      .++.+++..+.+..+...++++
T Consensus       368 ~gv~~lf~~i~~~~~~~~~~i~  389 (472)
T PRK03003        368 RAVDKLVPALETALESWDTRIP  389 (472)
T ss_pred             CCHHHHHHHHHHHHHHhcccCC
Confidence            9999999998888776666654


No 11 
>smart00302 GED Dynamin GTPase effector domain.
Probab=99.80  E-value=7.5e-20  Score=169.61  Aligned_cols=75  Identities=48%  Similarity=0.696  Sum_probs=73.0

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHhcCccchhHHhcCCHHHHHHhhhhc
Q psy5059         961 EKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEST 1035 (1036)
Q Consensus       961 e~~q~~~i~~lv~sYf~Iv~k~i~D~VPK~Im~~lVn~~~~~l~~~L~~~Ly~~~~~~~Ll~E~~~i~~~R~~~~ 1035 (1036)
                      |..+++.|++++.|||+||+|+++|+|||+|||||||++++.++++|+++||+++.+++||+|||+|++||++|.
T Consensus         2 e~~~~~~i~~lv~sYf~iv~k~i~D~VPKaI~~~lv~~~~~~lq~~L~~~L~~~~~~~~LL~E~~~i~~kR~~~~   76 (92)
T smart00302        2 EDSELEEIKSLVKSYFTIVSKTLADQVPKAIMYLLVNESKDSLQNELLALLYKEELLDELLEEDPEIASKRKELK   76 (92)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHhCcccHHHHHcCCHHHHHHHHHHH
Confidence            567899999999999999999999999999999999999999999999999999999999999999999999985


No 12 
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed
Probab=99.80  E-value=6.5e-19  Score=218.78  Aligned_cols=78  Identities=19%  Similarity=0.108  Sum_probs=62.6

Q ss_pred             HHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccch
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTD  448 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td  448 (1036)
                      .++++.+...|.+.|.|+||||++++..  .                      +.+++.+...+.+..+.++.++||+++
T Consensus       551 ~~i~~~~~~~~~piIiV~NK~DL~~~~~--~----------------------~~~~~~~~~~l~~~~~~~ii~iSAktg  606 (712)
T PRK09518        551 LKVMSMAVDAGRALVLVFNKWDLMDEFR--R----------------------QRLERLWKTEFDRVTWARRVNLSAKTG  606 (712)
T ss_pred             HHHHHHHHHcCCCEEEEEEchhcCChhH--H----------------------HHHHHHHHHhccCCCCCCEEEEECCCC
Confidence            4566667778999999999999986421  1                      346666777788889999999999999


Q ss_pred             hhhHHHHHHhhhcCcCCCceee
Q psy5059         449 MATSESLKLAKETDVDGRRTLA  470 (1036)
Q Consensus       449 ~~~qeil~la~~vd~~g~RtIg  470 (1036)
                      .++.++++.+.+..+...++++
T Consensus       607 ~gv~~L~~~i~~~~~~~~~~i~  628 (712)
T PRK09518        607 WHTNRLAPAMQEALESWDQRIP  628 (712)
T ss_pred             CCHHHHHHHHHHHHHHhcccCC
Confidence            9999999999888776666554


No 13 
>smart00302 GED Dynamin GTPase effector domain.
Probab=99.80  E-value=1.4e-19  Score=167.85  Aligned_cols=78  Identities=46%  Similarity=0.665  Sum_probs=74.1

Q ss_pred             hhhhHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHhhcccchHHhhhcCHHHHHhhhhhhccC
Q psy5059         691 EKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEASDTK  768 (1036)
Q Consensus       691 ~~~~~~~i~~~~~sYf~iv~k~~~d~vPk~i~~~lv~~~~~~l~~~l~~~l~~~~~~~~ll~E~~~ia~rR~~~~~~~  768 (1036)
                      |..++++|+.++.|||+||+|+++|+|||+|||||||.+++.||++|+++||+++.+++||+|+|++++||++|.+..
T Consensus         2 e~~~~~~i~~lv~sYf~iv~k~i~D~VPKaI~~~lv~~~~~~lq~~L~~~L~~~~~~~~LL~E~~~i~~kR~~~~~~l   79 (92)
T smart00302        2 EDSELEEIKSLVKSYFTIVSKTLADQVPKAIMYLLVNESKDSLQNELLALLYKEELLDELLEEDPEIASKRKELKKRL   79 (92)
T ss_pred             chhHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHHHHhCcccHHHHHcCCHHHHHHHHHHHHHH
Confidence            456788999999999999999999999999999999999999999999999999999999999999999999887654


No 14 
>PRK00093 GTP-binding protein Der; Reviewed
Probab=99.79  E-value=1.5e-18  Score=204.36  Aligned_cols=77  Identities=21%  Similarity=0.235  Sum_probs=61.3

Q ss_pred             HHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccch
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTD  448 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td  448 (1036)
                      .++++.+...|.+.|.|+||||+.+..  .                      ...+...+...+.+..++|+.++||+++
T Consensus       274 ~~i~~~~~~~~~~~ivv~NK~Dl~~~~--~----------------------~~~~~~~~~~~l~~~~~~~i~~~SA~~~  329 (435)
T PRK00093        274 LRIAGLALEAGRALVIVVNKWDLVDEK--T----------------------MEEFKKELRRRLPFLDYAPIVFISALTG  329 (435)
T ss_pred             HHHHHHHHHcCCcEEEEEECccCCCHH--H----------------------HHHHHHHHHHhcccccCCCEEEEeCCCC
Confidence            567777778899999999999998432  1                      1456667778888889999999999999


Q ss_pred             hhhHHHHHHhhhcCcCCCcee
Q psy5059         449 MATSESLKLAKETDVDGRRTL  469 (1036)
Q Consensus       449 ~~~qeil~la~~vd~~g~RtI  469 (1036)
                      .++.++++.+.+......+++
T Consensus       330 ~gv~~l~~~i~~~~~~~~~~i  350 (435)
T PRK00093        330 QGVDKLLEAIDEAYENANRRI  350 (435)
T ss_pred             CCHHHHHHHHHHHHHHHcCcC
Confidence            999999998877765544444


No 15 
>PF00350 Dynamin_N:  Dynamin family;  InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another. Dynamins are large GTPases that belong to a protein superfamily [] that, in eukaryotic cells, includes classical dynamins, dynamin-like proteins, OPA1, Mx proteins, mitofusins and guanylate-binding proteins/atlastins [, , , ], and are involved in the scission of a wide range of vesicles and organelles. They play a role in many processes including budding of transport vesicles, division of organelles, cytokinesis and pathogen resistance.   The minimal distinguishing architectural features that are common to all dynamins and are distinct from other GTPases are the structure of the large GTPase domain (300 amino acids) and the presence of two additional domains; the middle domain and the GTPase effector domain (GED), which are involved in oligomerization and regulation of the GTPase activity. This entry represents the GTPase domain, containing the GTP-binding motifs that are needed for guanine-nucleotide binding and hydrolysis. The conservation of these motifs is absolute except for the the final motif in guanylate-binding proteins. The GTPase catalytic activity can be stimulated by oligomerisation of the protein, which is mediated by interactions between the GTPase domain, the middle domain and the GED.; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 1JWY_B 1JX2_B 3ZVR_A 2AKA_B 3L43_B 2X2F_D 2X2E_D 3SNH_A 3ZYS_D 3ZYC_D ....
Probab=99.75  E-value=9.9e-18  Score=171.09  Aligned_cols=166  Identities=31%  Similarity=0.489  Sum_probs=129.2

Q ss_pred             eEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhccCCCCccccccccccccccccchhhh
Q psy5059          86 IVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFDDI  165 (1036)
Q Consensus        86 IvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~df~~~  165 (1036)
                      |+|+|.+|||||||+|||+|.+++|.+.+.||++|++++....+.....            .|..               
T Consensus         1 V~v~G~~ssGKSTliNaLlG~~ilp~~~~~~T~~~~~i~~~~~~~~~~~------------~~~~---------------   53 (168)
T PF00350_consen    1 VAVVGQFSSGKSTLINALLGRPILPSGVGPCTAVPTEISYGDEPEIEHE------------EAII---------------   53 (168)
T ss_dssp             EEEEEBTTSSHHHHHHHHHTSS-SSSSSSSTTSSEEEEEEEESSSCCTS------------EEEE---------------
T ss_pred             CEEEcCCCCCHHHHHHHHHhcccCcccccccccceeEEEecccCccccc------------cccc---------------
Confidence            7899999999999999999999999999999999999998765431100            0000               


Q ss_pred             hhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHHHHHHhcCCCCCcCCCcEEEEEeecCccccee
Q psy5059         166 RREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICSEPIILKIYSTSVLNLTL  245 (1036)
Q Consensus       166 r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~~~~~~g~~~~~S~d~I~L~I~~P~~~~Ltl  245 (1036)
                                              .|.    .....+.++.++.+.+........+....+++..+.+....+...+++|
T Consensus        54 ------------------------~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  105 (168)
T PF00350_consen   54 ------------------------EFK----DGSEEFEELNELREQIDEEFDSIEGKLEQISSKVIVISISSPLLRNLTL  105 (168)
T ss_dssp             ------------------------CEE----EETEEBCCHHHHHHHHHHHHHHHHTSSS-S-SSEEEEEEEETTSCSEEE
T ss_pred             ------------------------ccc----ccccchhhHHHHHHhhhcccccccccccccccceeEEeeccccccceEE
Confidence                                    000    0123456677888888777766666667788889999999999999999


Q ss_pred             ecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCCCCCcccceec
Q psy5059         246 VDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLD  316 (1036)
Q Consensus       246 VDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp~g~RTigvl~  316 (1036)
                      ||+||+.......+         +++.+|+ +...++|+|.+++.++.+++...+.+..++.+.|+++|+.
T Consensus       106 vDtPG~~~~~~~~~---------~~~~~~~-~~~d~vi~V~~~~~~~~~~~~~~l~~~~~~~~~~~i~V~n  166 (168)
T PF00350_consen  106 VDTPGLNSTNSEHT---------EITEEYL-PKADVVIFVVDANQDLTESDMEFLKQMLDPDKSRTIFVLN  166 (168)
T ss_dssp             EEEEEBHSSHTTTS---------HHHHHHH-STTEEEEEEEETTSTGGGHHHHHHHHHHTTTCSSEEEEEE
T ss_pred             EeCCccccchhhhH---------HHHHHhh-ccCCEEEEEeccCcccchHHHHHHHHHhcCCCCeEEEEEc
Confidence            99999854322221         6888999 6777999999999999999999999999999999999884


No 16 
>PF02212 GED:  Dynamin GTPase effector domain;  InterPro: IPR003130 Dynamin GTPase effector domain found in proteins related to dynamin.  Dynamin is a GTP-hydrolysing protein that is an essential participant in clathrin-mediated endocytosis by cells. It self-assembles into 'collars' in vivo at the necks of invaginated coated pits; the self-assembly of dynamin being coordinated by the GTPase domain. Mutation studies indicate that dynamin functions as a molecular regulator of receptor-mediated endocytosis [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3ZYS_B 3SZR_A 3LJB_B 3T35_C 3T34_A 2X2F_D 2X2E_D 3SNH_A 3ZYC_D 3ZVR_A.
Probab=99.65  E-value=1.7e-16  Score=147.46  Aligned_cols=76  Identities=47%  Similarity=0.767  Sum_probs=71.2

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHhcCccchhHHhcCCHHHHHHhhhhc
Q psy5059         960 KEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEST 1035 (1036)
Q Consensus       960 ~e~~q~~~i~~lv~sYf~Iv~k~i~D~VPK~Im~~lVn~~~~~l~~~L~~~Ly~~~~~~~Ll~E~~~i~~~R~~~~ 1035 (1036)
                      +|..+++.|+++++|||+||+|+|.|.|||+|||+||+++++.|+.+|+.+||..+.+++||.|||+++++|++|.
T Consensus         1 ~e~~~~~~i~~~l~aY~~ia~kr~~D~Vpk~I~~~lv~~~~~~L~~~l~~~l~~~~~~~~Ll~Ed~~i~~kR~~l~   76 (92)
T PF02212_consen    1 REQREVEEIKALLRAYFEIARKRFIDSVPKAIMHFLVNKSKEQLQSELLNELYDEEDLEELLQEDPEIAEKREELK   76 (92)
T ss_dssp             -HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCGGCCCCT--GHHHHHHHHHHH
T ss_pred             ChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhHHHHHHHHhccchHHHHHHHCCCHHHHHHHHHHH
Confidence            5788999999999999999999999999999999999999999999999999999999999999999999999985


No 17 
>PF02212 GED:  Dynamin GTPase effector domain;  InterPro: IPR003130 Dynamin GTPase effector domain found in proteins related to dynamin.  Dynamin is a GTP-hydrolysing protein that is an essential participant in clathrin-mediated endocytosis by cells. It self-assembles into 'collars' in vivo at the necks of invaginated coated pits; the self-assembly of dynamin being coordinated by the GTPase domain. Mutation studies indicate that dynamin functions as a molecular regulator of receptor-mediated endocytosis [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3ZYS_B 3SZR_A 3LJB_B 3T35_C 3T34_A 2X2F_D 2X2E_D 3SNH_A 3ZYC_D 3ZVR_A.
Probab=99.63  E-value=4.6e-16  Score=144.54  Aligned_cols=78  Identities=46%  Similarity=0.753  Sum_probs=71.7

Q ss_pred             hhhhhHHHHHHHHHHHHHHHHHHhhhhhhHHHHHHHHHHHHHHHHHHHHHHhhcccchHHhhhcCHHHHHhhhhhhcc
Q psy5059         690 KEKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEASDT  767 (1036)
Q Consensus       690 ~~~~~~~~i~~~~~sYf~iv~k~~~d~vPk~i~~~lv~~~~~~l~~~l~~~l~~~~~~~~ll~E~~~ia~rR~~~~~~  767 (1036)
                      +|..+++.|+.++.|||+||+|++.|+|||+|+||||+.+++.|+.+|++.||..+.+.+||.|+|+++++|+.|.+.
T Consensus         1 ~e~~~~~~i~~~l~aY~~ia~kr~~D~Vpk~I~~~lv~~~~~~L~~~l~~~l~~~~~~~~Ll~Ed~~i~~kR~~l~~~   78 (92)
T PF02212_consen    1 REQREVEEIKALLRAYFEIARKRFIDSVPKAIMHFLVNKSKEQLQSELLNELYDEEDLEELLQEDPEIAEKREELKKK   78 (92)
T ss_dssp             -HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCGGCCCCT--GHHHHHHHHHHHHH
T ss_pred             ChhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHHhHHHHHHHHhccchHHHHHHHCCCHHHHHHHHHHHHH
Confidence            467789999999999999999999999999999999999999999999999999999999999999999999977654


No 18 
>PRK09866 hypothetical protein; Provisional
Probab=99.46  E-value=1.5e-10  Score=137.41  Aligned_cols=65  Identities=23%  Similarity=0.328  Sum_probs=48.5

Q ss_pred             hhhhHHHHHHHHHhhhhcCCCCCCCCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEe
Q psy5059          59 KRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLY  126 (1036)
Q Consensus        59 ~~~~~~l~~kL~~~~~~~g~~~i~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~  126 (1036)
                      +|.+.+-+..|+.-+..+-..   -|.++|+|..|+||||++++|.|...+|.+.+.+|.+|+.++..
T Consensus        48 rR~i~~ri~~L~~~L~Kv~~~---~~~valvG~sgaGKSTLiNaL~G~~Vlpt~~~~~t~lpT~i~~~  112 (741)
T PRK09866         48 QPNIAERHAMLNNELRKISRL---EMVLAIVGTMKAGKSTTINAIVGTEVLPNRNRPMTALPTLIRHT  112 (741)
T ss_pred             HHHHHHHHHHHHHHHHHHhcc---ceEEEEECCCCCCHHHHHHHHhCCccccCCCcccccccEEEEec
Confidence            344444444454433322211   29999999999999999999999999999999999999965543


No 19 
>COG0218 Predicted GTPase [General function prediction only]
Probab=99.40  E-value=1.8e-12  Score=134.63  Aligned_cols=108  Identities=15%  Similarity=0.189  Sum_probs=81.3

Q ss_pred             CcccccCCCCCchHHHHHHHHHHhhhcCCCce--EEEEEecCccccchHHHHHhhhccccCCceEEEEecccccCCCchh
Q psy5059         321 GITKVPVGDQPDDIEAQIKQLVLHYISNPNSI--ILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDA  398 (1036)
Q Consensus       321 g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~--~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~Dl~~~g~~~  398 (1036)
                      ||+++++.     ..+.|++++.+||..+..|  ++.++|+++.++..+ ..+...+...|.+++.|+||.|....+...
T Consensus        81 GyAkv~k~-----~~e~w~~~i~~YL~~R~~L~~vvlliD~r~~~~~~D-~em~~~l~~~~i~~~vv~tK~DKi~~~~~~  154 (200)
T COG0218          81 GYAKVPKE-----VKEKWKKLIEEYLEKRANLKGVVLLIDARHPPKDLD-REMIEFLLELGIPVIVVLTKADKLKKSERN  154 (200)
T ss_pred             ccccCCHH-----HHHHHHHHHHHHHhhchhheEEEEEEECCCCCcHHH-HHHHHHHHHcCCCeEEEEEccccCChhHHH
Confidence            77777773     3478999999999998888  888999999988877 489999999999999999999999865432


Q ss_pred             hhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcce--eeeecccchhhhHHHHHHh
Q psy5059         399 IDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSII--LAVVTANTDMATSESLKLA  458 (1036)
Q Consensus       399 ~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ip--la~ISA~td~~~qeil~la  458 (1036)
                                              .....+...+.+....-  +.+.|+.++...+++....
T Consensus       155 ------------------------k~l~~v~~~l~~~~~~~~~~~~~ss~~k~Gi~~l~~~i  192 (200)
T COG0218         155 ------------------------KQLNKVAEELKKPPPDDQWVVLFSSLKKKGIDELKAKI  192 (200)
T ss_pred             ------------------------HHHHHHHHHhcCCCCccceEEEEecccccCHHHHHHHH
Confidence                                    22344555553333322  6777777777777665554


No 20 
>KOG0447|consensus
Probab=99.21  E-value=5e-11  Score=135.95  Aligned_cols=53  Identities=34%  Similarity=0.489  Sum_probs=48.1

Q ss_pred             chhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCCCCCcccceec
Q psy5059         260 PDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLD  316 (1036)
Q Consensus       260 ~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp~g~RTigvl~  316 (1036)
                      .++|..+-+.    ||++||+||||+.+.+.|+..|..-.|+-.+||.|+|||.||+
T Consensus       435 Kd~I~~msKa----yM~NPNAIILCIQDGSVDAERSnVTDLVsq~DP~GrRTIfVLT  487 (980)
T KOG0447|consen  435 KETIFSISKA----YMQNPNAIILCIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLT  487 (980)
T ss_pred             hHHHHHHHHH----HhcCCCeEEEEeccCCcchhhhhHHHHHHhcCCCCCeeEEEEe
Confidence            3566666666    8999999999999999999999999999999999999999995


No 21 
>TIGR00436 era GTP-binding protein Era. Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein.
Probab=99.12  E-value=5.3e-10  Score=123.99  Aligned_cols=71  Identities=14%  Similarity=0.003  Sum_probs=47.9

Q ss_pred             hhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhH
Q psy5059         373 KETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATS  452 (1036)
Q Consensus       373 ~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~q  452 (1036)
                      ..+...+.++|.|+||+|+.++.                           .+......+.....+.+...+||+++.++.
T Consensus       101 ~~l~~~~~p~ilV~NK~Dl~~~~---------------------------~~~~~~~~~~~~~~~~~v~~iSA~~g~gi~  153 (270)
T TIGR00436       101 TKLQNLKRPVVLTRNKLDNKFKD---------------------------KLLPLIDKYAILEDFKDIVPISALTGDNTS  153 (270)
T ss_pred             HHHHhcCCCEEEEEECeeCCCHH---------------------------HHHHHHHHHHhhcCCCceEEEecCCCCCHH
Confidence            33344578999999999997431                           112222233333344578899999999999


Q ss_pred             HHHHHhhhcCcCCCceee
Q psy5059         453 ESLKLAKETDVDGRRTLA  470 (1036)
Q Consensus       453 eil~la~~vd~~g~RtIg  470 (1036)
                      ++++...+.-+.+....+
T Consensus       154 ~L~~~l~~~l~~~~~~~~  171 (270)
T TIGR00436       154 FLAAFIEVHLPEGPFRYP  171 (270)
T ss_pred             HHHHHHHHhCCCCCCCCC
Confidence            999998887776665443


No 22 
>COG0486 ThdF Predicted GTPase [General function prediction only]
Probab=99.12  E-value=5.5e-10  Score=128.66  Aligned_cols=130  Identities=20%  Similarity=0.207  Sum_probs=83.6

Q ss_pred             HHhcCCCCCcCCCcEEEEEeecCcccceeecCCCccccCCCCCchhHHHHH-HHHHHHhhcCCCcEEEEEeccccccccc
Q psy5059         217 ERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQI-KQLVLHYISNPNSIILAVVTANTDMATS  295 (1036)
Q Consensus       217 ~~~~g~~~~~S~d~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~i-r~lv~~yI~~~n~IIL~V~~An~D~~~s  295 (1036)
                      .+++|+    |+|.|.-.+.= +..++.++||.||+..      +|..+.+ =.-.++.++..+ +||.|.+++..+...
T Consensus       246 TdI~GT----TRDviee~i~i-~G~pv~l~DTAGiRet------~d~VE~iGIeRs~~~i~~AD-lvL~v~D~~~~~~~~  313 (454)
T COG0486         246 TDIAGT----TRDVIEEDINL-NGIPVRLVDTAGIRET------DDVVERIGIERAKKAIEEAD-LVLFVLDASQPLDKE  313 (454)
T ss_pred             cCCCCC----ccceEEEEEEE-CCEEEEEEecCCcccC------ccHHHHHHHHHHHHHHHhCC-EEEEEEeCCCCCchh
Confidence            356777    88888877765 6788999999999742      2222211 122335556666 555566665543332


Q ss_pred             hhhhhhhhcCCCCCcccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhc
Q psy5059         296 ESLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKET  375 (1036)
Q Consensus       296 ~al~l~r~~Dp~g~RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~  375 (1036)
                      +                                                                        .++.. .
T Consensus       314 d------------------------------------------------------------------------~~~~~-~  320 (454)
T COG0486         314 D------------------------------------------------------------------------LALIE-L  320 (454)
T ss_pred             h------------------------------------------------------------------------HHHHH-h
Confidence            2                                                                        22333 5


Q ss_pred             cccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHH
Q psy5059         376 DVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESL  455 (1036)
Q Consensus       376 d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil  455 (1036)
                      -+.+++++.|+||.||..+.....                                ++-..-.+...+||+++.....+.
T Consensus       321 ~~~~~~~i~v~NK~DL~~~~~~~~--------------------------------~~~~~~~~~i~iSa~t~~Gl~~L~  368 (454)
T COG0486         321 LPKKKPIIVVLNKADLVSKIELES--------------------------------EKLANGDAIISISAKTGEGLDALR  368 (454)
T ss_pred             cccCCCEEEEEechhcccccccch--------------------------------hhccCCCceEEEEecCccCHHHHH
Confidence            678899999999999998754321                                011223367889999999998888


Q ss_pred             HHhhhcCc
Q psy5059         456 KLAKETDV  463 (1036)
Q Consensus       456 ~la~~vd~  463 (1036)
                      +.......
T Consensus       369 ~~i~~~~~  376 (454)
T COG0486         369 EAIKQLFG  376 (454)
T ss_pred             HHHHHHHh
Confidence            77665543


No 23 
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=99.11  E-value=1.1e-09  Score=110.55  Aligned_cols=70  Identities=16%  Similarity=0.224  Sum_probs=52.1

Q ss_pred             HHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchh
Q psy5059         370 KLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDM  449 (1036)
Q Consensus       370 ~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~  449 (1036)
                      .+.+.+...+.+.+.|+||+|+++......                      +.+.+.+.++++...+.+...+||+++.
T Consensus       104 ~~~~~~~~~~~~~iiv~nK~Dl~~~~~~~~----------------------~~~~~~~~~~~~~~~~~~~~~~Sa~~~~  161 (174)
T cd01895         104 RIAGLILEEGKALVIVVNKWDLVEKDSKTM----------------------KEFKKEIRRKLPFLDYAPIVFISALTGQ  161 (174)
T ss_pred             HHHHHHHhcCCCEEEEEeccccCCccHHHH----------------------HHHHHHHHhhcccccCCceEEEeccCCC
Confidence            344555556789999999999987642222                      4455666777776677889999999999


Q ss_pred             hhHHHHHHhhhc
Q psy5059         450 ATSESLKLAKET  461 (1036)
Q Consensus       450 ~~qeil~la~~v  461 (1036)
                      +..++++...++
T Consensus       162 ~i~~~~~~l~~~  173 (174)
T cd01895         162 GVDKLFDAIDEV  173 (174)
T ss_pred             CHHHHHHHHHHh
Confidence            999998876553


No 24 
>COG0699 Predicted GTPases (dynamin-related) [General function prediction only]
Probab=99.08  E-value=3.2e-09  Score=128.23  Aligned_cols=235  Identities=23%  Similarity=0.271  Sum_probs=180.5

Q ss_pred             ccCCcchhhccchHHHHHHHHHHHHHHHHhhchhhHHHHHHHHHHHHHHHhhcCCCCcchHHHHHHHHHHHHHhhccccc
Q psy5059         766 DTKYPTLASRNGTLYLAKTLNRLLMHHIRDCLPDLKTRVNVMISQFQTLLNSYGEDVSDKSQTLLQIITKFASAYCSTVE  845 (1036)
Q Consensus       766 ~~~y~~~~~r~G~~~L~~~Ln~~L~~hi~~~LP~l~~~i~~~l~~~~~~l~~~~d~~~~~~~~lL~~i~~F~~~f~~~I~  845 (1036)
                      ++.|.....-||++++..-+++.+..|++...|..+-+......+      .+++.      .++..++.|...+.    
T Consensus       171 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------~~~~~------~~~~~~~~~~~~~~----  234 (546)
T COG0699         171 HPLLEDNEKLVLLPYLKKLLSKILELHLRLLPKYDKLQDVIQLSQ------DLFEN------EVLAVIQTLLKRLS----  234 (546)
T ss_pred             CccccccccccCChhhhhhhhhhHHHHHHhcChhhhhHhhhcccc------cccch------HHHHHHHHHHHHHH----
Confidence            445566666789999999999999999999999887666655443      22222      77778888888776    


Q ss_pred             cccccccccccccceeehhhhhhhhhhhccccCCCCCCCHHHHHHHHHhccCCCCCCCCChhHHHHHHHHHHHHhhccHH
Q psy5059         846 GTARNIETTELCGGARICYIFHEIFGKVLDGINPLDGLTKMDILTAIRNATGPRPALFVPEVSFELLVKRQIRRLEEPSQ  925 (1036)
Q Consensus       846 G~~~~~~~~el~GGAri~~iF~~~F~~~i~~~~p~~~l~~~dIr~aI~n~~G~~~~lfvp~~aFe~Lvk~qI~~l~~Psl  925 (1036)
                               ++.+|+|+...        +..+.+++.+.+..++.+..+..|.++..|....+|..++..++..+..++.
T Consensus       235 ---------~~~~~~~~~~~--------~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~  297 (546)
T COG0699         235 ---------ELVRGARIRLN--------IILFSDLEEVSDSPVLLKELASKGERPSLLSGLTLLDTLVETPIGQFDTQIN  297 (546)
T ss_pred             ---------HHhccchhhhh--------hcccchHHHhhhhhhHHHHHcccCCCccccccccchhhhhHHHHHHHHHHHH
Confidence                     67777788776        5667888888999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHHHHhccCC---C------------------------------------------------------
Q psy5059         926 RCVELVHEEMQRIIQHCEKEGN---I------------------------------------------------------  948 (1036)
Q Consensus       926 ~cvdlV~~EL~~i~~~~~~~~~---~------------------------------------------------------  948 (1036)
                      +|+..++++|.++.........   +                                                      
T Consensus       298 ~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  377 (546)
T COG0699         298 QLLRKLISELVRILLKELESASSSPFPKLSEALEEVVNQLKNKVDSGLESGLLAIIDIEERYINTKHPLFLSLRQAAAIL  377 (546)
T ss_pred             HHHHHHHHHHHHHHHhhhcccccccchhhHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHhhcCcchHHHHHHHHHH
Confidence            9999999999998544332210   0                                                      


Q ss_pred             --------------CCC---C------C---------------------------------------------CCCCCHH
Q psy5059         949 --------------PAT---T------S---------------------------------------------SRTLSEK  960 (1036)
Q Consensus       949 --------------p~~---~------~---------------------------------------------~~~~~~~  960 (1036)
                                    +..   .      .                                             ...+.+.
T Consensus       378 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  457 (546)
T COG0699         378 SKVLDNLEALLRSLDDSRLRELSDMGLNSLLSNNLEEHLLGSDFSLYKFLNEFLELKKLDALLATLGEALRRLTGLLPER  457 (546)
T ss_pred             HHHHHHHHHHHHhhccccccchhhcccchhHHHHHHHHhhcchhhHHHHHHHHhhhccchhhhccchHHHHHhhcccchh
Confidence                          000   0      0                                             0011222


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHHHHHHHhcCccchhHHhcCCHHHHHHhhhh
Q psy5059         961 EKRDCDVIERLIKSYFYIIRKSIQDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKES 1034 (1036)
Q Consensus       961 e~~q~~~i~~lv~sYf~Iv~k~i~D~VPK~Im~~lVn~~~~~l~~~L~~~Ly~~~~~~~Ll~E~~~i~~~R~~~ 1034 (1036)
                      ...+...+..++++| .++...+.|.+++++++++.+.-+..........+|.....++|..+.+...+.|..+
T Consensus       458 ~~~~~~~i~~l~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~  530 (546)
T COG0699         458 KTLEKQLIKSLLESL-LILAQKIRDSVLKAIFELLKNKRKRLAQKQRLKRLYLEQLEDELLRTAEEILELRLLL  530 (546)
T ss_pred             hhhhhHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHH
Confidence            333346679999999 9999999999999999999888877777777788888888888888888877776554


No 25 
>COG1160 Predicted GTPases [General function prediction only]
Probab=99.07  E-value=6e-10  Score=128.05  Aligned_cols=141  Identities=18%  Similarity=0.172  Sum_probs=95.4

Q ss_pred             CCCcEEEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCC
Q psy5059         227 CSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDV  306 (1036)
Q Consensus       227 S~d~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp  306 (1036)
                      |+|.+.=....-+ ..+.+|||+|+...    .++.+..+++.-+...|+..++ ||+|+++...++..|          
T Consensus        38 TRDr~y~~~~~~~-~~f~lIDTgGl~~~----~~~~l~~~i~~Qa~~Ai~eADv-ilfvVD~~~Git~~D----------  101 (444)
T COG1160          38 TRDRIYGDAEWLG-REFILIDTGGLDDG----DEDELQELIREQALIAIEEADV-ILFVVDGREGITPAD----------  101 (444)
T ss_pred             ccCCccceeEEcC-ceEEEEECCCCCcC----CchHHHHHHHHHHHHHHHhCCE-EEEEEeCCCCCCHHH----------
Confidence            5565554554433 34899999999532    2246888888888899999984 455555665555544          


Q ss_pred             CCCcccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCceEEEE
Q psy5059         307 DGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVV  386 (1036)
Q Consensus       307 ~g~RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~Vi  386 (1036)
                                                                                    ..+|+.+-+.++++|.|+
T Consensus       102 --------------------------------------------------------------~~ia~~Lr~~~kpviLvv  119 (444)
T COG1160         102 --------------------------------------------------------------EEIAKILRRSKKPVILVV  119 (444)
T ss_pred             --------------------------------------------------------------HHHHHHHHhcCCCEEEEE
Confidence                                                                          568888888889999999


Q ss_pred             ecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhhcC----
Q psy5059         387 TKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETD----  462 (1036)
Q Consensus       387 tK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd----  462 (1036)
                      ||+|-.+....+.                               .+..+-.....-|||..|++...+++...+.-    
T Consensus       120 NK~D~~~~e~~~~-------------------------------efyslG~g~~~~ISA~Hg~Gi~dLld~v~~~l~~~e  168 (444)
T COG1160         120 NKIDNLKAEELAY-------------------------------EFYSLGFGEPVPISAEHGRGIGDLLDAVLELLPPDE  168 (444)
T ss_pred             EcccCchhhhhHH-------------------------------HHHhcCCCCceEeehhhccCHHHHHHHHHhhcCCcc
Confidence            9999884433321                               22333344456689999999988887765552    


Q ss_pred             ---cCC---Cceeeeecccc
Q psy5059         463 ---VDG---RRTLAVVTKID  476 (1036)
Q Consensus       463 ---~~g---~RtIgVlTK~D  476 (1036)
                         ...   ..+++++=+|-
T Consensus       169 ~~~~~~~~~~ikiaiiGrPN  188 (444)
T COG1160         169 EEEEEEETDPIKIAIIGRPN  188 (444)
T ss_pred             cccccccCCceEEEEEeCCC
Confidence               112   36777777764


No 26 
>PF02421 FeoB_N:  Ferrous iron transport protein B;  InterPro: IPR011619  Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent [].; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0016021 integral to membrane; PDB: 3TAH_B 3B1X_A 3SS8_A 3B1W_C 3B1V_A 3LX5_A 3B1Y_A 3LX8_A 3B1Z_A 3K53_B ....
Probab=99.06  E-value=6.2e-10  Score=113.21  Aligned_cols=62  Identities=18%  Similarity=0.126  Sum_probs=44.6

Q ss_pred             HHHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccc
Q psy5059         368 SLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANT  447 (1036)
Q Consensus       368 ~~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~t  447 (1036)
                      .+.|..++-.-|.++|.|+||+|+..+..-.+                    ..+.+.+.+        -.|++.+||.+
T Consensus        94 ~l~l~~ql~e~g~P~vvvlN~~D~a~~~g~~i--------------------d~~~Ls~~L--------g~pvi~~sa~~  145 (156)
T PF02421_consen   94 NLYLTLQLLELGIPVVVVLNKMDEAERKGIEI--------------------DAEKLSERL--------GVPVIPVSART  145 (156)
T ss_dssp             HHHHHHHHHHTTSSEEEEEETHHHHHHTTEEE---------------------HHHHHHHH--------TS-EEEEBTTT
T ss_pred             HHHHHHHHHHcCCCEEEEEeCHHHHHHcCCEE--------------------CHHHHHHHh--------CCCEEEEEeCC
Confidence            36788888899999999999999987532211                    112333332        36899999999


Q ss_pred             hhhhHHHHHH
Q psy5059         448 DMATSESLKL  457 (1036)
Q Consensus       448 d~~~qeil~l  457 (1036)
                      +....++.+.
T Consensus       146 ~~g~~~L~~~  155 (156)
T PF02421_consen  146 GEGIDELKDA  155 (156)
T ss_dssp             TBTHHHHHHH
T ss_pred             CcCHHHHHhh
Confidence            9999998765


No 27 
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=99.04  E-value=1.1e-09  Score=113.69  Aligned_cols=28  Identities=32%  Similarity=0.462  Sum_probs=24.9

Q ss_pred             CCCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          81 IQLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        81 i~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -..|.|+++|..++||||++++|.|..|
T Consensus        16 ~~~~~i~ivG~~~~GKStlin~l~~~~~   43 (179)
T TIGR03598        16 DDGPEIAFAGRSNVGKSSLINALTNRKK   43 (179)
T ss_pred             CCCCEEEEEcCCCCCHHHHHHHHhCCCC
Confidence            3578999999999999999999998764


No 28 
>PRK00454 engB GTP-binding protein YsxC; Reviewed
Probab=99.03  E-value=3.8e-09  Score=110.32  Aligned_cols=66  Identities=14%  Similarity=0.036  Sum_probs=43.5

Q ss_pred             HhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhh
Q psy5059         371 LAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMA  450 (1036)
Q Consensus       371 la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~  450 (1036)
                      +.+.+...|.+++.|+||+|+.+.+...                        .....+...+... ..+...+||+.+.+
T Consensus       127 i~~~l~~~~~~~iiv~nK~Dl~~~~~~~------------------------~~~~~i~~~l~~~-~~~~~~~Sa~~~~g  181 (196)
T PRK00454        127 MIEWLKEYGIPVLIVLTKADKLKKGERK------------------------KQLKKVRKALKFG-DDEVILFSSLKKQG  181 (196)
T ss_pred             HHHHHHHcCCcEEEEEECcccCCHHHHH------------------------HHHHHHHHHHHhc-CCceEEEEcCCCCC
Confidence            4444556688899999999998654321                        1222233333322 45666899999999


Q ss_pred             hHHHHHHhhhc
Q psy5059         451 TSESLKLAKET  461 (1036)
Q Consensus       451 ~qeil~la~~v  461 (1036)
                      +.++++.....
T Consensus       182 i~~l~~~i~~~  192 (196)
T PRK00454        182 IDELRAAIAKW  192 (196)
T ss_pred             HHHHHHHHHHH
Confidence            99999886554


No 29 
>COG1159 Era GTPase [General function prediction only]
Probab=99.03  E-value=2.6e-09  Score=117.10  Aligned_cols=74  Identities=16%  Similarity=0.108  Sum_probs=54.6

Q ss_pred             HhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhh
Q psy5059         371 LAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMA  450 (1036)
Q Consensus       371 la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~  450 (1036)
                      +...+-....+.|.++||+|...+.+.                          +...+..+-....+..++-|||+++.+
T Consensus       106 il~~lk~~~~pvil~iNKID~~~~~~~--------------------------l~~~~~~~~~~~~f~~ivpiSA~~g~n  159 (298)
T COG1159         106 ILEQLKKTKTPVILVVNKIDKVKPKTV--------------------------LLKLIAFLKKLLPFKEIVPISALKGDN  159 (298)
T ss_pred             HHHHHhhcCCCeEEEEEccccCCcHHH--------------------------HHHHHHHHHhhCCcceEEEeeccccCC
Confidence            333333356799999999999987543                          223344444455555888899999999


Q ss_pred             hHHHHHHhhhcCcCCCceee
Q psy5059         451 TSESLKLAKETDVDGRRTLA  470 (1036)
Q Consensus       451 ~qeil~la~~vd~~g~RtIg  470 (1036)
                      +..+++.....-|+|....+
T Consensus       160 ~~~L~~~i~~~Lpeg~~~yp  179 (298)
T COG1159         160 VDTLLEIIKEYLPEGPWYYP  179 (298)
T ss_pred             HHHHHHHHHHhCCCCCCcCC
Confidence            99999999999888887765


No 30 
>PRK00089 era GTPase Era; Reviewed
Probab=99.01  E-value=5.9e-09  Score=116.76  Aligned_cols=69  Identities=14%  Similarity=0.115  Sum_probs=45.1

Q ss_pred             hhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhH
Q psy5059         373 KETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATS  452 (1036)
Q Consensus       373 ~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~q  452 (1036)
                      ..+...+.+.+.|+||+|+....                          ..+...+..+-.......+..+||+++.+..
T Consensus       107 ~~l~~~~~pvilVlNKiDl~~~~--------------------------~~l~~~~~~l~~~~~~~~i~~iSA~~~~gv~  160 (292)
T PRK00089        107 EKLKKVKTPVILVLNKIDLVKDK--------------------------EELLPLLEELSELMDFAEIVPISALKGDNVD  160 (292)
T ss_pred             HHHhhcCCCEEEEEECCcCCCCH--------------------------HHHHHHHHHHHhhCCCCeEEEecCCCCCCHH
Confidence            33334468999999999998421                          1122222222222345677889999999999


Q ss_pred             HHHHHhhhcCcCCCc
Q psy5059         453 ESLKLAKETDVDGRR  467 (1036)
Q Consensus       453 eil~la~~vd~~g~R  467 (1036)
                      ++++...+.-+.+..
T Consensus       161 ~L~~~L~~~l~~~~~  175 (292)
T PRK00089        161 ELLDVIAKYLPEGPP  175 (292)
T ss_pred             HHHHHHHHhCCCCCC
Confidence            999888777655543


No 31 
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=98.99  E-value=5.5e-09  Score=104.78  Aligned_cols=68  Identities=15%  Similarity=0.069  Sum_probs=46.5

Q ss_pred             HHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhcc-CCCcceeeeecccc
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYIS-NPNSIILAVVTANT  447 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~-~~~~ipla~ISA~t  447 (1036)
                      ..+.+.++..+.+.+.|+||+|++.++...                        .....+...++ .....++..+||++
T Consensus       100 ~~~~~~l~~~~~~vi~v~nK~D~~~~~~~~------------------------~~~~~~~~~l~~~~~~~~~~~~Sa~~  155 (170)
T cd01876         100 LEMLDWLEELGIPFLVVLTKADKLKKSELA------------------------KALKEIKKELKLFEIDPPIILFSSLK  155 (170)
T ss_pred             HHHHHHHHHcCCCEEEEEEchhcCChHHHH------------------------HHHHHHHHHHHhccCCCceEEEecCC
Confidence            345666666678999999999998665332                        12223333343 44556777999999


Q ss_pred             hhhhHHHHHHhhh
Q psy5059         448 DMATSESLKLAKE  460 (1036)
Q Consensus       448 d~~~qeil~la~~  460 (1036)
                      +....++++...+
T Consensus       156 ~~~~~~l~~~l~~  168 (170)
T cd01876         156 GQGIDELRALIEK  168 (170)
T ss_pred             CCCHHHHHHHHHH
Confidence            9999998877543


No 32 
>PRK12298 obgE GTPase CgtA; Reviewed
Probab=98.94  E-value=5.5e-09  Score=121.51  Aligned_cols=25  Identities=24%  Similarity=0.478  Sum_probs=22.7

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +..|++||.+||||||||++|++..
T Consensus       159 iadValVG~PNaGKSTLln~Lt~~k  183 (390)
T PRK12298        159 LADVGLLGLPNAGKSTFIRAVSAAK  183 (390)
T ss_pred             cccEEEEcCCCCCHHHHHHHHhCCc
Confidence            3599999999999999999999765


No 33 
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=98.91  E-value=1.2e-08  Score=102.58  Aligned_cols=56  Identities=21%  Similarity=0.220  Sum_probs=37.3

Q ss_pred             CceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCC--CcceeeeecccchhhhHHHHHH
Q psy5059         380 RRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNP--NSIILAVVTANTDMATSESLKL  457 (1036)
Q Consensus       380 ~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~--~~ipla~ISA~td~~~qeil~l  457 (1036)
                      ++.|.|+||+|+.++...                        ......+...++..  ...++..+||+++.+..+++..
T Consensus       105 ~~~ilv~NK~Dl~~~~~~------------------------~~~~~~~~~~~~~~~~~~~~~~~~Sa~~~~~v~~l~~~  160 (164)
T cd04171         105 KRGLVVLTKADLVDEDWL------------------------ELVEEEIRELLAGTFLADAPIFPVSAVTGEGIEELKEY  160 (164)
T ss_pred             CcEEEEEECccccCHHHH------------------------HHHHHHHHHHHHhcCcCCCcEEEEeCCCCcCHHHHHHH
Confidence            389999999999754211                        11222333333332  3567889999999999999877


Q ss_pred             hh
Q psy5059         458 AK  459 (1036)
Q Consensus       458 a~  459 (1036)
                      ..
T Consensus       161 l~  162 (164)
T cd04171         161 LD  162 (164)
T ss_pred             Hh
Confidence            54


No 34 
>TIGR03156 GTP_HflX GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like).
Probab=98.91  E-value=2.3e-08  Score=114.90  Aligned_cols=28  Identities=29%  Similarity=0.640  Sum_probs=25.3

Q ss_pred             CCCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          81 IQLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        81 i~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -..|+|+++|.+|+|||||+++|+|..+
T Consensus       187 ~~~~~ValvG~~NvGKSSLln~L~~~~~  214 (351)
T TIGR03156       187 ADVPTVALVGYTNAGKSTLFNALTGADV  214 (351)
T ss_pred             cCCcEEEEECCCCCCHHHHHHHHhCCce
Confidence            3579999999999999999999998763


No 35 
>TIGR03594 GTPase_EngA ribosome-associated GTPase EngA. EngA (YfgK, Der) is a ribosome-associated essential GTPase with a duplication of its GTP-binding domain. It is broadly to universally distributed among bacteria. It appears to function in ribosome biogenesis or stability.
Probab=98.89  E-value=1.1e-08  Score=120.72  Aligned_cols=112  Identities=21%  Similarity=0.224  Sum_probs=74.4

Q ss_pred             ccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCCCCCcccceeccCCC
Q psy5059         241 LNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLDIDLP  320 (1036)
Q Consensus       241 ~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp~g~RTigvl~~~~~  320 (1036)
                      ..+.++||||+..     ....+.+.+...+..+++..+. +|+|+++.......+                        
T Consensus        47 ~~~~liDTpG~~~-----~~~~~~~~~~~~~~~~~~~ad~-vl~vvD~~~~~~~~d------------------------   96 (429)
T TIGR03594        47 REFILIDTGGIEE-----DDDGLDKQIREQAEIAIEEADV-ILFVVDGREGLTPED------------------------   96 (429)
T ss_pred             eEEEEEECCCCCC-----cchhHHHHHHHHHHHHHhhCCE-EEEEEeCCCCCCHHH------------------------
Confidence            3588999999842     2344666778888888888884 444445544333222                        


Q ss_pred             CcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCceEEEEecccccCCCchhhh
Q psy5059         321 GITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAID  400 (1036)
Q Consensus       321 g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~  400 (1036)
                                                                      ..+++.+...++++|.|+||+|+.+......+
T Consensus        97 ------------------------------------------------~~i~~~l~~~~~piilVvNK~D~~~~~~~~~~  128 (429)
T TIGR03594        97 ------------------------------------------------EEIAKWLRKSGKPVILVANKIDGKKEDAVAAE  128 (429)
T ss_pred             ------------------------------------------------HHHHHHHHHhCCCEEEEEECccCCcccccHHH
Confidence                                                            34566666678999999999999865432210


Q ss_pred             hhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhhc
Q psy5059         401 ILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKET  461 (1036)
Q Consensus       401 ~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~v  461 (1036)
                                                     +..+.......+||.++..+.++++.....
T Consensus       129 -------------------------------~~~lg~~~~~~vSa~~g~gv~~ll~~i~~~  158 (429)
T TIGR03594       129 -------------------------------FYSLGFGEPIPISAEHGRGIGDLLDAILEL  158 (429)
T ss_pred             -------------------------------HHhcCCCCeEEEeCCcCCChHHHHHHHHHh
Confidence                                           112233346789999999999998876554


No 36 
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=98.88  E-value=1.9e-08  Score=100.44  Aligned_cols=63  Identities=14%  Similarity=0.073  Sum_probs=40.8

Q ss_pred             HhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhh
Q psy5059         371 LAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMA  450 (1036)
Q Consensus       371 la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~  450 (1036)
                      +.+.+...+.+.+.|+||+|+.+...                          ................++..+|++++..
T Consensus       103 ~~~~~~~~~~~~iiv~nK~Dl~~~~~--------------------------~~~~~~~~~~~~~~~~~~~~~s~~~~~~  156 (168)
T cd04163         103 ILELLKKSKTPVILVLNKIDLVKDKE--------------------------DLLPLLEKLKELGPFAEIFPISALKGEN  156 (168)
T ss_pred             HHHHHHHhCCCEEEEEEchhccccHH--------------------------HHHHHHHHHHhccCCCceEEEEeccCCC
Confidence            33444444788999999999984211                          1122222222334466788899999999


Q ss_pred             hHHHHHHhh
Q psy5059         451 TSESLKLAK  459 (1036)
Q Consensus       451 ~qeil~la~  459 (1036)
                      ..+++....
T Consensus       157 ~~~l~~~l~  165 (168)
T cd04163         157 VDELLEEIV  165 (168)
T ss_pred             hHHHHHHHH
Confidence            999887754


No 37 
>KOG1191|consensus
Probab=98.87  E-value=1.1e-09  Score=125.70  Aligned_cols=64  Identities=23%  Similarity=0.269  Sum_probs=43.8

Q ss_pred             CCCcEEEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccch
Q psy5059         227 CSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSE  296 (1036)
Q Consensus       227 S~d~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~  296 (1036)
                      |+|.|...+. ++.....|+||+|+.+  ..++.  ++++==+-.++-+...+ +|++|++|+.-+..|+
T Consensus       303 TRDaiea~v~-~~G~~v~L~DTAGiRe--~~~~~--iE~~gI~rA~k~~~~ad-vi~~vvda~~~~t~sd  366 (531)
T KOG1191|consen  303 TRDAIEAQVT-VNGVPVRLSDTAGIRE--ESNDG--IEALGIERARKRIERAD-VILLVVDAEESDTESD  366 (531)
T ss_pred             chhhheeEee-cCCeEEEEEecccccc--ccCCh--hHHHhHHHHHHHHhhcC-EEEEEecccccccccc
Confidence            7899999988 7889999999999988  22222  22222233456677777 7778887765555554


No 38 
>PRK04213 GTP-binding protein; Provisional
Probab=98.85  E-value=4e-08  Score=103.54  Aligned_cols=27  Identities=41%  Similarity=0.730  Sum_probs=24.2

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ..++|+++|..++||||++++|+|..|
T Consensus         8 ~~~~i~i~G~~~~GKSsLin~l~~~~~   34 (201)
T PRK04213          8 RKPEIVFVGRSNVGKSTLVRELTGKKV   34 (201)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCCC
Confidence            468999999999999999999998764


No 39 
>cd04165 GTPBP1_like GTPBP1-like.  Mammalian GTP binding protein 1 (GTPBP1), GTPBP2, and nematode homologs AGP-1 and CGP-1 are GTPases whose specific functions remain unknown.  In mouse, GTPBP1 is expressed in macrophages, in smooth muscle cells of various tissues and in some neurons of the cerebral cortex; GTPBP2 tissue distribution appears to overlap that of GTPBP1.  In human leukemia and macrophage cell lines, expression of both GTPBP1 and GTPBP2 is enhanced by interferon-gamma (IFN-gamma).  The chromosomal location of both genes has been identified in humans, with GTPBP1 located in chromosome 22q12-13.1 and GTPBP2 located in chromosome 6p21-12.  Human glioblastoma multiforme (GBM), a highly-malignant astrocytic glioma and the most common cancer in the central nervous system, has been linked to chromosomal deletions and a translocation on chromosome 6.  The GBM translocation results in a fusion of GTPBP2 and PTPRZ1, a protein involved in oligodendrocyte differentiation, recovery, and
Probab=98.84  E-value=2.8e-08  Score=107.43  Aligned_cols=89  Identities=18%  Similarity=-0.000  Sum_probs=48.2

Q ss_pred             HHHhhhccccCCceEEEEecccccCCCch--hhhhhc---CcccccccccccccchHHHHHHHHHHhhccCCCcceeeee
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAGTD--AIDILC---GRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVV  443 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g~~--~~~~l~---~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~I  443 (1036)
                      ..++..+...|.+.|+|+||+|+.++..-  ..+-+.   ...-.-+.++.- ++.  +.+. .....+......|+..+
T Consensus       128 ~~~l~~l~~~~ip~ivvvNK~D~~~~~~~~~~~~~l~~~L~~~g~~~~p~~~-~~~--~~~~-~~~~~~~~~~~~pi~~v  203 (224)
T cd04165         128 KEHLGLALALNIPVFVVVTKIDLAPANILQETLKDLKRILKVPGVRKLPVPV-KSD--DDVV-LAASNFSSERIVPIFQV  203 (224)
T ss_pred             HHHHHHHHHcCCCEEEEEECccccCHHHHHHHHHHHHHHhcCCCccccceee-ecc--ccee-ehhhcCCccccCcEEEe
Confidence            55777778889999999999999764311  110000   000000000000 000  0000 00122344556699999


Q ss_pred             cccchhhhHHHHHHhhhc
Q psy5059         444 TANTDMATSESLKLAKET  461 (1036)
Q Consensus       444 SA~td~~~qeil~la~~v  461 (1036)
                      ||.++.+...+.+....+
T Consensus       204 Savtg~Gi~~L~~~L~~l  221 (224)
T cd04165         204 SNVTGEGLDLLHAFLNLL  221 (224)
T ss_pred             eCCCccCHHHHHHHHHhc
Confidence            999999999988776543


No 40 
>PRK03003 GTP-binding protein Der; Reviewed
Probab=98.83  E-value=3.4e-08  Score=118.10  Aligned_cols=26  Identities=35%  Similarity=0.754  Sum_probs=24.1

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ..|.|++||.+++|||||+++|+|..
T Consensus        37 ~~~~V~IvG~~nvGKSSL~nrl~~~~   62 (472)
T PRK03003         37 PLPVVAVVGRPNVGKSTLVNRILGRR   62 (472)
T ss_pred             CCCEEEEEcCCCCCHHHHHHHHhCcC
Confidence            56999999999999999999999865


No 41 
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=98.81  E-value=4.4e-08  Score=99.21  Aligned_cols=25  Identities=20%  Similarity=0.538  Sum_probs=22.9

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      |.|+++|..++||||++++|.+-.|
T Consensus         1 ~~i~iiG~~~~GKtsli~~l~~~~~   25 (168)
T cd01887           1 PVVTVMGHVDHGKTTLLDKIRKTNV   25 (168)
T ss_pred             CEEEEEecCCCCHHHHHHHHHhccc
Confidence            7799999999999999999987764


No 42 
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=98.80  E-value=4.9e-08  Score=99.22  Aligned_cols=55  Identities=20%  Similarity=0.163  Sum_probs=37.3

Q ss_pred             cCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHH
Q psy5059         378 DGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKL  457 (1036)
Q Consensus       378 ~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~l  457 (1036)
                      .+.+.+.|+||+|+.++...                           ...+..........+...+||+++.+..++++.
T Consensus       113 ~~~p~ivv~NK~Dl~~~~~~---------------------------~~~~~~~~~~~~~~~~~~~Sa~~~~gi~~l~~~  165 (170)
T cd01898         113 LEKPRIVVLNKIDLLDEEEL---------------------------FELLKELLKELWGKPVFPISALTGEGLDELLRK  165 (170)
T ss_pred             cccccEEEEEchhcCCchhh---------------------------HHHHHHHHhhCCCCCEEEEecCCCCCHHHHHHH
Confidence            46789999999999765322                           112222223223456778999999999999877


Q ss_pred             hh
Q psy5059         458 AK  459 (1036)
Q Consensus       458 a~  459 (1036)
                      ..
T Consensus       166 i~  167 (170)
T cd01898         166 LA  167 (170)
T ss_pred             HH
Confidence            54


No 43 
>PF00009 GTP_EFTU:  Elongation factor Tu GTP binding domain;  InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site. The proteins are all relatively similar in the vicinity of their C-termini, and are also highly similar to a range of proteins that includes the nodulation Q protein from Rhizobium meliloti (Sinorhizobium meliloti), bacterial tetracycline resistance proteins [] and the omnipotent suppressor protein 2 from yeast. In both prokaryotes and eukaryotes, there are three distinct types of elongation factors, EF-1alpha (EF-Tu), which binds GTP and an aminoacyl-tRNAand delivers the latter to the A site of ribosomes; EF-1beta (EF-Ts), which interacts with EF-1a/EF-Tu to displace GDP and thus allows the regeneration of GTP-EF-1a; and EF-2 (EF-G), which binds GTP and peptidyl-tRNA and translocates the latter from the A site to the P site. In EF-1-alpha, a specific region has been shown [] to be involved in a conformational change mediated by the hydrolysis of GTP to GDP. This region is conserved in both EF-1alpha/EF-Tu as well as EF-2/EF-G and thus seems typical for GTP-dependent proteins which bind non-initiator tRNAs to the ribosome. The GTP-binding protein synthesis factor family also includes the eukaryotic peptide chain release factor GTP-binding subunits [] and prokaryotic peptide chain release factor 3 (RF-3) []; the prokaryotic GTP-binding protein lepA and its homologue in yeast (GUF1) and Caenorhabditis elegans (ZK1236.1); yeast HBS1 []; rat statin S1 []; and the prokaryotic selenocysteine-specific elongation factor selB [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3IZW_C 1DG1_G 2BVN_B 3IZV_C 3MMP_C 1OB2_A 1EFU_A 3FIH_Z 3TR5_A 1TUI_C ....
Probab=98.79  E-value=3e-08  Score=103.85  Aligned_cols=73  Identities=21%  Similarity=0.168  Sum_probs=47.4

Q ss_pred             HHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCC--Ccceeeeeccc
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNP--NSIILAVVTAN  446 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~--~~ipla~ISA~  446 (1036)
                      ....+.+...+.+.|+|+||+|+....-..                     ..+++...+.+.....  ...|++.+||+
T Consensus       112 ~~~l~~~~~~~~p~ivvlNK~D~~~~~~~~---------------------~~~~~~~~l~~~~~~~~~~~~~vi~~Sa~  170 (188)
T PF00009_consen  112 EEHLKILRELGIPIIVVLNKMDLIEKELEE---------------------IIEEIKEKLLKEYGENGEEIVPVIPISAL  170 (188)
T ss_dssp             HHHHHHHHHTT-SEEEEEETCTSSHHHHHH---------------------HHHHHHHHHHHHTTSTTTSTEEEEEEBTT
T ss_pred             ccccccccccccceEEeeeeccchhhhHHH---------------------HHHHHHHHhccccccCccccceEEEEecC
Confidence            446666677788899999999999221111                     1122332222222333  47899999999


Q ss_pred             chhhhHHHHHHhhhcC
Q psy5059         447 TDMATSESLKLAKETD  462 (1036)
Q Consensus       447 td~~~qeil~la~~vd  462 (1036)
                      +|.+..++++...+.-
T Consensus       171 ~g~gi~~Ll~~l~~~~  186 (188)
T PF00009_consen  171 TGDGIDELLEALVELL  186 (188)
T ss_dssp             TTBTHHHHHHHHHHHS
T ss_pred             CCCCHHHHHHHHHHhC
Confidence            9999999998876543


No 44 
>PRK11058 GTPase HflX; Provisional
Probab=98.79  E-value=6.2e-08  Score=114.00  Aligned_cols=28  Identities=21%  Similarity=0.501  Sum_probs=25.2

Q ss_pred             CCCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          81 IQLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        81 i~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -.+|.|++||.+|+|||||+++|+|..+
T Consensus       195 ~~~p~ValVG~~NaGKSSLlN~Lt~~~~  222 (426)
T PRK11058        195 ADVPTVSLVGYTNAGKSTLFNRITEARV  222 (426)
T ss_pred             cCCCEEEEECCCCCCHHHHHHHHhCCce
Confidence            3579999999999999999999998764


No 45 
>PRK12299 obgE GTPase CgtA; Reviewed
Probab=98.78  E-value=4.3e-08  Score=112.00  Aligned_cols=25  Identities=28%  Similarity=0.520  Sum_probs=22.9

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ++.|++||-+||||||||++|++..
T Consensus       158 ~adVglVG~PNaGKSTLln~ls~a~  182 (335)
T PRK12299        158 LADVGLVGLPNAGKSTLISAVSAAK  182 (335)
T ss_pred             cCCEEEEcCCCCCHHHHHHHHHcCC
Confidence            4899999999999999999998754


No 46 
>PRK15494 era GTPase Era; Provisional
Probab=98.78  E-value=9.1e-08  Score=109.70  Aligned_cols=69  Identities=14%  Similarity=0.096  Sum_probs=45.8

Q ss_pred             hccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHH
Q psy5059         374 ETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSE  453 (1036)
Q Consensus       374 ~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qe  453 (1036)
                      .+...+.+.|.|+||+|+.++.   .                      ..+.+.+..   ......+..+||+++.++.+
T Consensus       155 ~l~~~~~p~IlViNKiDl~~~~---~----------------------~~~~~~l~~---~~~~~~i~~iSAktg~gv~e  206 (339)
T PRK15494        155 KLRSLNIVPIFLLNKIDIESKY---L----------------------NDIKAFLTE---NHPDSLLFPISALSGKNIDG  206 (339)
T ss_pred             HHHhcCCCEEEEEEhhcCcccc---H----------------------HHHHHHHHh---cCCCcEEEEEeccCccCHHH
Confidence            3334456789999999996431   1                      112222221   12235678899999999999


Q ss_pred             HHHHhhhcCcCCCceee
Q psy5059         454 SLKLAKETDVDGRRTLA  470 (1036)
Q Consensus       454 il~la~~vd~~g~RtIg  470 (1036)
                      ++......-+.|....+
T Consensus       207 L~~~L~~~l~~~~~~~~  223 (339)
T PRK15494        207 LLEYITSKAKISPWLYA  223 (339)
T ss_pred             HHHHHHHhCCCCCCCCC
Confidence            99998888777776554


No 47 
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=98.77  E-value=1.3e-07  Score=99.86  Aligned_cols=28  Identities=29%  Similarity=0.617  Sum_probs=25.2

Q ss_pred             CCCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          81 IQLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        81 i~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -..|.|+++|.++|||||++++|+|..+
T Consensus        39 ~~~~~I~iiG~~g~GKStLl~~l~~~~~   66 (204)
T cd01878          39 SGIPTVALVGYTNAGKSTLFNALTGADV   66 (204)
T ss_pred             cCCCeEEEECCCCCCHHHHHHHHhcchh
Confidence            4579999999999999999999998764


No 48 
>PRK00093 GTP-binding protein Der; Reviewed
Probab=98.74  E-value=5e-08  Score=115.36  Aligned_cols=25  Identities=36%  Similarity=0.672  Sum_probs=23.1

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +|.|+++|.+++|||||+++|+|..
T Consensus         1 ~~~I~ivG~~~vGKStL~n~l~~~~   25 (435)
T PRK00093          1 KPVVAIVGRPNVGKSTLFNRLTGKR   25 (435)
T ss_pred             CCEEEEECCCCCCHHHHHHHHhCCC
Confidence            3789999999999999999999876


No 49 
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=98.73  E-value=1.9e-07  Score=94.91  Aligned_cols=25  Identities=32%  Similarity=0.539  Sum_probs=23.1

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      |.|+++|.+++||||++++|+|..+
T Consensus         1 ~~i~~~G~~~~GKssli~~l~~~~~   25 (168)
T cd01897           1 PTLVIAGYPNVGKSSLVNKLTRAKP   25 (168)
T ss_pred             CeEEEEcCCCCCHHHHHHHHhcCCC
Confidence            7899999999999999999998764


No 50 
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=98.73  E-value=1.2e-07  Score=94.48  Aligned_cols=57  Identities=14%  Similarity=0.080  Sum_probs=37.6

Q ss_pred             HhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhh
Q psy5059         371 LAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMA  450 (1036)
Q Consensus       371 la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~  450 (1036)
                      +.+.+...+.+.|+|+||+|+.++...                               ...+......+...+||+++..
T Consensus        97 ~~~~~~~~~~piiiv~nK~D~~~~~~~-------------------------------~~~~~~~~~~~~~~~Sa~~~~g  145 (157)
T cd01894          97 IAKYLRKSKKPVILVVNKVDNIKEEDE-------------------------------AAEFYSLGFGEPIPISAEHGRG  145 (157)
T ss_pred             HHHHHHhcCCCEEEEEECcccCChHHH-------------------------------HHHHHhcCCCCeEEEecccCCC
Confidence            344444457899999999999764211                               0111122233567899999999


Q ss_pred             hHHHHHHh
Q psy5059         451 TSESLKLA  458 (1036)
Q Consensus       451 ~qeil~la  458 (1036)
                      +.+++...
T Consensus       146 v~~l~~~l  153 (157)
T cd01894         146 IGDLLDAI  153 (157)
T ss_pred             HHHHHHHH
Confidence            99988765


No 51 
>PRK09518 bifunctional cytidylate kinase/GTPase Der; Reviewed
Probab=98.73  E-value=5.8e-08  Score=121.57  Aligned_cols=25  Identities=24%  Similarity=0.631  Sum_probs=23.3

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +|.|+++|.+++|||||+++|+|..
T Consensus       275 ~~~V~IvG~~nvGKSSL~n~l~~~~  299 (712)
T PRK09518        275 VGVVAIVGRPNVGKSTLVNRILGRR  299 (712)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCC
Confidence            5899999999999999999999875


No 52 
>PRK12296 obgE GTPase CgtA; Reviewed
Probab=98.71  E-value=8.8e-08  Score=113.82  Aligned_cols=25  Identities=36%  Similarity=0.534  Sum_probs=23.0

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ++.|++||.+||||||||++|++..
T Consensus       159 ~adV~LVG~PNAGKSTLln~Ls~ak  183 (500)
T PRK12296        159 VADVGLVGFPSAGKSSLISALSAAK  183 (500)
T ss_pred             cceEEEEEcCCCCHHHHHHHHhcCC
Confidence            4899999999999999999999765


No 53 
>PRK12297 obgE GTPase CgtA; Reviewed
Probab=98.70  E-value=1.4e-07  Score=110.74  Aligned_cols=24  Identities=21%  Similarity=0.397  Sum_probs=22.3

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +.|++||.+||||||||++|++..
T Consensus       159 adVglVG~pNaGKSTLLn~Lt~ak  182 (424)
T PRK12297        159 ADVGLVGFPNVGKSTLLSVVSNAK  182 (424)
T ss_pred             CcEEEEcCCCCCHHHHHHHHHcCC
Confidence            599999999999999999999765


No 54 
>COG1084 Predicted GTPase [General function prediction only]
Probab=98.68  E-value=5.4e-07  Score=99.92  Aligned_cols=47  Identities=28%  Similarity=0.391  Sum_probs=37.2

Q ss_pred             hhHHHHHHHHHhhhhcCCCCCCCCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          61 TAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        61 ~~~~l~~kL~~~~~~~g~~~i~lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .-++.+++.++.+..+-.-+.++|.|||.|-+|+||||++.+|++-+
T Consensus       146 ~~L~fL~~~r~~l~~LP~Idp~~pTivVaG~PNVGKSSlv~~lT~Ak  192 (346)
T COG1084         146 DDLEFLRKARDHLKKLPAIDPDLPTIVVAGYPNVGKSSLVRKLTTAK  192 (346)
T ss_pred             HHHHHHHHHHHHHhcCCCCCCCCCeEEEecCCCCcHHHHHHHHhcCC
Confidence            33455556666555555567889999999999999999999999876


No 55 
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily.  Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus.  In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed.  Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages.  Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway.  Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.
Probab=98.66  E-value=2.4e-07  Score=96.52  Aligned_cols=24  Identities=38%  Similarity=0.594  Sum_probs=21.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+++|||||+++++.+..|
T Consensus         5 kv~~vG~~~~GKTsli~~~~~~~~   28 (183)
T cd04152           5 HIVMLGLDSAGKTTVLYRLKFNEF   28 (183)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCc
Confidence            699999999999999999987664


No 56 
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=98.66  E-value=1.8e-07  Score=93.61  Aligned_cols=62  Identities=11%  Similarity=0.057  Sum_probs=39.7

Q ss_pred             HhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhh
Q psy5059         371 LAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMA  450 (1036)
Q Consensus       371 la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~  450 (1036)
                      +..++...+.+.|+|+||+|+.+.....                       ... ..+...+    ..+...+||.++.+
T Consensus        93 ~~~~~~~~~~~~iiv~NK~Dl~~~~~~~-----------------------~~~-~~~~~~~----~~~~~~iSa~~~~~  144 (158)
T cd01879          93 LTLQLLELGLPVVVALNMIDEAEKRGIK-----------------------IDL-DKLSELL----GVPVVPTSARKGEG  144 (158)
T ss_pred             HHHHHHHcCCCEEEEEehhhhcccccch-----------------------hhH-HHHHHhh----CCCeEEEEccCCCC
Confidence            3334444688999999999997653111                       111 1122222    24678899999999


Q ss_pred             hHHHHHHhhh
Q psy5059         451 TSESLKLAKE  460 (1036)
Q Consensus       451 ~qeil~la~~  460 (1036)
                      ..+++.....
T Consensus       145 ~~~l~~~l~~  154 (158)
T cd01879         145 IDELKDAIAE  154 (158)
T ss_pred             HHHHHHHHHH
Confidence            9998877544


No 57 
>cd04166 CysN_ATPS CysN_ATPS subfamily.  CysN, together with protein CysD, form the ATP sulfurylase (ATPS) complex in some bacteria and lower eukaryotes.  ATPS catalyzes the production of ATP sulfurylase (APS) and pyrophosphate (PPi) from ATP and sulfate.  CysD, which catalyzes ATP hydrolysis, is a member of the ATP pyrophosphatase (ATP PPase) family.  CysN hydrolysis of GTP is required for CysD hydrolysis of ATP; however, CysN hydrolysis of GTP is not dependent on CysD hydrolysis of ATP.  CysN is an example of lateral gene transfer followed by acquisition of new function.  In many organisms, an ATPS exists which is not GTP-dependent and shares no sequence or structural similarity to CysN.
Probab=98.66  E-value=2.6e-07  Score=98.60  Aligned_cols=23  Identities=30%  Similarity=0.504  Sum_probs=20.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +|+++|..++|||||+++|++..
T Consensus         1 ~i~iiG~~~~GKStL~~~Ll~~~   23 (208)
T cd04166           1 RFLTCGSVDDGKSTLIGRLLYDS   23 (208)
T ss_pred             CEEEEECCCCCHHHHHHHHHHHc
Confidence            58999999999999999998754


No 58 
>cd00881 GTP_translation_factor GTP translation factor family.  This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation.  In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.
Probab=98.65  E-value=4.5e-07  Score=93.45  Aligned_cols=24  Identities=21%  Similarity=0.315  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .|+|+|+.+|||||++++|.+..+
T Consensus         1 ~v~v~G~~~~GKStlln~l~~~~~   24 (189)
T cd00881           1 NVGIAGHVDHGKTTLTERLLYVTG   24 (189)
T ss_pred             CEEEEeCCCCCHHHHHHHHHHhcC
Confidence            379999999999999999999874


No 59 
>cd01884 EF_Tu EF-Tu subfamily.  This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts.  It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors.  The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family.  EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function.  When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors.  Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=98.65  E-value=1.6e-07  Score=99.46  Aligned_cols=60  Identities=12%  Similarity=0.096  Sum_probs=40.9

Q ss_pred             HHHhhhccccCCc-eEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCC----Ccceeeee
Q psy5059         369 LKLAKETDVDGRR-TLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNP----NSIILAVV  443 (1036)
Q Consensus       369 ~~la~~~d~~g~r-ti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~----~~ipla~I  443 (1036)
                      ..+++.+...|.+ .|+|+||+|++++. +..                      +.+.+.+..++++.    ..+|+++|
T Consensus       107 ~~~~~~~~~~~~~~iIvviNK~D~~~~~-~~~----------------------~~~~~~i~~~l~~~g~~~~~v~iipi  163 (195)
T cd01884         107 REHLLLARQVGVPYIVVFLNKADMVDDE-ELL----------------------ELVEMEVRELLSKYGFDGDNTPIVRG  163 (195)
T ss_pred             HHHHHHHHHcCCCcEEEEEeCCCCCCcH-HHH----------------------HHHHHHHHHHHHHhcccccCCeEEEe
Confidence            4466666777876 67999999997432 111                      33445566666544    45999999


Q ss_pred             cccchhhh
Q psy5059         444 TANTDMAT  451 (1036)
Q Consensus       444 SA~td~~~  451 (1036)
                      ||++|.+.
T Consensus       164 Sa~~g~n~  171 (195)
T cd01884         164 SALKALEG  171 (195)
T ss_pred             eCccccCC
Confidence            99998874


No 60 
>TIGR02729 Obg_CgtA Obg family GTPase CgtA. This model describes a univeral, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation. This GTPase, related to the nucleolar protein Obg, is designated CgtA in bacteria. Mutations in this gene are pleiotropic, but it appears that effects on cellular functions such as chromosome partition may be secondary to the effect on ribosome structure. Recent work done in Vibrio cholerae shows an essential role in the stringent response, in which RelA-dependent ability to synthesize the alarmone ppGpp is required for deletion of this GTPase to be lethal.
Probab=98.64  E-value=1.9e-07  Score=106.47  Aligned_cols=25  Identities=28%  Similarity=0.520  Sum_probs=22.8

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ++.|++||.+||||||||++|++..
T Consensus       157 ~adV~lvG~pnaGKSTLl~~lt~~~  181 (329)
T TIGR02729       157 LADVGLVGLPNAGKSTLISAVSAAK  181 (329)
T ss_pred             cccEEEEcCCCCCHHHHHHHHhcCC
Confidence            4899999999999999999998764


No 61 
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=98.64  E-value=4.2e-07  Score=89.41  Aligned_cols=65  Identities=22%  Similarity=0.167  Sum_probs=43.3

Q ss_pred             hhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhh
Q psy5059         372 AKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMAT  451 (1036)
Q Consensus       372 a~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~  451 (1036)
                      .......+.+.++|+||+|++.......                        ...............+...+||.++..+
T Consensus        97 ~~~~~~~~~~~ivv~nK~D~~~~~~~~~------------------------~~~~~~~~~~~~~~~~~~~~sa~~~~~v  152 (163)
T cd00880          97 LELLRERGKPVLLVLNKIDLLPEEEEEE------------------------LLELRLLILLLLLGLPVIAVSALTGEGI  152 (163)
T ss_pred             HHHHHhcCCeEEEEEEccccCChhhHHH------------------------HHHHHHhhcccccCCceEEEeeeccCCH
Confidence            3344456788999999999987543321                        1111223344556678888999999999


Q ss_pred             HHHHHHhhh
Q psy5059         452 SESLKLAKE  460 (1036)
Q Consensus       452 qeil~la~~  460 (1036)
                      .+++.....
T Consensus       153 ~~l~~~l~~  161 (163)
T cd00880         153 DELREALIE  161 (163)
T ss_pred             HHHHHHHHh
Confidence            998877643


No 62 
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=98.64  E-value=3.5e-07  Score=93.99  Aligned_cols=58  Identities=22%  Similarity=0.317  Sum_probs=37.6

Q ss_pred             ccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHH
Q psy5059         377 VDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLK  456 (1036)
Q Consensus       377 ~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~  456 (1036)
                      ..+.+.|.|+||+|+.+....                         .....+...+. ..+.....+||+++.++.++++
T Consensus       117 ~~~~~iiiv~NK~Dl~~~~~~-------------------------~~~~~~~~~~~-~~~~~~~~~Sa~~g~gi~~l~~  170 (179)
T cd01890         117 ENNLEIIPVINKIDLPSADPE-------------------------RVKQQIEDVLG-LDPSEAILVSAKTGLGVEDLLE  170 (179)
T ss_pred             HcCCCEEEEEECCCCCcCCHH-------------------------HHHHHHHHHhC-CCcccEEEeeccCCCCHHHHHH
Confidence            357789999999999753211                         11122222222 2234567899999999999988


Q ss_pred             Hhhh
Q psy5059         457 LAKE  460 (1036)
Q Consensus       457 la~~  460 (1036)
                      ....
T Consensus       171 ~l~~  174 (179)
T cd01890         171 AIVE  174 (179)
T ss_pred             HHHh
Confidence            7643


No 63 
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=98.63  E-value=5e-07  Score=90.94  Aligned_cols=61  Identities=16%  Similarity=0.031  Sum_probs=41.4

Q ss_pred             ccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHH
Q psy5059         375 TDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSES  454 (1036)
Q Consensus       375 ~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qei  454 (1036)
                      ....+.+.+.|.||+|+....+.                        +.+.+.+..........+...+||+++.++.++
T Consensus        96 ~~~~~~piiiv~nK~D~~~~~~~------------------------~~~~~~~~~~~~~~~~~~~~~~Sa~~~~gv~~~  151 (158)
T cd00878          96 EELKGVPLLIFANKQDLPGALSV------------------------SELIEKLGLEKILGRRWHIQPCSAVTGDGLDEG  151 (158)
T ss_pred             cccCCCcEEEEeeccCCccccCH------------------------HHHHHhhChhhccCCcEEEEEeeCCCCCCHHHH
Confidence            33567899999999999764311                        223333332223445678889999999999999


Q ss_pred             HHHhh
Q psy5059         455 LKLAK  459 (1036)
Q Consensus       455 l~la~  459 (1036)
                      +....
T Consensus       152 ~~~l~  156 (158)
T cd00878         152 LDWLL  156 (158)
T ss_pred             HHHHh
Confidence            87653


No 64 
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1).  This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria.  The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2.  AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family.  The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections.  The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).
Probab=98.62  E-value=2.2e-07  Score=98.02  Aligned_cols=24  Identities=29%  Similarity=0.643  Sum_probs=22.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|.+++||||++|+|+|...
T Consensus         2 ~i~lvG~~g~GKSsl~N~ilg~~~   25 (196)
T cd01852           2 RLVLVGKTGAGKSATGNTILGREV   25 (196)
T ss_pred             EEEEECCCCCCHHHHHHHhhCCCc
Confidence            589999999999999999999873


No 65 
>TIGR02528 EutP ethanolamine utilization protein, EutP. This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site.
Probab=98.61  E-value=2.8e-07  Score=91.34  Aligned_cols=23  Identities=26%  Similarity=0.648  Sum_probs=21.1

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +|+++|++++|||||+++++|..
T Consensus         2 kv~liG~~~vGKSsL~~~l~~~~   24 (142)
T TIGR02528         2 RIMFIGSVGCGKTTLTQALQGEE   24 (142)
T ss_pred             eEEEECCCCCCHHHHHHHHcCCc
Confidence            68999999999999999998765


No 66 
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=98.60  E-value=3.9e-07  Score=92.38  Aligned_cols=25  Identities=28%  Similarity=0.570  Sum_probs=23.2

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+|+|+++|||||+++++.+..|
T Consensus         4 ~ki~vvG~~~~GKSsli~~l~~~~~   28 (165)
T cd01868           4 FKIVLIGDSGVGKSNLLSRFTRNEF   28 (165)
T ss_pred             eEEEEECCCCCCHHHHHHHHhcCCC
Confidence            5899999999999999999998875


No 67 
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=98.60  E-value=8e-07  Score=88.18  Aligned_cols=24  Identities=38%  Similarity=0.767  Sum_probs=22.3

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|.+++||||++++|.|..|
T Consensus         1 ~i~i~G~~~~GKssl~~~l~~~~~   24 (159)
T cd04159           1 EITLVGLQNSGKTTLVNVIAGGQF   24 (159)
T ss_pred             CEEEEcCCCCCHHHHHHHHccCCC
Confidence            589999999999999999999875


No 68 
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=98.59  E-value=5e-07  Score=92.85  Aligned_cols=26  Identities=23%  Similarity=0.652  Sum_probs=23.2

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .-++|+++|.++||||||+++++|..
T Consensus        13 ~~~kv~ivG~~~~GKTsL~~~l~~~~   38 (173)
T cd04154          13 REMRILILGLDNAGKTTILKKLLGED   38 (173)
T ss_pred             CccEEEEECCCCCCHHHHHHHHccCC
Confidence            34789999999999999999999875


No 69 
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=98.59  E-value=3.4e-07  Score=90.71  Aligned_cols=25  Identities=32%  Similarity=0.571  Sum_probs=22.6

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+++|.++|||||+++++.+..+
T Consensus         1 ~~i~~~G~~~~GKStl~~~l~~~~~   25 (159)
T cd00154           1 FKIVLIGDSGVGKTSLLLRFVDGKF   25 (159)
T ss_pred             CeEEEECCCCCCHHHHHHHHHhCcC
Confidence            3689999999999999999998875


No 70 
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins.  GTPases act as molecular switches regulating diverse cellular processes.  DRG2 and DRG1 comprise the DRG subfamily in eukaryotes.  In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes.  It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=98.59  E-value=1.5e-06  Score=94.56  Aligned_cols=171  Identities=16%  Similarity=0.158  Sum_probs=88.5

Q ss_pred             ccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCCCCCcccceeccC--
Q psy5059         241 LNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLDID--  318 (1036)
Q Consensus       241 ~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp~g~RTigvl~~~--  318 (1036)
                      ..+.++|+||+...+....  .   ..+. +..++++.+.+++++...+.+..-..+...+++.+-...+.-+...+.  
T Consensus        47 ~~i~l~DtpG~~~~~~~~~--~---~~~~-~l~~~~~ad~il~V~D~t~~~~~~~~~~~~l~~~gi~l~~~~~~v~~~~~  120 (233)
T cd01896          47 AKIQLLDLPGIIEGAADGK--G---RGRQ-VIAVARTADLILMVLDATKPEGHREILERELEGVGIRLNKRPPNITIKKK  120 (233)
T ss_pred             eEEEEEECCCcccccccch--h---HHHH-HHHhhccCCEEEEEecCCcchhHHHHHHHHHHHcCceecCCCCeEEEEEE
Confidence            4678999999865432111  1   1222 246778888555554433322222233334443333223333333333  


Q ss_pred             CC-CcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhcc--ccCCceEEEEecccccCCC
Q psy5059         319 LP-GITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETD--VDGRRTLAVVTKIDLMDAG  395 (1036)
Q Consensus       319 ~~-g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d--~~g~rti~VitK~Dl~~~g  395 (1036)
                      .+ |+.-+.....++--++.++.+.++|=-.+.     .|-...+.+-++   +...+.  ..-.+++.|.||.|+.+..
T Consensus       121 ~~ggi~~~~~~~~~~~~~~~v~~~l~~~~i~~~-----~v~~~~~~~~~~---~~~~~~~~~~y~p~iiV~NK~Dl~~~~  192 (233)
T cd01896         121 KKGGINITSTVPLTKLDEKTIKAILREYKIHNA-----DVLIREDITVDD---LIDVIEGNRVYIPCLYVYNKIDLISIE  192 (233)
T ss_pred             ecCCEEEeccCCCCCCCHHHHHHHHHHhCeeeE-----EEEEccCCCHHH---HHHHHhCCceEeeEEEEEECccCCCHH
Confidence            22 222222233333346778888888832222     223333333333   444443  2346899999999996431


Q ss_pred             chhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhh
Q psy5059         396 TDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAK  459 (1036)
Q Consensus       396 ~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~  459 (1036)
                                                 +..    ....   ..+...+||+++.+..++++...
T Consensus       193 ---------------------------~~~----~~~~---~~~~~~~SA~~g~gi~~l~~~i~  222 (233)
T cd01896         193 ---------------------------ELD----LLAR---QPNSVVISAEKGLNLDELKERIW  222 (233)
T ss_pred             ---------------------------HHH----HHhc---CCCEEEEcCCCCCCHHHHHHHHH
Confidence                                       111    1111   12467789999999999987753


No 71 
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed
Probab=98.59  E-value=4.4e-07  Score=107.85  Aligned_cols=26  Identities=31%  Similarity=0.602  Sum_probs=23.5

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +-++|+++|.+++|||||+++|+|.+
T Consensus       214 ~~~kV~ivG~~nvGKSSLln~L~~~~  239 (449)
T PRK05291        214 EGLKVVIAGRPNVGKSSLLNALLGEE  239 (449)
T ss_pred             cCCEEEEECCCCCCHHHHHHHHhCCC
Confidence            34799999999999999999999876


No 72 
>PRK15467 ethanolamine utilization protein EutP; Provisional
Probab=98.58  E-value=5.3e-07  Score=92.06  Aligned_cols=54  Identities=15%  Similarity=0.229  Sum_probs=37.5

Q ss_pred             CCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCc-ceeeeecccchhhhHHHHHH
Q psy5059         379 GRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNS-IILAVVTANTDMATSESLKL  457 (1036)
Q Consensus       379 g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~-ipla~ISA~td~~~qeil~l  457 (1036)
                      +.+.++|+||+|+.+...                         ..+.    +.+..... .|+..+||+++.+++++++.
T Consensus        91 ~~~ii~v~nK~Dl~~~~~-------------------------~~~~----~~~~~~~~~~p~~~~Sa~~g~gi~~l~~~  141 (158)
T PRK15467         91 SKRQIAVISKTDMPDADV-------------------------AATR----KLLLETGFEEPIFELNSHDPQSVQQLVDY  141 (158)
T ss_pred             CCCeEEEEEccccCcccH-------------------------HHHH----HHHHHcCCCCCEEEEECCCccCHHHHHHH
Confidence            567999999999864321                         1122    22222222 68999999999999999988


Q ss_pred             hhhc
Q psy5059         458 AKET  461 (1036)
Q Consensus       458 a~~v  461 (1036)
                      ..+.
T Consensus       142 l~~~  145 (158)
T PRK15467        142 LASL  145 (158)
T ss_pred             HHHh
Confidence            7655


No 73 
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=98.57  E-value=3.6e-07  Score=87.82  Aligned_cols=23  Identities=35%  Similarity=0.757  Sum_probs=21.3

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +|+|+|..++|||||+++|+|..
T Consensus         1 ~V~iiG~~~~GKSTlin~l~~~~   23 (116)
T PF01926_consen    1 RVAIIGRPNVGKSTLINALTGKK   23 (116)
T ss_dssp             EEEEEESTTSSHHHHHHHHHTST
T ss_pred             CEEEECCCCCCHHHHHHHHhccc
Confidence            58999999999999999999865


No 74 
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=98.57  E-value=5e-07  Score=91.65  Aligned_cols=58  Identities=21%  Similarity=0.237  Sum_probs=37.4

Q ss_pred             ccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhcc--CCCcceeeeecccchhhhHHH
Q psy5059         377 VDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYIS--NPNSIILAVVTANTDMATSES  454 (1036)
Q Consensus       377 ~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~--~~~~ipla~ISA~td~~~qei  454 (1036)
                      ..+.++|.|+||.|+.+.-+.                        +.....+..+..  .....+..-+||+++.++.++
T Consensus       105 ~~~~p~ilv~NK~D~~~~~~~------------------------~~~~~~~~~~~~~~~~~~~~~~~~Sa~~g~gv~e~  160 (167)
T cd04160         105 LEGVPLLILANKQDLPDALSV------------------------EEIKEVFQDKAEEIGRRDCLVLPVSALEGTGVREG  160 (167)
T ss_pred             hcCCCEEEEEEccccccCCCH------------------------HHHHHHhccccccccCCceEEEEeeCCCCcCHHHH
Confidence            457899999999998654221                        122222222221  123457888999999999999


Q ss_pred             HHHh
Q psy5059         455 LKLA  458 (1036)
Q Consensus       455 l~la  458 (1036)
                      +...
T Consensus       161 ~~~l  164 (167)
T cd04160         161 IEWL  164 (167)
T ss_pred             HHHH
Confidence            8764


No 75 
>cd01889 SelB_euk SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner.  This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and euk
Probab=98.57  E-value=4.6e-07  Score=95.08  Aligned_cols=62  Identities=16%  Similarity=0.140  Sum_probs=40.7

Q ss_pred             CCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhcc--CCCcceeeeecccchhhhHHHHH
Q psy5059         379 GRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYIS--NPNSIILAVVTANTDMATSESLK  456 (1036)
Q Consensus       379 g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~--~~~~ipla~ISA~td~~~qeil~  456 (1036)
                      |.+.++|+||+|+++......                    ..+.+.+.+..++.  .....++..+||+++.+..+++.
T Consensus       120 ~~~~iiv~NK~Dl~~~~~~~~--------------------~~~~~~~~l~~~~~~~~~~~~~vi~iSa~~g~gi~~L~~  179 (192)
T cd01889         120 CKKLIVVLNKIDLIPEEERER--------------------KIEKMKKKLQKTLEKTRFKNSPIIPVSAKPGGGEAELGK  179 (192)
T ss_pred             CCCEEEEEECcccCCHHHHHH--------------------HHHHHHHHHHHHHHhcCcCCCCEEEEeccCCCCHHHHHH
Confidence            678999999999985432110                    11233333333332  12457889999999999999988


Q ss_pred             Hhhh
Q psy5059         457 LAKE  460 (1036)
Q Consensus       457 la~~  460 (1036)
                      ....
T Consensus       180 ~l~~  183 (192)
T cd01889         180 DLNN  183 (192)
T ss_pred             HHHh
Confidence            7643


No 76 
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=98.57  E-value=1.2e-06  Score=88.25  Aligned_cols=23  Identities=39%  Similarity=0.673  Sum_probs=21.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +|+++|++++||||++.++++..
T Consensus         1 ~i~~vG~~~~GKTsl~~~l~~~~   23 (162)
T cd04157           1 NILVVGLDNSGKTTIINQLKPEN   23 (162)
T ss_pred             CEEEECCCCCCHHHHHHHHcccC
Confidence            68999999999999999998865


No 77 
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=98.56  E-value=1.1e-06  Score=87.39  Aligned_cols=24  Identities=38%  Similarity=0.728  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++++|.|..+
T Consensus         3 ~i~l~G~~~~GKstli~~l~~~~~   26 (157)
T cd04164           3 KVVIVGKPNVGKSSLLNALAGRDR   26 (157)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCce
Confidence            689999999999999999998763


No 78 
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=98.55  E-value=9.8e-07  Score=88.83  Aligned_cols=24  Identities=38%  Similarity=0.681  Sum_probs=22.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+++|||||+++++.|..|
T Consensus         2 ki~liG~~~~GKSsli~~l~~~~~   25 (161)
T cd01861           2 KLVFLGDQSVGKTSIITRFMYDTF   25 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCC
Confidence            589999999999999999998875


No 79 
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE, also called MnmE and previously designated ThdF (thiophene and furan oxidation protein), is a GTPase involved in tRNA modification to create 5-methylaminomethyl-2-thiouridine in the wobble position of some tRNAs. This protein and GidA form an alpha2/beta2 heterotetramer.
Probab=98.54  E-value=5.5e-07  Score=106.63  Aligned_cols=26  Identities=27%  Similarity=0.500  Sum_probs=23.7

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +-++|+++|.+++|||||+++|+|.+
T Consensus       202 ~g~kVvIvG~~nvGKSSLiN~L~~~~  227 (442)
T TIGR00450       202 DGFKLAIVGSPNVGKSSLLNALLKQD  227 (442)
T ss_pred             cCCEEEEECCCCCcHHHHHHHHhCCC
Confidence            45799999999999999999999875


No 80 
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=98.54  E-value=1.3e-06  Score=88.22  Aligned_cols=23  Identities=22%  Similarity=0.485  Sum_probs=20.4

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +|+++|++++||||+++++.+..
T Consensus         1 kv~lvG~~~~GKTsl~~~l~~~~   23 (158)
T cd04151           1 RILILGLDNAGKTTILYRLQLGE   23 (158)
T ss_pred             CEEEECCCCCCHHHHHHHHccCC
Confidence            58999999999999999996554


No 81 
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=98.54  E-value=8.8e-07  Score=89.30  Aligned_cols=24  Identities=25%  Similarity=0.558  Sum_probs=22.5

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|++++||||+++++.+..|
T Consensus         2 ki~~vG~~~vGKTsli~~l~~~~~   25 (168)
T cd04119           2 KVISMGNSGVGKSCIIKRYCEGRF   25 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            689999999999999999998875


No 82 
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=98.54  E-value=3.9e-07  Score=91.90  Aligned_cols=24  Identities=33%  Similarity=0.549  Sum_probs=21.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||+++++.+..|
T Consensus         4 ki~i~G~~~~GKtsl~~~~~~~~~   27 (164)
T cd04145           4 KLVVVGGGGVGKSALTIQFIQSYF   27 (164)
T ss_pred             EEEEECCCCCcHHHHHHHHHhCCC
Confidence            799999999999999999988764


No 83 
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=98.53  E-value=1.6e-06  Score=88.23  Aligned_cols=59  Identities=12%  Similarity=0.152  Sum_probs=39.1

Q ss_pred             cccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHH
Q psy5059         376 DVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESL  455 (1036)
Q Consensus       376 d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil  455 (1036)
                      .+.+.+.+.|+||.|+.++.....                      +.    +...+......++..+||+++.++.+++
T Consensus       106 ~~~~~p~ilv~nK~Dl~~~~~~~~----------------------~~----~~~~~~~~~~~~~~~~Sa~~~~gv~~l~  159 (172)
T cd01862         106 DPENFPFVVLGNKIDLEEKRQVST----------------------KK----AQQWCQSNGNIPYFETSAKEAINVEQAF  159 (172)
T ss_pred             CCCCceEEEEEECcccccccccCH----------------------HH----HHHHHHHcCCceEEEEECCCCCCHHHHH
Confidence            355788999999999985321110                      11    2223333334677889999999999998


Q ss_pred             HHhhh
Q psy5059         456 KLAKE  460 (1036)
Q Consensus       456 ~la~~  460 (1036)
                      ..+.+
T Consensus       160 ~~i~~  164 (172)
T cd01862         160 ETIAR  164 (172)
T ss_pred             HHHHH
Confidence            77543


No 84 
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=98.52  E-value=1.6e-06  Score=88.16  Aligned_cols=26  Identities=27%  Similarity=0.614  Sum_probs=22.6

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ..+|+|+|++++||||+++++.+-.|
T Consensus         3 ~~kv~vvG~~~~GKTsli~~l~~~~~   28 (165)
T cd01864           3 LFKIILIGDSNVGKTCVVQRFKSGTF   28 (165)
T ss_pred             eeEEEEECCCCCCHHHHHHHHhhCCC
Confidence            36899999999999999999976654


No 85 
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=98.52  E-value=1.2e-06  Score=89.52  Aligned_cols=26  Identities=27%  Similarity=0.526  Sum_probs=23.8

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ..+|+++|++++||||+++++++.+|
T Consensus         3 ~~ki~vvG~~~~GKSsl~~~~~~~~f   28 (167)
T cd01867           3 LFKLLLIGDSGVGKSCLLLRFSEDSF   28 (167)
T ss_pred             ceEEEEECCCCCCHHHHHHHHhhCcC
Confidence            46899999999999999999998876


No 86 
>cd04142 RRP22 RRP22 subfamily.  RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death.  Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation.  RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Like most Ras family proteins, RRP22 is farnesylated.
Probab=98.51  E-value=9.6e-07  Score=93.61  Aligned_cols=24  Identities=21%  Similarity=0.674  Sum_probs=22.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|++++||||+++++++..|
T Consensus         2 kI~ivG~~~vGKTsLi~~~~~~~f   25 (198)
T cd04142           2 RVAVLGAPGVGKTAIVRQFLAQEF   25 (198)
T ss_pred             EEEEECCCCCcHHHHHHHHHcCCC
Confidence            589999999999999999998775


No 87 
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=98.51  E-value=7.3e-07  Score=90.65  Aligned_cols=26  Identities=27%  Similarity=0.534  Sum_probs=23.4

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +++|+++|.+++||||+++++++..+
T Consensus         7 ~~~v~v~G~~~~GKSsli~~l~~~~~   32 (169)
T cd04114           7 LFKIVLIGNAGVGKTCLVRRFTQGLF   32 (169)
T ss_pred             eeEEEEECCCCCCHHHHHHHHHhCCC
Confidence            58999999999999999999986654


No 88 
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=98.50  E-value=4e-07  Score=96.29  Aligned_cols=25  Identities=40%  Similarity=0.555  Sum_probs=22.7

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+++|+.++||||++++|.|..+
T Consensus         2 ~kI~i~G~~g~GKSSLin~L~g~~~   26 (197)
T cd04104           2 LNIAVTGESGAGKSSFINALRGVGH   26 (197)
T ss_pred             eEEEEECCCCCCHHHHHHHHhccCC
Confidence            4799999999999999999999763


No 89 
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=98.49  E-value=1e-06  Score=88.35  Aligned_cols=25  Identities=36%  Similarity=0.567  Sum_probs=22.7

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+++|++++||||+++++++..|
T Consensus         2 ~ki~iiG~~~vGKTsl~~~~~~~~~   26 (162)
T cd04138           2 YKLVVVGAGGVGKSALTIQLIQNHF   26 (162)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhCCC
Confidence            4799999999999999999998775


No 90 
>cd01891 TypA_BipA TypA (tyrosine phosphorylated protein A)/BipA subfamily.  BipA is a protein belonging to the ribosome-binding family of GTPases and is widely distributed in bacteria and plants.  BipA was originally described as a protein that is induced in Salmonella typhimurium after exposure to bactericidal/permeability-inducing protein (a cationic antimicrobial protein produced by neutrophils), and has since been identified in E. coli as well.  The properties thus far described for BipA are related to its role in the process of pathogenesis by enteropathogenic E. coli.  It appears to be involved in the regulation of several processes important for infection, including rearrangements of the cytoskeleton of the host, bacterial resistance to host defense peptides, flagellum-mediated cell motility, and expression of K5 capsular genes.  It has been proposed that BipA may utilize a novel mechanism to regulate the expression of target genes.  In addition, BipA from enteropathogenic E. co
Probab=98.49  E-value=9.2e-07  Score=92.97  Aligned_cols=21  Identities=19%  Similarity=0.575  Sum_probs=19.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVG  105 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G  105 (1036)
                      .|+++|+.++|||||++++.+
T Consensus         4 ~i~ivG~~~~GKTsL~~~l~~   24 (194)
T cd01891           4 NIAIIAHVDHGKTTLVDALLK   24 (194)
T ss_pred             EEEEEecCCCCHHHHHHHHHH
Confidence            689999999999999999986


No 91 
>PF10662 PduV-EutP:  Ethanolamine utilisation - propanediol utilisation;  InterPro: IPR012381 Members of this family function in ethanolamine [] and propanediol [] degradation pathways. Both pathways require coenzyme B12 (adenosylcobalamin, AdoCbl). Bacteria that harbour these pathways can use ethanolamine as a source of carbon and nitrogen, or propanediol as a sole carbon and energy source, respectively. The exact roles of the EutP and PduV proteins in these respective pathways are not yet determined. Members of this family contain P-loop consensus motifs in the N-terminal part, and are distantly related to various GTPases and ATPases, including ATPase components of transport systems. Propanediol degradation is thought to be important for the natural Salmonella populations, since propanediol is produced by the fermentation of the common plant sugars rhamnose and fucose [, ]. More than 1% of the Salmonella enterica genome is devoted to the utilisation of propanediol and cobalamin biosynthesis. In vivo expression technology has indicated that propanediol utilisation (pdu) genes may be important for growth in host tissues, and competitive index studies with mice have shown that pdu mutations confer a virulence defect [, ]. The pdu operon is contiguous and co-regulated with the cobalamin (B12) biosynthesis cob operon, indicating that propanediol catabolism may be the primary reason for de novo B12 synthesis in Salmonella [, , ]. Please see IPR003207 from INTERPRO, IPR003208 from INTERPRO, IPR009204 from INTERPRO, IPR009191 from INTERPRO, IPR009192 from INTERPRO for more details on the propanediol utilisation pathway and the pdu operon.; GO: 0005524 ATP binding, 0006576 cellular biogenic amine metabolic process
Probab=98.49  E-value=5.6e-07  Score=90.11  Aligned_cols=54  Identities=20%  Similarity=0.239  Sum_probs=37.7

Q ss_pred             CCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHh
Q psy5059         379 GRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLA  458 (1036)
Q Consensus       379 g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la  458 (1036)
                      .+++||||||+|+.....+.                           +..+++++..-.-.+..||+.++..+.++.++.
T Consensus        89 ~~pvIGVITK~Dl~~~~~~i---------------------------~~a~~~L~~aG~~~if~vS~~~~eGi~eL~~~L  141 (143)
T PF10662_consen   89 NKPVIGVITKIDLPSDDANI---------------------------ERAKKWLKNAGVKEIFEVSAVTGEGIEELKDYL  141 (143)
T ss_pred             CCCEEEEEECccCccchhhH---------------------------HHHHHHHHHcCCCCeEEEECCCCcCHHHHHHHH
Confidence            37899999999999433221                           123344444444456889999999999998875


Q ss_pred             h
Q psy5059         459 K  459 (1036)
Q Consensus       459 ~  459 (1036)
                      +
T Consensus       142 ~  142 (143)
T PF10662_consen  142 E  142 (143)
T ss_pred             h
Confidence            4


No 92 
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=98.49  E-value=1.3e-06  Score=89.15  Aligned_cols=26  Identities=31%  Similarity=0.608  Sum_probs=23.2

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .-+|+|+|++++||||++.++.+..|
T Consensus         5 ~~ki~vvG~~~~GKTsli~~~~~~~~   30 (170)
T cd04116           5 LLKVILLGDGGVGKSSLMNRYVTNKF   30 (170)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHcCCC
Confidence            45899999999999999999987765


No 93 
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=98.48  E-value=1e-06  Score=88.80  Aligned_cols=25  Identities=32%  Similarity=0.503  Sum_probs=22.3

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+++|++++||||+++++++-.|
T Consensus         2 ~ki~i~G~~~vGKTsl~~~~~~~~~   26 (163)
T cd04136           2 YKVVVLGSGGVGKSALTVQFVQGIF   26 (163)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhCCC
Confidence            4799999999999999999987664


No 94 
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.47  E-value=6.8e-07  Score=93.73  Aligned_cols=24  Identities=17%  Similarity=0.519  Sum_probs=21.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+++|||||++..+.+..|
T Consensus         2 Ki~vvG~~~vGKTSli~~~~~~~~   25 (191)
T cd04112           2 KVMLLGDSGVGKTCLLVRFKDGAF   25 (191)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCC
Confidence            589999999999999999987765


No 95 
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=98.47  E-value=7.3e-07  Score=97.90  Aligned_cols=42  Identities=29%  Similarity=0.313  Sum_probs=31.4

Q ss_pred             hhhHHHHHHHHHhhhhcCCCCCCCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          60 RTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        60 ~~~~~l~~kL~~~~~~~g~~~i~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ..+.++..++++       ....-..|+|+|..++||||++|+|.|...
T Consensus        15 ~~~~~~~~~~~~-------~~~~~~~IllvG~tGvGKSSliNaLlg~~~   56 (249)
T cd01853          15 TKALELEAKGKE-------ELDFSLTILVLGKTGVGKSSTINSIFGERK   56 (249)
T ss_pred             HHHHHHHHHhhh-------hccCCeEEEEECCCCCcHHHHHHHHhCCCC
Confidence            344455555544       233567999999999999999999999873


No 96 
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=98.46  E-value=7.8e-07  Score=90.40  Aligned_cols=25  Identities=16%  Similarity=0.486  Sum_probs=22.7

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+++|++++||||+++++++..|
T Consensus         3 ~ki~i~G~~~vGKSsli~~~~~~~~   27 (166)
T cd01869           3 FKLLLIGDSGVGKSCLLLRFADDTY   27 (166)
T ss_pred             EEEEEECCCCCCHHHHHHHHhcCCC
Confidence            5799999999999999999988765


No 97 
>CHL00071 tufA elongation factor Tu
Probab=98.45  E-value=6.4e-07  Score=105.35  Aligned_cols=59  Identities=14%  Similarity=0.046  Sum_probs=39.3

Q ss_pred             HHHhhhccccCCc-eEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCC----cceeeee
Q psy5059         369 LKLAKETDVDGRR-TLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPN----SIILAVV  443 (1036)
Q Consensus       369 ~~la~~~d~~g~r-ti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~----~ipla~I  443 (1036)
                      ..++..++..|.+ .|+|+||||+.+... .                      .+.+...+..+++...    .+|++.+
T Consensus       117 ~~~~~~~~~~g~~~iIvvvNK~D~~~~~~-~----------------------~~~~~~~l~~~l~~~~~~~~~~~ii~~  173 (409)
T CHL00071        117 KEHILLAKQVGVPNIVVFLNKEDQVDDEE-L----------------------LELVELEVRELLSKYDFPGDDIPIVSG  173 (409)
T ss_pred             HHHHHHHHHcCCCEEEEEEEccCCCCHHH-H----------------------HHHHHHHHHHHHHHhCCCCCcceEEEc
Confidence            4456666677887 668999999986421 1                      1334455556665544    3899999


Q ss_pred             cccchhh
Q psy5059         444 TANTDMA  450 (1036)
Q Consensus       444 SA~td~~  450 (1036)
                      ||+++.+
T Consensus       174 Sa~~g~n  180 (409)
T CHL00071        174 SALLALE  180 (409)
T ss_pred             chhhccc
Confidence            9988863


No 98 
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=98.45  E-value=1.4e-06  Score=93.34  Aligned_cols=24  Identities=33%  Similarity=0.609  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||+++++++..|
T Consensus         2 Ki~ivG~~~vGKSsLi~~l~~~~~   25 (215)
T cd04109           2 KIVVLGDGAVGKTSLCRRFAKEGF   25 (215)
T ss_pred             EEEEECcCCCCHHHHHHHHhcCCC
Confidence            589999999999999999998765


No 99 
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=98.44  E-value=8.9e-07  Score=90.56  Aligned_cols=26  Identities=27%  Similarity=0.545  Sum_probs=23.4

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .-+|+|+|++++||||+++++.+..|
T Consensus         4 ~~ki~vvG~~~vGKSsLl~~l~~~~~   29 (168)
T cd01866           4 LFKYIIIGDTGVGKSCLLLQFTDKRF   29 (168)
T ss_pred             ceEEEEECCCCCCHHHHHHHHHcCCC
Confidence            35899999999999999999998775


No 100
>cd04168 TetM_like Tet(M)-like subfamily.  Tet(M), Tet(O), Tet(W), and OtrA are tetracycline resistance genes found in Gram-positive and Gram-negative bacteria.  Tetracyclines inhibit protein synthesis by preventing aminoacyl-tRNA from binding to the ribosomal acceptor site.  This subfamily contains tetracycline resistance proteins that function through ribosomal protection and are typically found on mobile genetic elements, such as transposons or plasmids, and are often conjugative.  Ribosomal protection proteins are homologous to the elongation factors EF-Tu and EF-G.  EF-G and Tet(M) compete for binding on the ribosomes.  Tet(M) has a higher affinity than EF-G, suggesting these two proteins may have overlapping binding sites and that Tet(M) must be released before EF-G can bind.  Tet(M) and Tet(O) have been shown to have ribosome-dependent GTPase activity.  These proteins are part of the GTP translation factor family, which includes EF-G, EF-Tu, EF2, LepA, and SelB.
Probab=98.44  E-value=1.6e-06  Score=94.52  Aligned_cols=93  Identities=15%  Similarity=0.052  Sum_probs=64.9

Q ss_pred             HhhhccccCCceEEEEecccccCCCchh-----hhhhcCcccccccccccc-----c---c-------------------
Q psy5059         371 LAKETDVDGRRTLAVVTKIDLMDAGTDA-----IDILCGRVIPVKLDVDGR-----R---T-------------------  418 (1036)
Q Consensus       371 la~~~d~~g~rti~VitK~Dl~~~g~~~-----~~~l~~~~~~~~~~~~~~-----~---~-------------------  418 (1036)
                      +.+.++..|.+.|+|+||+|+.....+.     .+.|..+++|+.+++.+-     .   .                   
T Consensus       108 ~~~~~~~~~~P~iivvNK~D~~~a~~~~~~~~i~~~~~~~~~~~~~p~~~~~~~~~~~~~~~l~e~vae~dd~l~e~yl~  187 (237)
T cd04168         108 LWRLLRKLNIPTIIFVNKIDRAGADLEKVYQEIKEKLSSDIVPMQKVGLAPNICETNEIDDEFWETLAEGDDELLEKYLE  187 (237)
T ss_pred             HHHHHHHcCCCEEEEEECccccCCCHHHHHHHHHHHHCCCeEEEECCcEeeeeeeeeeccHHHHHHHhcCCHHHHHHHhC
Confidence            4445555688999999999998654332     256677888988764321     0   0                   


Q ss_pred             ---hHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhhcCc
Q psy5059         419 ---YIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDV  463 (1036)
Q Consensus       419 ---~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd~  463 (1036)
                         ...+++.+-++.-+..-..+|+.+.||.++..++++++.....-|
T Consensus       188 ~~~~~~~el~~~l~~~~~~~~~~Pv~~gsa~~~~Gv~~ll~~~~~~~p  235 (237)
T cd04168         188 GGPIEELELDNELSARIAKRKVFPVYHGSALKGIGIEELLEGITKLFP  235 (237)
T ss_pred             CCCCCHHHHHHHHHHHHHhCCeEEEEEccccCCcCHHHHHHHHHHhcC
Confidence               122344455666666778899999999999999999988766543


No 101
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=98.44  E-value=2.1e-06  Score=86.44  Aligned_cols=24  Identities=29%  Similarity=0.541  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|.+++||||+++++++..|
T Consensus         1 ~i~i~G~~~~GKTsl~~~~~~~~~   24 (160)
T cd04156           1 QVLLLGLDSAGKSTLLYKLKHAEL   24 (160)
T ss_pred             CEEEEcCCCCCHHHHHHHHhcCCc
Confidence            589999999999999999998774


No 102
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=98.44  E-value=1.7e-06  Score=87.50  Aligned_cols=24  Identities=33%  Similarity=0.574  Sum_probs=22.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|+.+|||||+++++.+..|
T Consensus         2 ki~v~G~~~~GKTsli~~~~~~~~   25 (164)
T smart00173        2 KLVVLGSGGVGKSALTIQFVQGHF   25 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCcC
Confidence            689999999999999999998775


No 103
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=98.44  E-value=3e-06  Score=88.28  Aligned_cols=27  Identities=19%  Similarity=0.464  Sum_probs=24.0

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .-++|+++|.++|||||++++++|..+
T Consensus        18 ~~~ki~ilG~~~~GKStLi~~l~~~~~   44 (190)
T cd00879          18 KEAKILFLGLDNAGKTTLLHMLKDDRL   44 (190)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcCCC
Confidence            468999999999999999999987663


No 104
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=98.43  E-value=3e-06  Score=86.34  Aligned_cols=24  Identities=25%  Similarity=0.610  Sum_probs=22.4

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||+++++.+..|
T Consensus         4 ki~iiG~~~vGKTsli~~~~~~~~   27 (166)
T cd04122           4 KYIIIGDMGVGKSCLLHQFTEKKF   27 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCC
Confidence            689999999999999999998776


No 105
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=98.42  E-value=3.3e-06  Score=85.12  Aligned_cols=24  Identities=29%  Similarity=0.630  Sum_probs=22.1

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|++++||||+++++.+..|
T Consensus         2 ki~v~G~~~~GKSsli~~l~~~~~   25 (161)
T cd01863           2 KILLIGDSGVGKSSLLLRFTDDTF   25 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCC
Confidence            589999999999999999998775


No 106
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=98.41  E-value=3.6e-06  Score=86.59  Aligned_cols=26  Identities=19%  Similarity=0.312  Sum_probs=22.6

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ..+|+++|.+++||||++.++++..|
T Consensus         9 ~~kv~i~G~~~~GKTsli~~l~~~~~   34 (168)
T cd04149           9 EMRILMLGLDAAGKTTILYKLKLGQS   34 (168)
T ss_pred             ccEEEEECcCCCCHHHHHHHHccCCC
Confidence            46899999999999999999976553


No 107
>PRK09554 feoB ferrous iron transport protein B; Reviewed
Probab=98.41  E-value=1.4e-06  Score=109.26  Aligned_cols=65  Identities=6%  Similarity=-0.002  Sum_probs=44.0

Q ss_pred             HHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchh
Q psy5059         370 KLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDM  449 (1036)
Q Consensus       370 ~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~  449 (1036)
                      .+..++...|.++|.|+||+|+.++....                       ..+ +.+.+.+    -.|.+.+||.++.
T Consensus       103 ~l~~ql~e~giPvIvVlNK~Dl~~~~~i~-----------------------id~-~~L~~~L----G~pVvpiSA~~g~  154 (772)
T PRK09554        103 YLTLQLLELGIPCIVALNMLDIAEKQNIR-----------------------IDI-DALSARL----GCPVIPLVSTRGR  154 (772)
T ss_pred             HHHHHHHHcCCCEEEEEEchhhhhccCcH-----------------------HHH-HHHHHHh----CCCEEEEEeecCC
Confidence            35556667799999999999987532111                       111 1222222    3578889999999


Q ss_pred             hhHHHHHHhhhcC
Q psy5059         450 ATSESLKLAKETD  462 (1036)
Q Consensus       450 ~~qeil~la~~vd  462 (1036)
                      +..++.+.+.+..
T Consensus       155 GIdeL~~~I~~~~  167 (772)
T PRK09554        155 GIEALKLAIDRHQ  167 (772)
T ss_pred             CHHHHHHHHHHhh
Confidence            9999988877664


No 108
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=98.41  E-value=3.8e-06  Score=84.76  Aligned_cols=24  Identities=25%  Similarity=0.714  Sum_probs=22.1

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|+.++||||+++++.+..|
T Consensus         2 ki~v~G~~~vGKTsli~~l~~~~~   25 (161)
T cd04113           2 KFIIIGSSGTGKSCLLHRFVENKF   25 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            589999999999999999998775


No 109
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=98.41  E-value=1.3e-06  Score=89.14  Aligned_cols=54  Identities=19%  Similarity=0.210  Sum_probs=35.6

Q ss_pred             cCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHH
Q psy5059         378 DGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKL  457 (1036)
Q Consensus       378 ~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~l  457 (1036)
                      .+.+.+.|+||+|+.+......                           .......+....+...+||+++....++++.
T Consensus       119 ~~~p~ivv~NK~Dl~~~~~~~~---------------------------~~~~~~~~~~~~~~~~~Sa~~~~gl~~l~~~  171 (176)
T cd01881         119 TAKPVIYVLNKIDLDDAEELEE---------------------------ELVRELALEEGAEVVPISAKTEEGLDELIRA  171 (176)
T ss_pred             hhCCeEEEEEchhcCchhHHHH---------------------------HHHHHHhcCCCCCEEEEehhhhcCHHHHHHH
Confidence            3689999999999976532211                           0011122223456778899999999998875


Q ss_pred             h
Q psy5059         458 A  458 (1036)
Q Consensus       458 a  458 (1036)
                      .
T Consensus       172 l  172 (176)
T cd01881         172 I  172 (176)
T ss_pred             H
Confidence            4


No 110
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=98.40  E-value=4.3e-06  Score=85.19  Aligned_cols=24  Identities=29%  Similarity=0.598  Sum_probs=22.4

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|++++||||+++++++..|
T Consensus         3 ki~i~G~~~~GKSsli~~l~~~~~   26 (165)
T cd01865           3 KLLIIGNSSVGKTSFLFRYADDSF   26 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCC
Confidence            699999999999999999998775


No 111
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=98.39  E-value=4.3e-06  Score=85.46  Aligned_cols=26  Identities=23%  Similarity=0.673  Sum_probs=23.5

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -.+|+++|.++|||||++++|.|..+
T Consensus        14 ~~~v~i~G~~g~GKStLl~~l~~~~~   39 (173)
T cd04155          14 EPRILILGLDNAGKTTILKQLASEDI   39 (173)
T ss_pred             ccEEEEEccCCCCHHHHHHHHhcCCC
Confidence            57899999999999999999998753


No 112
>PRK12317 elongation factor 1-alpha; Reviewed
Probab=98.39  E-value=2.8e-06  Score=100.49  Aligned_cols=24  Identities=25%  Similarity=0.484  Sum_probs=21.4

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      -.|+++|..++|||||+++|++..
T Consensus         7 ~~v~iiGh~d~GKSTL~~~Ll~~~   30 (425)
T PRK12317          7 LNLAVIGHVDHGKSTLVGRLLYET   30 (425)
T ss_pred             EEEEEECCCCCChHHHHHHHHHHc
Confidence            468999999999999999998654


No 113
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=98.39  E-value=4.4e-06  Score=83.52  Aligned_cols=24  Identities=33%  Similarity=0.606  Sum_probs=21.7

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+++|||||+++++.+..|
T Consensus         1 ki~i~G~~~~GKTsli~~l~~~~~   24 (160)
T cd00876           1 KVVVLGAGGVGKSAITIQFVKGTF   24 (160)
T ss_pred             CEEEECCCCCCHHHHHHHHHhCCC
Confidence            589999999999999999987764


No 114
>cd01893 Miro1 Miro1 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the N-terminal GTPase domain of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=98.38  E-value=3e-06  Score=86.52  Aligned_cols=24  Identities=50%  Similarity=0.804  Sum_probs=21.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||+++++.+-.|
T Consensus         2 kv~ivG~~~vGKTsl~~~l~~~~~   25 (166)
T cd01893           2 RIVLIGDEGVGKSSLIMSLVSEEF   25 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCcC
Confidence            689999999999999999988765


No 115
>cd01899 Ygr210 Ygr210 subfamily.  Ygr210 is a member of Obg-like family and present in archaea and fungi.  They are characterized by a distinct glycine-rich motif immediately following the Walker B motif.  The Ygr210 and YyaF/YchF subfamilies appear to form one major branch of the Obg-like family.  Among eukaryotes, the Ygr210 subfamily is represented only in fungi.  These fungal proteins form a tight cluster with their archaeal orthologs, which suggests the possibility of horizontal transfer from archaea to fungi.
Probab=98.38  E-value=1.2e-05  Score=91.45  Aligned_cols=37  Identities=22%  Similarity=0.238  Sum_probs=28.4

Q ss_pred             eEEeCcCCCChhhHHhhhcCCCcCcccccccccCceE
Q psy5059          86 IVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLI  122 (1036)
Q Consensus        86 IvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~  122 (1036)
                      |++||.+|+||||++++|++..+-+..---||+-|..
T Consensus         1 i~ivG~pnvGKStLfn~lt~~~~~~~~~pftT~~p~~   37 (318)
T cd01899           1 IGLVGKPNAGKSTFFNAATLADVEIANYPFTTIDPNV   37 (318)
T ss_pred             CEEECCCCCCHHHHHHHHhCCCCcccCCCCcccccee
Confidence            5799999999999999999988533232347777764


No 116
>PRK10512 selenocysteinyl-tRNA-specific translation factor; Provisional
Probab=98.36  E-value=2.3e-06  Score=105.25  Aligned_cols=59  Identities=19%  Similarity=0.168  Sum_probs=40.0

Q ss_pred             CCc-eEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCC--CcceeeeecccchhhhHHHH
Q psy5059         379 GRR-TLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNP--NSIILAVVTANTDMATSESL  455 (1036)
Q Consensus       379 g~r-ti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~--~~ipla~ISA~td~~~qeil  455 (1036)
                      |.+ .|.|+||+|+.++..  .                      ..+...+...+...  ...++..+||+++.+...++
T Consensus       103 gi~~iIVVlNKiDlv~~~~--~----------------------~~v~~ei~~~l~~~~~~~~~ii~VSA~tG~gI~~L~  158 (614)
T PRK10512        103 GNPMLTVALTKADRVDEAR--I----------------------AEVRRQVKAVLREYGFAEAKLFVTAATEGRGIDALR  158 (614)
T ss_pred             CCCeEEEEEECCccCCHHH--H----------------------HHHHHHHHHHHHhcCCCCCcEEEEeCCCCCCCHHHH
Confidence            444 579999999975421  1                      22333444444332  34788899999999999999


Q ss_pred             HHhhhc
Q psy5059         456 KLAKET  461 (1036)
Q Consensus       456 ~la~~v  461 (1036)
                      +...+.
T Consensus       159 ~~L~~~  164 (614)
T PRK10512        159 EHLLQL  164 (614)
T ss_pred             HHHHHh
Confidence            887665


No 117
>PRK12736 elongation factor Tu; Reviewed
Probab=98.36  E-value=3e-06  Score=99.30  Aligned_cols=24  Identities=17%  Similarity=0.291  Sum_probs=21.1

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      -.|+++|.-.+|||||+++|+|..
T Consensus        13 ~ni~i~Ghvd~GKSTL~~~L~~~~   36 (394)
T PRK12736         13 VNIGTIGHVDHGKTTLTAAITKVL   36 (394)
T ss_pred             eEEEEEccCCCcHHHHHHHHHhhh
Confidence            358999999999999999998653


No 118
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase).
Probab=98.36  E-value=2.8e-06  Score=95.29  Aligned_cols=42  Identities=26%  Similarity=0.529  Sum_probs=34.3

Q ss_pred             hhhhHHHHHHHHHhhhhcCCCCCCCCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          59 KRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        59 ~~~~~~l~~kL~~~~~~~g~~~i~lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ...+++++.+|.+       .+.+...|+++|..++||||++++|.|..
T Consensus        21 q~~l~~~l~~l~~-------~~~~~~rIllvGktGVGKSSliNsIlG~~   62 (313)
T TIGR00991        21 QTKLLELLGKLKE-------EDVSSLTILVMGKGGVGKSSTVNSIIGER   62 (313)
T ss_pred             HHHHHHHHHhccc-------ccccceEEEEECCCCCCHHHHHHHHhCCC
Confidence            3456666666665       45678899999999999999999999986


No 119
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=98.36  E-value=5e-06  Score=83.58  Aligned_cols=24  Identities=29%  Similarity=0.544  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|..++||||++.++++..|
T Consensus         2 ki~~~G~~~~GKTsl~~~l~~~~~   25 (164)
T cd04139           2 KVIVVGAGGVGKSALTLQFMYDEF   25 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            589999999999999999998775


No 120
>TIGR00475 selB selenocysteine-specific elongation factor SelB. In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor. 3-prime or 5-prime non-coding elements of mRNA have been found as probable structures for directing selenocysteine incorporation. This model describes the elongation factor SelB, a close homolog rf EF-Tu. It may function by replacing EF-Tu. A C-terminal domain not found in EF-Tu is in all SelB sequences in the seed alignment except that from Methanococcus jannaschii. This model does not find an equivalent protein for eukaryotes.
Probab=98.36  E-value=1.8e-06  Score=105.69  Aligned_cols=22  Identities=27%  Similarity=0.585  Sum_probs=20.4

Q ss_pred             eEEeCcCCCChhhHHhhhcCCC
Q psy5059          86 IVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        86 IvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      |+++|..++|||||+++|+|..
T Consensus         3 I~iiG~~d~GKTTLi~aLtg~~   24 (581)
T TIGR00475         3 IATAGHVDHGKTTLLKALTGIA   24 (581)
T ss_pred             EEEECCCCCCHHHHHHHHhCcc
Confidence            7899999999999999999864


No 121
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=98.35  E-value=1.9e-06  Score=87.44  Aligned_cols=24  Identities=29%  Similarity=0.423  Sum_probs=20.9

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .+|+++|++++||||++.++..-.
T Consensus         2 ~ki~~~G~~~~GKTsli~~~~~~~   25 (164)
T cd04175           2 YKLVVLGSGGVGKSALTVQFVQGI   25 (164)
T ss_pred             cEEEEECCCCCCHHHHHHHHHhCC
Confidence            379999999999999999987544


No 122
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G.  On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group
Probab=98.35  E-value=6.9e-06  Score=91.10  Aligned_cols=40  Identities=10%  Similarity=-0.049  Sum_probs=32.1

Q ss_pred             HHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhhcCc
Q psy5059         424 IKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDV  463 (1036)
Q Consensus       424 l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd~  463 (1036)
                      +.+.++..+..-...|+.+.||+++..++.+++.....-|
T Consensus       227 l~~~l~~~~~~~~~~pv~~gSa~~~~G~~~ll~~~~~~~p  266 (268)
T cd04170         227 LHAGLRRALRAGLLVPVLCGSALTNIGVRELLDALVHLLP  266 (268)
T ss_pred             HHHHHHHHHHhCCEEEEEEeeCCCCcCHHHHHHHHHHhCC
Confidence            3334666777888899999999999999999998776544


No 123
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=98.34  E-value=5.1e-06  Score=83.70  Aligned_cols=24  Identities=42%  Similarity=0.697  Sum_probs=22.1

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|++++||||+++++.+..|
T Consensus         2 kv~~vG~~~~GKTsl~~~~~~~~~   25 (162)
T cd04106           2 KVIVVGNGNVGKSSMIQRFVKGIF   25 (162)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCC
Confidence            589999999999999999998765


No 124
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=98.34  E-value=8.2e-06  Score=85.19  Aligned_cols=26  Identities=19%  Similarity=0.478  Sum_probs=23.5

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -++|+++|.+++||||++++++|..|
T Consensus        17 ~~~i~ivG~~~~GKTsli~~l~~~~~   42 (184)
T smart00178       17 HAKILFLGLDNAGKTTLLHMLKNDRL   42 (184)
T ss_pred             cCEEEEECCCCCCHHHHHHHHhcCCC
Confidence            38999999999999999999998764


No 125
>TIGR00487 IF-2 translation initiation factor IF-2. This model discriminates eubacterial (and mitochondrial) translation initiation factor 2 (IF-2), encoded by the infB gene in bacteria, from similar proteins in the Archaea and Eukaryotes. In the bacteria and in organelles, the initiator tRNA is charged with N-formyl-Met instead of Met. This translation factor acts in delivering the initator tRNA to the ribosome. It is one of a number of GTP-binding translation factors recognized by the pfam model GTP_EFTU.
Probab=98.33  E-value=4.5e-06  Score=102.04  Aligned_cols=27  Identities=22%  Similarity=0.509  Sum_probs=24.2

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ..|.|+++|..++|||||+++|.+..|
T Consensus        86 r~p~V~I~Ghvd~GKTSLl~~l~~~~v  112 (587)
T TIGR00487        86 RPPVVTIMGHVDHGKTSLLDSIRKTKV  112 (587)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHhCCc
Confidence            459999999999999999999987664


No 126
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=98.33  E-value=3.5e-06  Score=85.23  Aligned_cols=21  Identities=24%  Similarity=0.479  Sum_probs=19.6

Q ss_pred             ceEEeCcCCCChhhHHhhhcC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVG  105 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G  105 (1036)
                      +|+|+|+.+|||||++.++.+
T Consensus         2 ki~vvG~~~~GKtsl~~~l~~   22 (164)
T cd04101           2 RCAVVGDPAVGKTAFVQMFHS   22 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHhc
Confidence            689999999999999999974


No 127
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=98.33  E-value=8.1e-06  Score=84.22  Aligned_cols=26  Identities=15%  Similarity=0.402  Sum_probs=22.8

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -.+|+++|.+++||||+++++.+-.|
T Consensus        15 ~~kv~~~G~~~~GKTsl~~~l~~~~~   40 (174)
T cd04153          15 EYKVIIVGLDNAGKTTILYQFLLGEV   40 (174)
T ss_pred             ccEEEEECCCCCCHHHHHHHHccCCC
Confidence            35899999999999999999987654


No 128
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=98.33  E-value=1.7e-06  Score=87.88  Aligned_cols=24  Identities=25%  Similarity=0.636  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||+++++.+..|
T Consensus         2 ki~vvG~~~vGKTsli~~~~~~~~   25 (161)
T cd04124           2 KIILLGDSAVGKSKLVERFLMDGY   25 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            689999999999999999987765


No 129
>PLN03118 Rab family protein; Provisional
Probab=98.32  E-value=3.1e-06  Score=90.27  Aligned_cols=25  Identities=32%  Similarity=0.555  Sum_probs=22.7

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+++|+.++||||++.++.+..|
T Consensus        15 ~kv~ivG~~~vGKTsli~~l~~~~~   39 (211)
T PLN03118         15 FKILLIGDSGVGKSSLLVSFISSSV   39 (211)
T ss_pred             eEEEEECcCCCCHHHHHHHHHhCCC
Confidence            5899999999999999999987663


No 130
>KOG1423|consensus
Probab=98.32  E-value=7.1e-06  Score=90.01  Aligned_cols=145  Identities=14%  Similarity=0.162  Sum_probs=84.2

Q ss_pred             EeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCCCCCcccce
Q psy5059         235 IYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDL  314 (1036)
Q Consensus       235 I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp~g~RTigv  314 (1036)
                      |...+-..|.|+|+||++.....-+...+.+. ..=....+.+.+|++++++.+++.-.-+                   
T Consensus       114 i~ts~eTQlvf~DTPGlvs~~~~r~~~l~~s~-lq~~~~a~q~AD~vvVv~Das~tr~~l~-------------------  173 (379)
T KOG1423|consen  114 IITSGETQLVFYDTPGLVSKKMHRRHHLMMSV-LQNPRDAAQNADCVVVVVDASATRTPLH-------------------  173 (379)
T ss_pred             EEecCceEEEEecCCcccccchhhhHHHHHHh-hhCHHHHHhhCCEEEEEEeccCCcCccC-------------------
Confidence            44446678999999999764443333233222 2234567888898888877665322221                   


Q ss_pred             eccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCceEEEEecccccCC
Q psy5059         315 LDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDA  394 (1036)
Q Consensus       315 l~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~Dl~~~  394 (1036)
                                           -++=.+.++|-+-                                +.|.|.||+|....
T Consensus       174 ---------------------p~vl~~l~~ys~i--------------------------------ps~lvmnkid~~k~  200 (379)
T KOG1423|consen  174 ---------------------PRVLHMLEEYSKI--------------------------------PSILVMNKIDKLKQ  200 (379)
T ss_pred             ---------------------hHHHHHHHHHhcC--------------------------------Cceeeccchhcchh
Confidence                                 1233344455333                                34778899987765


Q ss_pred             Cchhh---hhhcCcccccccccccccchHHHHHHHHHHhhccCCC-------------cceeeeecccchhhhHHHHHHh
Q psy5059         395 GTDAI---DILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPN-------------SIILAVVTANTDMATSESLKLA  458 (1036)
Q Consensus       395 g~~~~---~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~-------------~ipla~ISA~td~~~qeil~la  458 (1036)
                      ...-+   +.|.+..+-              ....++.+.+.+..             +--+..|||++|-.++++-++.
T Consensus       201 k~~Ll~l~~~Lt~g~l~--------------~~kl~v~~~f~~~p~~~~~~~~~gwshfe~vF~vSaL~G~GikdlkqyL  266 (379)
T KOG1423|consen  201 KRLLLNLKDLLTNGELA--------------KLKLEVQEKFTDVPSDEKWRTICGWSHFERVFMVSALYGEGIKDLKQYL  266 (379)
T ss_pred             hhHHhhhHHhccccccc--------------hhhhhHHHHhccCCcccccccccCcccceeEEEEecccccCHHHHHHHH
Confidence            44322   333322222              12334455555544             3446679999999999998887


Q ss_pred             hhcCcCCC
Q psy5059         459 KETDVDGR  466 (1036)
Q Consensus       459 ~~vd~~g~  466 (1036)
                      ..-.+.|.
T Consensus       267 msqa~~gp  274 (379)
T KOG1423|consen  267 MSQAPPGP  274 (379)
T ss_pred             HhcCCCCC
Confidence            66555444


No 131
>cd01886 EF-G Elongation factor G (EF-G) subfamily.  Translocation is mediated by EF-G (also called translocase).  The structure of EF-G closely resembles that of the complex between EF-Tu and tRNA.  This is an example of molecular mimicry; a protein domain evolved so that it mimics the shape of a tRNA molecule.  EF-G in the GTP form binds to the ribosome, primarily through the interaction of its EF-Tu-like domain with the 50S subunit.  The binding of EF-G to the ribosome in this manner stimulates the GTPase activity of EF-G. On GTP hydrolysis, EF-G undergoes a conformational change that forces its arm deeper into the A site on the 30S subunit.  To accommodate this domain, the peptidyl-tRNA in the A site moves to the P site, carrying the mRNA and the deacylated tRNA with it.  The ribosome may be prepared for these rearrangements by the initial binding of EF-G as well.  The dissociation of EF-G leaves the ribosome ready to accept the next aminoacyl-tRNA into the A site.  This group conta
Probab=98.32  E-value=6.8e-06  Score=91.41  Aligned_cols=40  Identities=10%  Similarity=-0.056  Sum_probs=31.8

Q ss_pred             HHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhhcCc
Q psy5059         424 IKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDV  463 (1036)
Q Consensus       424 l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd~  463 (1036)
                      +.+-++..+..-..+|+.+.||.++..+.++++.....-|
T Consensus       229 l~~~l~~~~~~~~~~PV~~gSa~~~~Gi~~lld~i~~~~p  268 (270)
T cd01886         229 IKAAIRKGTIANKIVPVLCGSAFKNKGVQPLLDAVVDYLP  268 (270)
T ss_pred             HHHHHHHHHHcCcEEEEEeCcCCCCcCHHHHHHHHHHhcC
Confidence            3344666667788999999999999999999988766543


No 132
>cd01888 eIF2_gamma eIF2-gamma (gamma subunit of initiation factor 2).  eIF2 is a heterotrimeric translation initiation factor that consists of alpha, beta, and gamma subunits.  The GTP-bound gamma subunit also binds initiator methionyl-tRNA and delivers it to the 40S ribosomal subunit.  Following hydrolysis of GTP to GDP, eIF2:GDP is released from the ribosome.  The gamma subunit has no intrinsic GTPase activity, but is stimulated by the GTPase activating protein (GAP) eIF5, and GDP/GTP exchange is stimulated by the guanine nucleotide exchange factor (GEF) eIF2B.  eIF2B is a heteropentamer, and the epsilon chain binds eIF2.  Both eIF5 and eIF2B-epsilon are known to bind strongly to eIF2-beta, but have also been shown to bind directly to eIF2-gamma.  It is possible that eIF2-beta serves simply as a high-affinity docking site for eIF5 and eIF2B-epsilon, or that eIF2-beta serves a regulatory role.  eIF2-gamma is found only in eukaryotes and archaea.  It is closely related to SelB, the sel
Probab=98.32  E-value=3.2e-06  Score=89.90  Aligned_cols=60  Identities=12%  Similarity=0.166  Sum_probs=39.3

Q ss_pred             CceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccC--CCcceeeeecccchhhhHHHHHH
Q psy5059         380 RRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISN--PNSIILAVVTANTDMATSESLKL  457 (1036)
Q Consensus       380 ~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~--~~~ipla~ISA~td~~~qeil~l  457 (1036)
                      .+.|+|+||+|+.++...                        ....+.+...+..  ....++..+||+++.++.++++.
T Consensus       138 ~~iiivvNK~Dl~~~~~~------------------------~~~~~~i~~~~~~~~~~~~~i~~vSA~~g~gi~~L~~~  193 (203)
T cd01888         138 KHIIIVQNKIDLVKEEQA------------------------LENYEQIKKFVKGTIAENAPIIPISAQLKYNIDVLLEY  193 (203)
T ss_pred             CcEEEEEEchhccCHHHH------------------------HHHHHHHHHHHhccccCCCcEEEEeCCCCCCHHHHHHH
Confidence            468899999999753211                        1112233333332  23567888999999999999988


Q ss_pred             hhhcCc
Q psy5059         458 AKETDV  463 (1036)
Q Consensus       458 a~~vd~  463 (1036)
                      ..+.-+
T Consensus       194 l~~~l~  199 (203)
T cd01888         194 IVKKIP  199 (203)
T ss_pred             HHHhCC
Confidence            765443


No 133
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=98.32  E-value=1.4e-06  Score=91.06  Aligned_cols=24  Identities=38%  Similarity=0.725  Sum_probs=22.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|+.++|||||++++++..|
T Consensus         2 ki~vvG~~~vGKSsLi~~~~~~~~   25 (193)
T cd04118           2 KVVMLGKESVGKTSLVERYVHHRF   25 (193)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCc
Confidence            699999999999999999998775


No 134
>CHL00189 infB translation initiation factor 2; Provisional
Probab=98.32  E-value=4.3e-06  Score=103.87  Aligned_cols=27  Identities=15%  Similarity=0.485  Sum_probs=24.1

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ..|.|+++|..++|||||+++|.+..|
T Consensus       243 r~p~V~IvGhvdvGKTSLld~L~~~~~  269 (742)
T CHL00189        243 RPPIVTILGHVDHGKTTLLDKIRKTQI  269 (742)
T ss_pred             cCCEEEEECCCCCCHHHHHHHHHhccC
Confidence            458999999999999999999987664


No 135
>cd04143 Rhes_like Rhes_like subfamily.  This subfamily includes Rhes (Ras homolog enriched in striatum) and Dexras1/AGS1 (activator of G-protein signaling 1).  These proteins are homologous, but exhibit significant differences in tissue distribution and subcellular localization.  Rhes is found primarily in the striatum of the brain, but is also expressed in other areas of the brain, such as the cerebral cortex, hippocampus, inferior colliculus, and cerebellum.  Rhes expression is controlled by thyroid hormones.  In rat PC12 cells, Rhes is farnesylated and localizes to the plasma membrane.  Rhes binds and activates PI3K, and plays a role in coupling serpentine membrane receptors with heterotrimeric G-protein signaling.  Rhes has recently been shown to be reduced under conditions of dopamine supersensitivity and may play a role in determining dopamine receptor sensitivity.  Dexras1/AGS1 is a dexamethasone-induced Ras protein that is expressed primarily in the brain, with low expression l
Probab=98.32  E-value=5.3e-06  Score=91.12  Aligned_cols=24  Identities=29%  Similarity=0.747  Sum_probs=21.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++.++++-.|
T Consensus         2 KVvvlG~~gvGKTSLi~r~~~~~f   25 (247)
T cd04143           2 RMVVLGASKVGKTAIVSRFLGGRF   25 (247)
T ss_pred             EEEEECcCCCCHHHHHHHHHcCCC
Confidence            589999999999999999987765


No 136
>PF00350 Dynamin_N:  Dynamin family;  InterPro: IPR001401 Membrane transport between compartments in eukaryotic cells requires proteins that allow the budding and scission of nascent cargo vesicles from one compartment and their targeting and fusion with another. Dynamins are large GTPases that belong to a protein superfamily [] that, in eukaryotic cells, includes classical dynamins, dynamin-like proteins, OPA1, Mx proteins, mitofusins and guanylate-binding proteins/atlastins [, , , ], and are involved in the scission of a wide range of vesicles and organelles. They play a role in many processes including budding of transport vesicles, division of organelles, cytokinesis and pathogen resistance.   The minimal distinguishing architectural features that are common to all dynamins and are distinct from other GTPases are the structure of the large GTPase domain (300 amino acids) and the presence of two additional domains; the middle domain and the GTPase effector domain (GED), which are involved in oligomerization and regulation of the GTPase activity. This entry represents the GTPase domain, containing the GTP-binding motifs that are needed for guanine-nucleotide binding and hydrolysis. The conservation of these motifs is absolute except for the the final motif in guanylate-binding proteins. The GTPase catalytic activity can be stimulated by oligomerisation of the protein, which is mediated by interactions between the GTPase domain, the middle domain and the GED.; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 1JWY_B 1JX2_B 3ZVR_A 2AKA_B 3L43_B 2X2F_D 2X2E_D 3SNH_A 3ZYS_D 3ZYC_D ....
Probab=98.32  E-value=5.7e-07  Score=91.79  Aligned_cols=45  Identities=40%  Similarity=0.643  Sum_probs=40.9

Q ss_pred             EEEeccCCCchHHHHHhhhcCCcccccCCccccccEEEeeccCCC
Q psy5059          10 IVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPK   54 (1036)
Q Consensus        10 i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~l~l~~~~~   54 (1036)
                      |+|+|.+|||||||+|+|+|.+.+|.+.+.||++|+.+...+.+.
T Consensus         1 V~v~G~~ssGKSTliNaLlG~~ilp~~~~~~T~~~~~i~~~~~~~   45 (168)
T PF00350_consen    1 VAVVGQFSSGKSTLINALLGRPILPSGVGPCTAVPTEISYGDEPE   45 (168)
T ss_dssp             EEEEEBTTSSHHHHHHHHHTSS-SSSSSSSTTSSEEEEEEEESSS
T ss_pred             CEEEcCCCCCHHHHHHHHHhcccCcccccccccceeEEEecccCc
Confidence            799999999999999999999999999999999999999876543


No 137
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=98.31  E-value=8e-06  Score=83.78  Aligned_cols=22  Identities=27%  Similarity=0.690  Sum_probs=20.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      .|+++|..+|||||++++++|.
T Consensus         1 ~i~~~G~~~~GKTsl~~~l~~~   22 (167)
T cd04161           1 TLLTVGLDNAGKTTLVSALQGE   22 (167)
T ss_pred             CEEEECCCCCCHHHHHHHHhCC
Confidence            3899999999999999999876


No 138
>smart00177 ARF ARF-like small GTPases; ARF, ADP-ribosylation factor. Ras homologues involved in vesicular transport. Activator of phospholipase D isoforms. Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated. ARFs are N-terminally myristoylated. Contains ATP/GTP-binding motif (P-loop).
Probab=98.31  E-value=9e-06  Score=84.09  Aligned_cols=22  Identities=27%  Similarity=0.514  Sum_probs=20.3

Q ss_pred             CCceEEeCcCCCChhhHHhhhc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLV  104 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~  104 (1036)
                      ..+|+++|.+++||||++..+.
T Consensus        13 ~~ki~l~G~~~~GKTsL~~~~~   34 (175)
T smart00177       13 EMRILMVGLDAAGKTTILYKLK   34 (175)
T ss_pred             ccEEEEEcCCCCCHHHHHHHHh
Confidence            4789999999999999999985


No 139
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2. This model describes archaeal and eukaryotic orthologs of bacterial IF-2. Like IF-2, it helps convey the initiator tRNA to the ribosome, although the initiator is N-formyl-Met in bacteria and Met here. This protein is not closely related to the subunits of eIF-2 of eukaryotes, which is also involved in the initiation of translation. The aIF-2 of Methanococcus jannaschii contains a large intein interrupting a region of very strongly conserved sequence very near the amino end; this model does not correctly align the sequences from Methanococcus jannaschii and Pyrococcus horikoshii in this region.
Probab=98.31  E-value=2.7e-06  Score=103.78  Aligned_cols=36  Identities=25%  Similarity=0.514  Sum_probs=28.5

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCCcCcccccccc
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVT  117 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cT  117 (1036)
                      ..|-|+++|..++||||||++|.|..|.....|..|
T Consensus         3 r~piV~IiG~~d~GKTSLln~l~~~~v~~~e~ggiT   38 (590)
T TIGR00491         3 RSPIVSVLGHVDHGKTTLLDKIRGSAVAKREAGGIT   38 (590)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhccccccccCCcee
Confidence            468999999999999999999999886443333333


No 140
>PLN03127 Elongation factor Tu; Provisional
Probab=98.31  E-value=3.8e-06  Score=99.74  Aligned_cols=25  Identities=12%  Similarity=0.267  Sum_probs=21.7

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCC
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      +-..|+++|...+|||||+++|.|.
T Consensus        60 ~~~ni~iiGhvd~GKSTL~~~L~~~   84 (447)
T PLN03127         60 PHVNVGTIGHVDHGKTTLTAAITKV   84 (447)
T ss_pred             ceEEEEEECcCCCCHHHHHHHHHhH
Confidence            3456999999999999999999764


No 141
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.31  E-value=8.8e-06  Score=86.04  Aligned_cols=24  Identities=33%  Similarity=0.625  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++.++.+..|
T Consensus         2 KivivG~~~vGKTsli~~l~~~~~   25 (201)
T cd04107           2 KVLVIGDLGVGKTSIIKRYVHGIF   25 (201)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCC
Confidence            689999999999999999998765


No 142
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=98.30  E-value=1.1e-06  Score=88.84  Aligned_cols=24  Identities=33%  Similarity=0.632  Sum_probs=21.7

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|++++||||++..+.+-.|
T Consensus         3 ki~i~G~~~vGKTsl~~~~~~~~~   26 (163)
T cd04176           3 KVVVLGSGGVGKSALTVQFVSGTF   26 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCC
Confidence            699999999999999999987665


No 143
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=98.30  E-value=9.1e-06  Score=81.95  Aligned_cols=24  Identities=38%  Similarity=0.663  Sum_probs=22.6

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|+++|||||+++++.+..|
T Consensus         3 ki~v~G~~~~GKSsli~~l~~~~~   26 (163)
T cd01860           3 KLVLLGDSSVGKSSLVLRFVKNEF   26 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCC
Confidence            689999999999999999998886


No 144
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=98.30  E-value=1.2e-05  Score=79.03  Aligned_cols=53  Identities=25%  Similarity=0.273  Sum_probs=38.9

Q ss_pred             CCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHh
Q psy5059         379 GRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLA  458 (1036)
Q Consensus       379 g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la  458 (1036)
                      +.+.+.|+||+|+.+..                            +.......+......+...+||..+.++.+++...
T Consensus       108 ~~p~ivv~nK~D~~~~~----------------------------~~~~~~~~~~~~~~~~~~~~sa~~~~gv~~~~~~l  159 (161)
T TIGR00231       108 NVPIILVGNKIDLRDAK----------------------------LKTHVAFLFAKLNGEPIIPLSAETGKNIDSAFKIV  159 (161)
T ss_pred             CCcEEEEEEcccCCcch----------------------------hhHHHHHHHhhccCCceEEeecCCCCCHHHHHHHh
Confidence            77899999999997542                            12233444555556678899999999999988765


Q ss_pred             h
Q psy5059         459 K  459 (1036)
Q Consensus       459 ~  459 (1036)
                      +
T Consensus       160 ~  160 (161)
T TIGR00231       160 E  160 (161)
T ss_pred             h
Confidence            3


No 145
>PRK05124 cysN sulfate adenylyltransferase subunit 1; Provisional
Probab=98.29  E-value=5.7e-06  Score=99.02  Aligned_cols=27  Identities=26%  Similarity=0.450  Sum_probs=23.7

Q ss_pred             CCCCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          81 IQLPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        81 i~lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      -+...||++|..++|||||+++|....
T Consensus        25 ~~~~~i~iiGhvdaGKSTL~~~LL~~~   51 (474)
T PRK05124         25 KSLLRFLTCGSVDDGKSTLIGRLLHDT   51 (474)
T ss_pred             cCceEEEEECCCCCChHHHHHHHHHhc
Confidence            456899999999999999999998654


No 146
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=98.28  E-value=2.8e-06  Score=88.99  Aligned_cols=24  Identities=29%  Similarity=0.504  Sum_probs=21.3

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|+.++||||++.++.+-.|
T Consensus         1 ki~ivG~~~vGKTsli~~l~~~~f   24 (190)
T cd04144           1 KLVVLGDGGVGKTALTIQLCLNHF   24 (190)
T ss_pred             CEEEECCCCCCHHHHHHHHHhCCC
Confidence            489999999999999999986654


No 147
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=98.28  E-value=1.1e-05  Score=82.69  Aligned_cols=24  Identities=25%  Similarity=0.576  Sum_probs=21.5

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|..+|||||++.++++..|
T Consensus         1 ~vvlvG~~~~GKTsl~~~l~~~~~   24 (169)
T cd04158           1 RVVTLGLDGAGKTTILFKLKQDEF   24 (169)
T ss_pred             CEEEECCCCCCHHHHHHHHhcCCC
Confidence            589999999999999999987654


No 148
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=98.28  E-value=6.8e-06  Score=82.33  Aligned_cols=24  Identities=29%  Similarity=0.581  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|.+++||||+++++.+..|
T Consensus         2 ki~i~G~~~~GKStli~~l~~~~~   25 (162)
T cd04123           2 KVVLLGEGRVGKTSLVLRYVENKF   25 (162)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            589999999999999999998775


No 149
>cd01883 EF1_alpha Eukaryotic elongation factor 1 (EF1) alpha subfamily.  EF1 is responsible for the GTP-dependent binding of aminoacyl-tRNAs to the ribosomes.  EF1 is composed of four subunits: the alpha chain which binds GTP and aminoacyl-tRNAs, the gamma chain that probably plays a role in anchoring the complex to other cellular components and the beta and delta (or beta') chains.  This subfamily is the alpha subunit, and represents the counterpart of bacterial EF-Tu for the archaea (aEF1-alpha) and eukaryotes (eEF1-alpha).  eEF1-alpha interacts with the actin of the eukaryotic cytoskeleton and may thereby play a role in cellular transformation and apoptosis.  EF-Tu can have no such role in bacteria.  In humans, the isoform eEF1A2 is overexpressed in 2/3 of breast cancers and has been identified as a putative oncogene.  This subfamily also includes Hbs1, a G protein known to be important for efficient growth and protein synthesis under conditions of limiting translation initiation in
Probab=98.28  E-value=7.6e-06  Score=88.10  Aligned_cols=21  Identities=33%  Similarity=0.488  Sum_probs=18.9

Q ss_pred             eEEeCcCCCChhhHHhhhcCC
Q psy5059          86 IVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        86 IvVvG~QSsGKSSlLEal~G~  106 (1036)
                      |+++|...+|||||+++|...
T Consensus         2 v~i~Gh~~~GKttL~~~ll~~   22 (219)
T cd01883           2 LVVIGHVDAGKSTTTGHLLYL   22 (219)
T ss_pred             EEEecCCCCChHHHHHHHHHH
Confidence            789999999999999999643


No 150
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=98.28  E-value=6.3e-06  Score=84.20  Aligned_cols=24  Identities=38%  Similarity=0.605  Sum_probs=21.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|.++|||||+++++++..|
T Consensus         3 ki~liG~~~~GKTsli~~~~~~~~   26 (168)
T cd04177           3 KIVVLGAGGVGKSALTVQFVQNVF   26 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            689999999999999999987765


No 151
>COG1163 DRG Predicted GTPase [General function prediction only]
Probab=98.27  E-value=9.4e-06  Score=89.96  Aligned_cols=166  Identities=20%  Similarity=0.231  Sum_probs=87.1

Q ss_pred             cccceeecCCCccccCCCCCc--hhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCCCCCc---ccce
Q psy5059         240 VLNLTLVDLPGITKVPVGDQP--DDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRR---TLDL  314 (1036)
Q Consensus       240 ~~~LtlVDLPGi~~~~~~~q~--~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp~g~R---Tigv  314 (1036)
                      .....++|+|||+..+..+-.  ..+        .+-+++.+ .|++|.++..|...-+  .+.+|+--.|=|   +=.-
T Consensus       109 ga~IQild~Pgii~gas~g~grG~~v--------lsv~R~AD-lIiiVld~~~~~~~~~--~i~~ELe~~GIrlnk~~p~  177 (365)
T COG1163         109 GAQIQLLDLPGIIEGASSGRGRGRQV--------LSVARNAD-LIIIVLDVFEDPHHRD--IIERELEDVGIRLNKRPPD  177 (365)
T ss_pred             CceEEEEcCcccccCcccCCCCccee--------eeeeccCC-EEEEEEecCCChhHHH--HHHHHHHhcCeEecCCCCc
Confidence            366789999999987665543  222        24556667 4555555665544211  233443222211   0000


Q ss_pred             ecc---CCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhcc--ccCCceEEEEecc
Q psy5059         315 LDI---DLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETD--VDGRRTLAVVTKI  389 (1036)
Q Consensus       315 l~~---~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d--~~g~rti~VitK~  389 (1036)
                      ..|   +.-||--.....-++--+..++.++++|==+ ||.++.--+.+.    ++   ++..++  -...++|.|+||.
T Consensus       178 V~I~kk~~gGI~i~~t~~l~~~d~~~ir~iL~Ey~I~-nA~V~Ir~dvTl----Dd---~id~l~~nrvY~p~l~v~NKi  249 (365)
T COG1163         178 VTIKKKESGGIRINGTGPLTHLDEDTVRAILREYRIH-NADVLIREDVTL----DD---LIDALEGNRVYKPALYVVNKI  249 (365)
T ss_pred             eEEEEeccCCEEEecccccccCCHHHHHHHHHHhCcc-cceEEEecCCcH----HH---HHHHHhhcceeeeeEEEEecc
Confidence            000   0112222221111222367788888888322 333333344443    33   443333  3457899999999


Q ss_pred             cccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHh
Q psy5059         390 DLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLA  458 (1036)
Q Consensus       390 Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la  458 (1036)
                      |+....                           .+..+.+..       ..++|||+.+.+..++.+-.
T Consensus       250 D~~~~e---------------------------~~~~l~~~~-------~~v~isa~~~~nld~L~e~i  284 (365)
T COG1163         250 DLPGLE---------------------------ELERLARKP-------NSVPISAKKGINLDELKERI  284 (365)
T ss_pred             cccCHH---------------------------HHHHHHhcc-------ceEEEecccCCCHHHHHHHH
Confidence            999731                           111121111       56789999999998887654


No 152
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=98.26  E-value=7.1e-06  Score=84.48  Aligned_cols=26  Identities=23%  Similarity=0.459  Sum_probs=23.7

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ..+|+++|+.++|||||+.++++-.|
T Consensus         4 ~~ki~ivG~~~vGKTsli~~~~~~~~   29 (180)
T cd04127           4 LIKFLALGDSGVGKTSFLYQYTDNKF   29 (180)
T ss_pred             eEEEEEECCCCCCHHHHHHHHhcCCC
Confidence            35899999999999999999998876


No 153
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=98.26  E-value=1.1e-05  Score=86.06  Aligned_cols=24  Identities=25%  Similarity=0.739  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ||||+|+.++||||++..+.+-.|
T Consensus         2 ~vvvlG~~gVGKTSli~r~~~~~f   25 (202)
T cd04120           2 QVIIIGSRGVGKTSLMRRFTDDTF   25 (202)
T ss_pred             EEEEECcCCCCHHHHHHHHHhCCC
Confidence            799999999999999999987665


No 154
>cd04169 RF3 RF3 subfamily.  Peptide chain release factor 3 (RF3) is a protein involved in the termination step of translation in bacteria.  Termination occurs when class I release factors (RF1 or RF2) recognize the stop codon at the A-site of the ribosome and activate the release of the nascent polypeptide.  The class II release factor RF3 then initiates the release of the class I RF from the ribosome.  RF3 binds to the RF/ribosome complex in the inactive (GDP-bound) state.  GDP/GTP exchange occurs, followed by the release of the class I RF.  Subsequent hydrolysis of GTP to GDP triggers the release of RF3 from the ribosome.  RF3 also enhances the efficiency of class I RFs at less preferred stop codons and at stop codons in weak contexts.
Probab=98.26  E-value=1.3e-05  Score=89.04  Aligned_cols=38  Identities=8%  Similarity=-0.055  Sum_probs=30.7

Q ss_pred             HHHHhhccCCCcceeeeecccchhhhHHHHHHhhhcCc
Q psy5059         426 QLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDV  463 (1036)
Q Consensus       426 ~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd~  463 (1036)
                      +.+..-+..-..+|+.+.||.++..++++++.....-|
T Consensus       228 ~~~~~~~~~~~~~Pv~~gsa~~~~Gv~~Lld~i~~~~P  265 (267)
T cd04169         228 EFDQEAFLAGELTPVFFGSALNNFGVQELLDALVDLAP  265 (267)
T ss_pred             HHhHHHHHcCCEEEEEecccccCcCHHHHHHHHHHHCC
Confidence            34566667788899999999999999999998766543


No 155
>cd01850 CDC_Septin CDC/Septin.  Septins are a conserved family of GTP-binding proteins associated with diverse processes in dividing and non-dividing cells.  They were first discovered in the budding yeast S. cerevisiae as a set of genes (CDC3, CDC10, CDC11 and CDC12) required for normal bud morphology. Septins are also present in metazoan cells, where they are required for cytokinesis in some systems, and implicated in a variety of other processes involving organization of the cell cortex and exocytosis.  In humans, 12 septin genes generate dozens of polypeptides, many of which comprise heterooligomeric complexes. Since septin mutants are commonly defective in cytokinesis and formation of the neck formation of the neck filaments/septin rings, septins have been considered to be the primary constituents of the neck filaments.  Septins belong to the GTPase superfamily for their conserved GTPase motifs and enzymatic activities.
Probab=98.25  E-value=1.4e-05  Score=89.30  Aligned_cols=25  Identities=36%  Similarity=0.635  Sum_probs=22.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCcC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSFL  109 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~fl  109 (1036)
                      .|+|+|..++||||++++|.|..+.
T Consensus         6 ~I~vvG~sg~GKSTliN~L~~~~~~   30 (276)
T cd01850           6 NIMVVGESGLGKSTFINTLFNTKLI   30 (276)
T ss_pred             EEEEEcCCCCCHHHHHHHHHcCCCc
Confidence            6899999999999999999988863


No 156
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.24  E-value=3.6e-06  Score=87.82  Aligned_cols=25  Identities=28%  Similarity=0.579  Sum_probs=22.8

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+|+|+.++||||++.++++..|
T Consensus         1 ~ki~v~G~~~vGKSsli~~~~~~~~   25 (188)
T cd04125           1 FKVVIIGDYGVGKSSLLKRFTEDEF   25 (188)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCCC
Confidence            3699999999999999999998875


No 157
>cd04147 Ras_dva Ras-dva subfamily.  Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date.  In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm.  Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1.  Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9.  Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=98.23  E-value=9.6e-06  Score=85.60  Aligned_cols=24  Identities=25%  Similarity=0.616  Sum_probs=21.8

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||+++++.+..|
T Consensus         1 kv~vvG~~~vGKTsll~~~~~~~~   24 (198)
T cd04147           1 RLVFMGAAGVGKTALIQRFLYDTF   24 (198)
T ss_pred             CEEEECCCCCCHHHHHHHHHhCCC
Confidence            589999999999999999987764


No 158
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=98.23  E-value=3.5e-06  Score=84.81  Aligned_cols=24  Identities=29%  Similarity=0.648  Sum_probs=22.1

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+++|||||+++++.+..|
T Consensus         2 kv~v~G~~~~GKTtli~~l~~~~~   25 (164)
T smart00175        2 KIILIGDSGVGKSSLLSRFTDGKF   25 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCC
Confidence            589999999999999999998875


No 159
>TIGR02034 CysN sulfate adenylyltransferase, large subunit. Homologous to this E.coli activation pathway are nodPQH gene products found among members of the Rhizobiaceae family. These gene products have been shown to exhibit ATP sulfurase and APS kinase activity, yet are involved in Nod factor sulfation, and sulfation of other macromolecules. With members of the Rhizobiaceae family, nodQ often appears as a fusion of cysN (large subunit of ATP sulfurase) and cysC (APS kinase).
Probab=98.23  E-value=5.3e-06  Score=97.51  Aligned_cols=23  Identities=26%  Similarity=0.531  Sum_probs=20.6

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      +||++|..+||||||+++|....
T Consensus         2 ~~~~vGhvd~GKSTL~~~ll~~~   24 (406)
T TIGR02034         2 RFLTCGSVDDGKSTLIGRLLHDT   24 (406)
T ss_pred             eEEEECCCCCCchhhhHHHHHHc
Confidence            58999999999999999997554


No 160
>cd04111 Rab39 Rab39 subfamily.  Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines.  It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.   Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=98.22  E-value=7.7e-06  Score=87.53  Aligned_cols=25  Identities=28%  Similarity=0.588  Sum_probs=22.8

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+|+|++++||||+++++++..|
T Consensus         3 ~KIvvvG~~~vGKTsLi~~l~~~~~   27 (211)
T cd04111           3 FRLIVIGDSTVGKSSLLKRFTEGRF   27 (211)
T ss_pred             eEEEEECCCCCCHHHHHHHHHcCCC
Confidence            4799999999999999999998775


No 161
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=98.22  E-value=6e-06  Score=84.11  Aligned_cols=24  Identities=38%  Similarity=0.624  Sum_probs=22.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|++++||||+++++++-.|
T Consensus         3 kv~~vG~~~vGKTsli~~~~~~~f   26 (165)
T cd04140           3 RVVVFGAGGVGKSSLVLRFVKGTF   26 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            689999999999999999988775


No 162
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily.  Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics.   These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains.  Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42.  Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells.  Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42.  This ternary complex is proposed to have physiological function in processes such as tumorigenesis.  Activated Ric is likely to sign
Probab=98.22  E-value=7.3e-06  Score=84.60  Aligned_cols=24  Identities=38%  Similarity=0.657  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|++++||||++..+.+..|
T Consensus         4 ki~vvG~~~vGKTsL~~~~~~~~f   27 (172)
T cd04141           4 KIVMLGAGGVGKSAVTMQFISHSF   27 (172)
T ss_pred             EEEEECCCCCcHHHHHHHHHhCCC
Confidence            689999999999999999987775


No 163
>cd04150 Arf1_5_like Arf1-Arf5-like subfamily.  This subfamily contains Arf1, Arf2, Arf3, Arf4, Arf5, and related proteins.  Arfs1-5 are soluble proteins that are crucial for assembling coat proteins during vesicle formation.  Each contains an N-terminal myristoylated amphipathic helix that is folded into the protein in the GDP-bound state.  GDP/GTP exchange exposes the helix, which anchors to the membrane.  Following GTP hydrolysis, the helix dissociates from the membrane and folds back into the protein.  A general feature of Arf1-5 signaling may be the cooperation of two Arfs at the same site.  Arfs1-5 are generally considered to be interchangeable in function and location, but some specific functions have been assigned.  Arf1 localizes to the early/cis-Golgi, where it is activated by GBF1 and recruits the coat protein COPI.  It also localizes to the trans-Golgi network (TGN), where it is activated by BIG1/BIG2 and recruits the AP1, AP3, AP4, and GGA proteins.  Humans, but not rodents
Probab=98.21  E-value=2.1e-05  Score=79.96  Aligned_cols=37  Identities=27%  Similarity=0.495  Sum_probs=27.5

Q ss_pred             cccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccc
Q psy5059         240 VLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTAN  289 (1036)
Q Consensus       240 ~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An  289 (1036)
                      ...+.+.|+||..             ..+.+...|++..+++|++++..+
T Consensus        43 ~~~~~l~D~~G~~-------------~~~~~~~~~~~~ad~~i~v~D~~~   79 (159)
T cd04150          43 NISFTVWDVGGQD-------------KIRPLWRHYFQNTQGLIFVVDSND   79 (159)
T ss_pred             CEEEEEEECCCCH-------------hHHHHHHHHhcCCCEEEEEEeCCC
Confidence            3568899999952             245677789999998887777654


No 164
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=98.21  E-value=7.9e-06  Score=82.97  Aligned_cols=66  Identities=21%  Similarity=0.095  Sum_probs=40.9

Q ss_pred             CCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHh
Q psy5059         379 GRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLA  458 (1036)
Q Consensus       379 g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la  458 (1036)
                      +.+.++|+||+|+.++.........+            ...+   -.........+....+..-+||+++.+..+++..+
T Consensus       104 ~~p~ivv~nK~Dl~~~~~~~~~~~~~------------~~~v---~~~~~~~~~~~~~~~~~~~~Sa~~~~gi~~l~~~i  168 (171)
T cd00157         104 NVPIILVGTKIDLRDDENTLKKLEKG------------KEPI---TPEEGEKLAKEIGAIGYMECSALTQEGVKEVFEEA  168 (171)
T ss_pred             CCCEEEEEccHHhhhchhhhhhcccC------------CCcc---CHHHHHHHHHHhCCeEEEEeecCCCCCHHHHHHHH
Confidence            68899999999998765332110000            0000   01223334444555588899999999999998775


Q ss_pred             h
Q psy5059         459 K  459 (1036)
Q Consensus       459 ~  459 (1036)
                      .
T Consensus       169 ~  169 (171)
T cd00157         169 I  169 (171)
T ss_pred             h
Confidence            4


No 165
>PLN00223 ADP-ribosylation factor; Provisional
Probab=98.21  E-value=2e-05  Score=82.28  Aligned_cols=24  Identities=25%  Similarity=0.437  Sum_probs=21.2

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .+|+++|+++|||||++..+..-.
T Consensus        18 ~ki~ivG~~~~GKTsl~~~l~~~~   41 (181)
T PLN00223         18 MRILMVGLDAAGKTTILYKLKLGE   41 (181)
T ss_pred             cEEEEECCCCCCHHHHHHHHccCC
Confidence            589999999999999999987444


No 166
>PLN03110 Rab GTPase; Provisional
Probab=98.21  E-value=8.9e-06  Score=87.32  Aligned_cols=26  Identities=31%  Similarity=0.616  Sum_probs=23.3

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .-+|+++|++++|||||++++++..|
T Consensus        12 ~~Ki~ivG~~~vGKStLi~~l~~~~~   37 (216)
T PLN03110         12 LFKIVLIGDSGVGKSNILSRFTRNEF   37 (216)
T ss_pred             eeEEEEECCCCCCHHHHHHHHhcCCC
Confidence            35899999999999999999998775


No 167
>PRK00049 elongation factor Tu; Reviewed
Probab=98.20  E-value=1.1e-05  Score=94.65  Aligned_cols=23  Identities=13%  Similarity=0.320  Sum_probs=20.8

Q ss_pred             CceEEeCcCCCChhhHHhhhcCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      -.|+++|...+|||||+++|++.
T Consensus        13 ~ni~iiGhvd~GKSTL~~~L~~~   35 (396)
T PRK00049         13 VNVGTIGHVDHGKTTLTAAITKV   35 (396)
T ss_pred             EEEEEEeECCCCHHHHHHHHHHh
Confidence            35899999999999999999874


No 168
>PTZ00133 ADP-ribosylation factor; Provisional
Probab=98.20  E-value=2e-05  Score=82.30  Aligned_cols=24  Identities=25%  Similarity=0.446  Sum_probs=21.1

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .+|+++|++++||||++..+..-.
T Consensus        18 ~kv~lvG~~~vGKTsli~~~~~~~   41 (182)
T PTZ00133         18 VRILMVGLDAAGKTTILYKLKLGE   41 (182)
T ss_pred             cEEEEEcCCCCCHHHHHHHHhcCC
Confidence            589999999999999999986444


No 169
>PRK12735 elongation factor Tu; Reviewed
Probab=98.20  E-value=1.1e-05  Score=94.51  Aligned_cols=23  Identities=13%  Similarity=0.320  Sum_probs=20.7

Q ss_pred             CceEEeCcCCCChhhHHhhhcCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      -.|+++|..++|||||+++|++.
T Consensus        13 ~~i~iiGhvd~GKSTL~~~L~~~   35 (396)
T PRK12735         13 VNVGTIGHVDHGKTTLTAAITKV   35 (396)
T ss_pred             EEEEEECcCCCCHHHHHHHHHHh
Confidence            35899999999999999999874


No 170
>TIGR01393 lepA GTP-binding protein LepA. LepA (GUF1 in Saccaromyces) is a GTP-binding membrane protein related to EF-G and EF-Tu. Two types of phylogenetic tree, rooted by other GTP-binding proteins, suggest that eukaryotic homologs (including GUF1 of yeast) originated within the bacterial LepA family. The function is unknown.
Probab=98.20  E-value=1.1e-05  Score=99.18  Aligned_cols=58  Identities=21%  Similarity=0.291  Sum_probs=37.7

Q ss_pred             cCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHH
Q psy5059         378 DGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKL  457 (1036)
Q Consensus       378 ~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~l  457 (1036)
                      .+.+.|.|+||+|+.+...+                         .....+...+. ..+.....+||+++.++.++++.
T Consensus       121 ~~ipiIiViNKiDl~~~~~~-------------------------~~~~el~~~lg-~~~~~vi~vSAktG~GI~~Lle~  174 (595)
T TIGR01393       121 NDLEIIPVINKIDLPSADPE-------------------------RVKKEIEEVIG-LDASEAILASAKTGIGIEEILEA  174 (595)
T ss_pred             cCCCEEEEEECcCCCccCHH-------------------------HHHHHHHHHhC-CCcceEEEeeccCCCCHHHHHHH
Confidence            46789999999998643211                         11222333322 22234678999999999999988


Q ss_pred             hhhc
Q psy5059         458 AKET  461 (1036)
Q Consensus       458 a~~v  461 (1036)
                      ..+.
T Consensus       175 I~~~  178 (595)
T TIGR01393       175 IVKR  178 (595)
T ss_pred             HHHh
Confidence            6544


No 171
>PRK05306 infB translation initiation factor IF-2; Validated
Probab=98.20  E-value=8.6e-06  Score=102.03  Aligned_cols=26  Identities=19%  Similarity=0.524  Sum_probs=23.2

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ..|-|+++|..++|||||+++|.+..
T Consensus       289 R~pvV~ImGhvd~GKTSLl~~Lr~~~  314 (787)
T PRK05306        289 RPPVVTIMGHVDHGKTSLLDAIRKTN  314 (787)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHhCC
Confidence            45999999999999999999997655


No 172
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=98.19  E-value=7.7e-06  Score=86.46  Aligned_cols=26  Identities=27%  Similarity=0.590  Sum_probs=23.6

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ..+|+++|+.++||||+++++.+..|
T Consensus         6 ~~kivvvG~~~vGKTsli~~l~~~~~   31 (199)
T cd04110           6 LFKLLIIGDSGVGKSSLLLRFADNTF   31 (199)
T ss_pred             eeEEEEECCCCCCHHHHHHHHhcCCC
Confidence            46899999999999999999988765


No 173
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=98.19  E-value=7.7e-06  Score=83.82  Aligned_cols=25  Identities=24%  Similarity=0.480  Sum_probs=22.5

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+++|++++||||+++++.+..|
T Consensus         3 ~ki~vvG~~~vGKTsli~~~~~~~~   27 (170)
T cd04115           3 FKIIVIGDSNVGKTCLTYRFCAGRF   27 (170)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhCCC
Confidence            5799999999999999999987664


No 174
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=98.19  E-value=9.4e-06  Score=83.62  Aligned_cols=24  Identities=33%  Similarity=0.639  Sum_probs=22.3

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|++++||||++.++++..|
T Consensus         2 ki~ivG~~~vGKTsli~~~~~~~f   25 (170)
T cd04108           2 KVIVVGDLSVGKTCLINRFCKDVF   25 (170)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCC
Confidence            689999999999999999998775


No 175
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=98.18  E-value=1.7e-05  Score=82.39  Aligned_cols=24  Identities=33%  Similarity=0.530  Sum_probs=22.1

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|+.++||||+++++.+..|
T Consensus         2 ki~vvG~~~vGKTsli~~l~~~~~   25 (187)
T cd04132           2 KIVVVGDGGCGKTCLLIVYSQGKF   25 (187)
T ss_pred             eEEEECCCCCCHHHHHHHHHhCcC
Confidence            689999999999999999998775


No 176
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=98.17  E-value=1.1e-05  Score=86.56  Aligned_cols=27  Identities=37%  Similarity=0.626  Sum_probs=22.8

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCcCcc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSFLPR  111 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~flPr  111 (1036)
                      +|+++|..+|||||+.++|.|.+.++.
T Consensus         2 ~IlllG~tGsGKSs~~N~ilg~~~f~~   28 (212)
T PF04548_consen    2 RILLLGKTGSGKSSLGNSILGKEVFKS   28 (212)
T ss_dssp             EEEEECSTTSSHHHHHHHHHTSS-SS-
T ss_pred             EEEEECCCCCCHHHHHHHHhcccceee
Confidence            589999999999999999999885433


No 177
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional
Probab=98.15  E-value=2.1e-05  Score=97.64  Aligned_cols=25  Identities=32%  Similarity=0.503  Sum_probs=22.2

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ...||++|..++|||||+++|++..
T Consensus        24 ~~~i~iiGh~~~GKSTL~~~Ll~~~   48 (632)
T PRK05506         24 LLRFITCGSVDDGKSTLIGRLLYDS   48 (632)
T ss_pred             eeEEEEECCCCCChHHHHHHHHHHh
Confidence            4579999999999999999998764


No 178
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=98.13  E-value=2.5e-05  Score=79.85  Aligned_cols=23  Identities=35%  Similarity=0.609  Sum_probs=21.2

Q ss_pred             eEEeCcCCCChhhHHhhhcCCCc
Q psy5059          86 IVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        86 IvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      |+|+|+.++||||++.++.+..|
T Consensus         1 i~i~G~~~vGKTsli~~~~~~~~   23 (174)
T smart00174        1 LVVVGDGAVGKTCLLISYTTNAF   23 (174)
T ss_pred             CEEECCCCCCHHHHHHHHHhCCC
Confidence            68999999999999999998775


No 179
>COG3596 Predicted GTPase [General function prediction only]
Probab=98.13  E-value=1.6e-05  Score=86.62  Aligned_cols=139  Identities=19%  Similarity=0.272  Sum_probs=80.2

Q ss_pred             CcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCCCCCcccceeccC
Q psy5059         239 SVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLDID  318 (1036)
Q Consensus       239 ~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp~g~RTigvl~~~  318 (1036)
                      +.-+|+|-|+||+=.      ..+-...-+.+++.|+.+-+ ++|.+.+|.+-...-| ..+++++              
T Consensus        85 ~~~~l~lwDtPG~gd------g~~~D~~~r~~~~d~l~~~D-LvL~l~~~~draL~~d-~~f~~dV--------------  142 (296)
T COG3596          85 DGENLVLWDTPGLGD------GKDKDAEHRQLYRDYLPKLD-LVLWLIKADDRALGTD-EDFLRDV--------------  142 (296)
T ss_pred             cccceEEecCCCccc------chhhhHHHHHHHHHHhhhcc-EEEEeccCCCccccCC-HHHHHHH--------------
Confidence            346799999999833      22222345778888888888 8888888876444322 1111111              


Q ss_pred             CCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCceEEEEecccccCCCchh
Q psy5059         319 LPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDA  398 (1036)
Q Consensus       319 ~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~Dl~~~g~~~  398 (1036)
                                                                          ++.-+|   +|+|.|||..|...+|.+ 
T Consensus       143 ----------------------------------------------------i~~~~~---~~~i~~VtQ~D~a~p~~~-  166 (296)
T COG3596         143 ----------------------------------------------------IILGLD---KRVLFVVTQADRAEPGRE-  166 (296)
T ss_pred             ----------------------------------------------------HHhccC---ceeEEEEehhhhhccccc-
Confidence                                                                122222   899999999999888722 


Q ss_pred             hhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhhcCcC
Q psy5059         399 IDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVD  464 (1036)
Q Consensus       399 ~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd~~  464 (1036)
                      ||.=.+.-.|      ..+..++.+.+. +..+++.  --|++++++....+..++....-++-|.
T Consensus       167 W~~~~~~p~~------a~~qfi~~k~~~-~~~~~q~--V~pV~~~~~r~~wgl~~l~~ali~~lp~  223 (296)
T COG3596         167 WDSAGHQPSP------AIKQFIEEKAEA-LGRLFQE--VKPVVAVSGRLPWGLKELVRALITALPV  223 (296)
T ss_pred             cccccCCCCH------HHHHHHHHHHHH-HHHHHhh--cCCeEEeccccCccHHHHHHHHHHhCcc
Confidence            1111111110      011122222211 2333333  6778888888889988888777666553


No 180
>cd01882 BMS1 Bms1.  Bms1 is an essential, evolutionarily conserved, nucleolar protein.  Its depletion interferes with processing of the 35S pre-rRNA at sites A0, A1, and A2, and the formation of 40S subunits.  Bms1, the putative endonuclease Rc11, and the essential U3 small nucleolar RNA form a stable subcomplex that is believed to control an early step in the formation of the 40S subumit.  The C-terminal domain of Bms1 contains a GTPase-activating protein (GAP) that functions intramolecularly.  It is believed that Rc11 activates Bms1 by acting as a guanine-nucleotide exchange factor (GEF) to promote GDP/GTP exchange, and that activated (GTP-bound) Bms1 delivers Rc11 to the preribosomes.
Probab=98.13  E-value=1.6e-05  Score=86.17  Aligned_cols=57  Identities=16%  Similarity=0.177  Sum_probs=37.4

Q ss_pred             HHhhhccccCCc-eEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhcc--CCCcceeeeeccc
Q psy5059         370 KLAKETDVDGRR-TLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYIS--NPNSIILAVVTAN  446 (1036)
Q Consensus       370 ~la~~~d~~g~r-ti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~--~~~~ipla~ISA~  446 (1036)
                      .+...+...|.+ .|+|+||||++++..+ +                      ..+.+.+..++.  +..+.++.++||+
T Consensus       123 ~i~~~l~~~g~p~vi~VvnK~D~~~~~~~-~----------------------~~~~~~l~~~~~~~~~~~~ki~~iSa~  179 (225)
T cd01882         123 EFLNILQVHGFPRVMGVLTHLDLFKKNKT-L----------------------RKTKKRLKHRFWTEVYQGAKLFYLSGI  179 (225)
T ss_pred             HHHHHHHHcCCCeEEEEEeccccCCcHHH-H----------------------HHHHHHHHHHHHHhhCCCCcEEEEeec
Confidence            455555556776 4669999999854222 1                      344555555443  5678999999987


Q ss_pred             chh
Q psy5059         447 TDM  449 (1036)
Q Consensus       447 td~  449 (1036)
                      +..
T Consensus       180 ~~~  182 (225)
T cd01882         180 VHG  182 (225)
T ss_pred             cCC
Confidence            763


No 181
>TIGR00485 EF-Tu translation elongation factor TU. This alignment models orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts, one of several GTP-binding translation factors found by the more general pfam model GTP_EFTU. The eukaryotic conterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this model. EF-Tu is one of the most abundant proteins in bacteria, as well as one of the most highly conserved, and in a number of species the gene is duplicated with identical function. When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors. Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=98.12  E-value=1.9e-05  Score=92.49  Aligned_cols=23  Identities=17%  Similarity=0.333  Sum_probs=20.8

Q ss_pred             CceEEeCcCCCChhhHHhhhcCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      -.|+++|...+|||||+++|+|.
T Consensus        13 ~~i~i~Ghvd~GKStL~~~L~~~   35 (394)
T TIGR00485        13 VNIGTIGHVDHGKTTLTAAITTV   35 (394)
T ss_pred             EEEEEEeecCCCHHHHHHHHHhh
Confidence            35999999999999999999865


No 182
>PTZ00369 Ras-like protein; Provisional
Probab=98.12  E-value=1.3e-05  Score=83.88  Aligned_cols=26  Identities=31%  Similarity=0.462  Sum_probs=23.3

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -.+|+++|+.++||||+++++.+-.|
T Consensus         5 ~~Ki~iiG~~~~GKTsLi~~~~~~~~   30 (189)
T PTZ00369          5 EYKLVVVGGGGVGKSALTIQFIQNHF   30 (189)
T ss_pred             ceEEEEECCCCCCHHHHHHHHhcCCC
Confidence            36899999999999999999987765


No 183
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=98.10  E-value=3.9e-05  Score=78.50  Aligned_cols=25  Identities=24%  Similarity=0.538  Sum_probs=22.7

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+++|+++|||||++.++.+..|
T Consensus         2 ~ki~iiG~~~~GKTsl~~~~~~~~~   26 (175)
T cd01870           2 KKLVIVGDGACGKTCLLIVFSKDQF   26 (175)
T ss_pred             cEEEEECCCCCCHHHHHHHHhcCCC
Confidence            5799999999999999999998765


No 184
>PLN03126 Elongation factor Tu; Provisional
Probab=98.10  E-value=1.5e-05  Score=95.20  Aligned_cols=24  Identities=21%  Similarity=0.292  Sum_probs=21.2

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      -.|+++|..++|||||+++|++..
T Consensus        82 ~ni~iiGhvd~GKSTLi~~Ll~~~  105 (478)
T PLN03126         82 VNIGTIGHVDHGKTTLTAALTMAL  105 (478)
T ss_pred             eEEEEECCCCCCHHHHHHHHHHhh
Confidence            458999999999999999998654


No 185
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily.  Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project.  It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2).  This is a novel subfamily identified in human cancers that is uncharacterized to date.
Probab=98.09  E-value=3.2e-05  Score=79.18  Aligned_cols=24  Identities=38%  Similarity=0.607  Sum_probs=21.8

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ||+++|++++||||++.++.+..|
T Consensus         1 ~i~ivG~~~vGKTsli~~~~~~~~   24 (164)
T cd04162           1 QILVLGLDGAGKTSLLHSLSSERS   24 (164)
T ss_pred             CEEEECCCCCCHHHHHHHHhcCCC
Confidence            799999999999999999987654


No 186
>PLN03108 Rab family protein; Provisional
Probab=98.09  E-value=1.7e-05  Score=84.80  Aligned_cols=25  Identities=24%  Similarity=0.514  Sum_probs=23.0

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -+|+++|+.++||||+++.+++..|
T Consensus         7 ~kivivG~~gvGKStLi~~l~~~~~   31 (210)
T PLN03108          7 FKYIIIGDTGVGKSCLLLQFTDKRF   31 (210)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhCCC
Confidence            5799999999999999999998775


No 187
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=98.09  E-value=1.6e-05  Score=81.21  Aligned_cols=24  Identities=33%  Similarity=0.578  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|..++||||++.++.+-.|
T Consensus         2 ki~i~G~~~~GKTsl~~~~~~~~~   25 (174)
T cd04135           2 KCVVVGDGAVGKTCLLMSYANDAF   25 (174)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            589999999999999999988775


No 188
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=98.08  E-value=1e-05  Score=82.28  Aligned_cols=24  Identities=33%  Similarity=0.642  Sum_probs=21.3

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|+.++|||||++++.+..|
T Consensus         1 ki~vvG~~~~GKtsli~~~~~~~~   24 (165)
T cd04146           1 KIAVLGASGVGKSALVVRFLTKRF   24 (165)
T ss_pred             CEEEECCCCCcHHHHHHHHHhCcc
Confidence            489999999999999999987664


No 189
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=98.08  E-value=4.9e-05  Score=78.33  Aligned_cols=24  Identities=42%  Similarity=0.634  Sum_probs=21.8

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|..++||||+++++++..|
T Consensus         3 kv~l~G~~g~GKTtl~~~~~~~~~   26 (180)
T cd04137           3 KIAVLGSRSVGKSSLTVQFVEGHF   26 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            589999999999999999997764


No 190
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=98.07  E-value=2.9e-05  Score=78.98  Aligned_cols=24  Identities=17%  Similarity=0.558  Sum_probs=22.1

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|++++||||++..+.+..|
T Consensus         2 ki~vvG~~~~GKTsli~~~~~~~~   25 (161)
T cd04117           2 RLLLIGDSGVGKTCLLCRFTDNEF   25 (161)
T ss_pred             EEEEECcCCCCHHHHHHHHhcCCC
Confidence            589999999999999999988776


No 191
>cd04134 Rho3 Rho3 subfamily.  Rho3 is a member of the Rho family found only in fungi.  Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules.  Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity.  The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=98.05  E-value=3.9e-05  Score=80.40  Aligned_cols=24  Identities=29%  Similarity=0.598  Sum_probs=21.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++..+.+-.|
T Consensus         2 kivivG~~~vGKTsli~~~~~~~~   25 (189)
T cd04134           2 KVVVLGDGACGKTSLLNVFTRGYF   25 (189)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCC
Confidence            689999999999999999988765


No 192
>cd04130 Wrch_1 Wrch-1 subfamily.  Wrch-1 (Wnt-1 responsive Cdc42 homolog) is a Rho family GTPase that shares significant sequence and functional similarity with Cdc42.  Wrch-1 was first identified in mouse mammary epithelial cells, where its transcription is upregulated in Wnt-1 transformation.  Wrch-1 contains N- and C-terminal extensions relative to cdc42, suggesting potential differences in cellular localization and function.  The Wrch-1 N-terminal extension contains putative SH3 domain-binding motifs and has been shown to bind the SH3 domain-containing protein Grb2, which increases the level of active Wrch-1 in cells.  Unlike Cdc42, which localizes to the cytosol and perinuclear membranes, Wrch-1 localizes extensively with the plasma membrane and endosomes.  The membrane association, localization, and biological activity of Wrch-1 indicate an atypical model of regulation distinct from other Rho family GTPases.  Most Rho proteins contain a lipid modification site at the C-terminus, 
Probab=98.04  E-value=2.1e-05  Score=80.85  Aligned_cols=24  Identities=33%  Similarity=0.549  Sum_probs=21.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +++++|+.++||||++.++.+-.|
T Consensus         2 k~~i~G~~~~GKtsl~~~~~~~~~   25 (173)
T cd04130           2 KCVLVGDGAVGKTSLIVSYTTNGY   25 (173)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            589999999999999999877664


No 193
>cd04148 RGK RGK subfamily.  The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues.   RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function.  Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells.  RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton.  Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra
Probab=98.04  E-value=1.6e-05  Score=85.79  Aligned_cols=24  Identities=25%  Similarity=0.569  Sum_probs=21.3

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|++++|||||++++.+-.|
T Consensus         2 KI~lvG~~gvGKTsLi~~~~~~~~   25 (221)
T cd04148           2 RVVMLGSPGVGKSSLASQFTSGEY   25 (221)
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCc
Confidence            689999999999999999976554


No 194
>cd04128 Spg1 Spg1p.  Spg1p (septum-promoting GTPase) was first identified in the fission yeast S. pombe, where it regulates septum formation in the septation initiation network (SIN) through the cdc7 protein kinase.  Spg1p is an essential gene that localizes to the spindle pole bodies.  When GTP-bound, it binds cdc7 and causes it to translocate to spindle poles. Sid4p (septation initiation defective) is required for localization of Spg1p to the spindle pole body, and the ability of Spg1p to promote septum formation from any point in the cell cycle depends on Sid4p.  Spg1p is negatively regulated by Byr4 and cdc16, which form a two-component GTPase activating protein (GAP) for Spg1p.  The existence of a SIN-related pathway in plants has been proposed.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP.  Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are
Probab=98.04  E-value=7.3e-05  Score=78.11  Aligned_cols=24  Identities=29%  Similarity=0.491  Sum_probs=21.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++..+.+..|
T Consensus         2 Ki~vlG~~~vGKTsLi~~~~~~~f   25 (182)
T cd04128           2 KIGLLGDAQIGKTSLMVKYVEGEF   25 (182)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            689999999999999999987775


No 195
>PRK00007 elongation factor G; Reviewed
Probab=98.03  E-value=2.1e-05  Score=98.54  Aligned_cols=55  Identities=16%  Similarity=0.129  Sum_probs=43.0

Q ss_pred             HHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccch
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTD  448 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td  448 (1036)
                      .++++.+...|.+.|.|+||||+.+..-                         ..+...++..+.+..+.+.+.+||..+
T Consensus       117 ~~~~~~~~~~~~p~iv~vNK~D~~~~~~-------------------------~~~~~~i~~~l~~~~~~~~ipisa~~~  171 (693)
T PRK00007        117 ETVWRQADKYKVPRIAFVNKMDRTGADF-------------------------YRVVEQIKDRLGANPVPIQLPIGAEDD  171 (693)
T ss_pred             HHHHHHHHHcCCCEEEEEECCCCCCCCH-------------------------HHHHHHHHHHhCCCeeeEEecCccCCc
Confidence            5678888889999999999999986431                         345567788888887788888887655


No 196
>PLN03071 GTP-binding nuclear protein Ran; Provisional
Probab=98.03  E-value=1.4e-05  Score=86.16  Aligned_cols=26  Identities=23%  Similarity=0.484  Sum_probs=22.4

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .-+|+++|++++||||+++++..-.|
T Consensus        13 ~~Ki~vvG~~gvGKTsli~~~~~~~f   38 (219)
T PLN03071         13 SFKLVIVGDGGTGKTTFVKRHLTGEF   38 (219)
T ss_pred             ceEEEEECcCCCCHHHHHHHHhhCCC
Confidence            45899999999999999999876554


No 197
>cd04173 Rnd2_Rho7 Rnd2/Rho7 subfamily.  Rnd2/Rho7 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd3/RhoE/Rho8.  Rnd2/Rho7 is transiently expressed in radially migrating cells in the brain while they are within the subventricular zone of the hippocampus and cerebral cortex.  These migrating cells typically develop into pyramidal neurons.  Cells that exogenously expressed Rnd2/Rho7 failed to migrate to upper layers of the brain, suggesting that Rnd2/Rho7 plays a role in the radial migration and morphological changes of developing pyramidal neurons, and that Rnd2/Rho7 degradation is necessary for proper cellular migration.  The Rnd2/Rho7 GEF Rapostlin is found primarily in the brain and together with Rnd2/Rho7 induces dendrite branching.  Unlike Rnd1/Rho6 and Rnd3/RhoE/Rho8, which are RhoA antagonists, Rnd2/Rho7 binds the GEF Pragmin and significantly stimulates RhoA activity and Rho-A mediated cell contraction.  Rnd2/Rho7 is also found to be expressed in sperma
Probab=98.03  E-value=8.5e-05  Score=80.39  Aligned_cols=24  Identities=29%  Similarity=0.664  Sum_probs=22.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|||||++++|||||+.++++..|
T Consensus         3 KIvvvGd~~vGKTsLi~~~~~~~f   26 (222)
T cd04173           3 KIVVVGDAECGKTALLQVFAKDAY   26 (222)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCC
Confidence            689999999999999999998775


No 198
>PRK04004 translation initiation factor IF-2; Validated
Probab=98.03  E-value=2.6e-05  Score=95.58  Aligned_cols=27  Identities=26%  Similarity=0.667  Sum_probs=24.2

Q ss_pred             CCCCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          81 IQLPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        81 i~lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ...|.|+++|..++||||||++|.|..
T Consensus         4 ~R~p~V~i~Gh~~~GKTSLl~~l~~~~   30 (586)
T PRK04004          4 LRQPIVVVLGHVDHGKTTLLDKIRGTA   30 (586)
T ss_pred             CCCcEEEEECCCCCCHHHHHHHHhCcc
Confidence            456999999999999999999998765


No 199
>PRK12739 elongation factor G; Reviewed
Probab=97.99  E-value=2.3e-05  Score=98.21  Aligned_cols=37  Identities=8%  Similarity=-0.096  Sum_probs=28.9

Q ss_pred             HHHHhhccCCCcceeeeecccchhhhHHHHHHhhhcC
Q psy5059         426 QLVLHYISNPNSIILAVVTANTDMATSESLKLAKETD  462 (1036)
Q Consensus       426 ~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd  462 (1036)
                      ..+...+....+.|+.+.||.++..++.+++.....-
T Consensus       241 ~~l~~~~~~~~~~Pv~~gSa~~~~Gv~~LLd~I~~~l  277 (691)
T PRK12739        241 AAIRKATINMEFFPVLCGSAFKNKGVQPLLDAVVDYL  277 (691)
T ss_pred             HHHHHHHHcCCEEEEEeccccCCccHHHHHHHHHHHC
Confidence            3444445556788999999999999999999976653


No 200
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=97.99  E-value=2.4e-05  Score=80.10  Aligned_cols=24  Identities=25%  Similarity=0.588  Sum_probs=21.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+++|||||+++++....|
T Consensus         2 ki~vvG~~~vGKTsli~~~~~~~~   25 (166)
T cd00877           2 KLVLVGDGGTGKTTFVKRHLTGEF   25 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            689999999999999999986553


No 201
>TIGR00437 feoB ferrous iron transporter FeoB. FeoB (773 amino acids in E. coli), a cytoplasmic membrane protein required for iron(II) update, is encoded in an operon with FeoA (75 amino acids), which is also required, and is regulated by Fur. There appear to be two copies in Archaeoglobus fulgidus and Clostridium acetobutylicum.
Probab=97.98  E-value=2.7e-05  Score=95.64  Aligned_cols=65  Identities=8%  Similarity=0.022  Sum_probs=43.0

Q ss_pred             HHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccch
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTD  448 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td  448 (1036)
                      +.+..++...|.++|.|+||+|+.++..-.                       .. .+.+.+.+    ..|...+||+++
T Consensus        89 l~l~~ql~~~~~PiIIVlNK~Dl~~~~~i~-----------------------~d-~~~L~~~l----g~pvv~tSA~tg  140 (591)
T TIGR00437        89 LYLTLQLLELGIPMILALNLVDEAEKKGIR-----------------------ID-EEKLEERL----GVPVVPTSATEG  140 (591)
T ss_pred             HHHHHHHHhcCCCEEEEEehhHHHHhCCCh-----------------------hh-HHHHHHHc----CCCEEEEECCCC
Confidence            345555566789999999999996432110                       00 11222222    357888999999


Q ss_pred             hhhHHHHHHhhhc
Q psy5059         449 MATSESLKLAKET  461 (1036)
Q Consensus       449 ~~~qeil~la~~v  461 (1036)
                      .+.+++++...+.
T Consensus       141 ~Gi~eL~~~i~~~  153 (591)
T TIGR00437       141 RGIERLKDAIRKA  153 (591)
T ss_pred             CCHHHHHHHHHHH
Confidence            9999999887554


No 202
>cd04126 Rab20 Rab20 subfamily.  Rab20 is one of several Rab proteins that appear to be restricted in expression to the apical domain of murine polarized epithelial cells.  It is expressed on the apical side of polarized kidney tubule and intestinal epithelial cells, and in non-polarized cells. It also localizes to vesico-tubular structures below the apical brush border of renal proximal tubule cells and in the apical region of duodenal epithelial cells.  Rab20 has also been shown to colocalize with vacuolar H+-ATPases (V-ATPases) in mouse kidney cells, suggesting a role in the regulation of V-ATPase traffic in specific portions of the nephron.  It was also shown to be one of several proteins whose expression is upregulated in human myelodysplastic syndrome (MDS) patients. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bo
Probab=97.97  E-value=0.0001  Score=79.62  Aligned_cols=24  Identities=25%  Similarity=0.635  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++.++.+..|
T Consensus         2 KIvivG~~~vGKTSLi~r~~~~~f   25 (220)
T cd04126           2 KVVLLGDMNVGKTSLLHRYMERRF   25 (220)
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCC
Confidence            589999999999999999988775


No 203
>PRK09602 translation-associated GTPase; Reviewed
Probab=97.95  E-value=8.7e-05  Score=86.88  Aligned_cols=39  Identities=21%  Similarity=0.186  Sum_probs=31.0

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceE
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLI  122 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~  122 (1036)
                      .+|++||.+|+||||++++|++..+...+-.-||+-|..
T Consensus         2 ~kigivG~pnvGKSTlfn~Lt~~~~~~~~y~f~t~~p~~   40 (396)
T PRK09602          2 ITIGLVGKPNVGKSTFFNAATLADVEIANYPFTTIDPNV   40 (396)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCcccccCCCCcceeeee
Confidence            479999999999999999999988643344457777764


No 204
>cd04121 Rab40 Rab40 subfamily.  This subfamily contains Rab40a, Rab40b, and Rab40c, which are all highly homologous.  In rat, Rab40c is localized to the perinuclear recycling compartment (PRC), and is distributed in a tissue-specific manor, with high expression in brain, heart, kidney, and testis, low expression in lung and liver, and no expression in spleen and skeletal muscle.  Rab40c is highly expressed in differentiated oligodendrocytes but minimally expressed in oligodendrocyte progenitors, suggesting a role in the vesicular transport of myelin components.  Unlike most other Ras-superfamily proteins, Rab40c was shown to have a much lower affinity for GTP, and an affinity for GDP that is lower than for GTP. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide d
Probab=97.94  E-value=2.9e-05  Score=81.87  Aligned_cols=26  Identities=31%  Similarity=0.482  Sum_probs=22.7

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +-+|+++|+.++||||+|.++.+-.|
T Consensus         6 ~~KivviG~~~vGKTsll~~~~~~~~   31 (189)
T cd04121           6 LLKFLLVGDSDVGKGEILASLQDGST   31 (189)
T ss_pred             eeEEEEECCCCCCHHHHHHHHHcCCC
Confidence            34899999999999999999987654


No 205
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains. The long precursor of the 86K protein originally described is proposed to have three domains. The N-terminal A-domain is acidic, repetitive, weakly conserved, readily removed by proteolysis during chloroplast isolation, and not required for protein translocation. The other domains are designated G (GTPase) and M (membrane anchor); this family includes most of the G domain and all of M.
Probab=97.94  E-value=5.5e-05  Score=91.41  Aligned_cols=25  Identities=36%  Similarity=0.565  Sum_probs=22.9

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ..|+++|..++||||++++|.|...
T Consensus       119 lrIvLVGKTGVGKSSLINSILGekv  143 (763)
T TIGR00993       119 LNILVLGKSGVGKSATINSIFGEVK  143 (763)
T ss_pred             eEEEEECCCCCCHHHHHHHHhcccc
Confidence            4799999999999999999999873


No 206
>cd01874 Cdc42 Cdc42 subfamily.  Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases.  These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway.  Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth.  In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus.  Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand.  In addi
Probab=97.92  E-value=9.5e-05  Score=76.59  Aligned_cols=24  Identities=33%  Similarity=0.537  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++.++.+-.|
T Consensus         3 ki~vvG~~~vGKTsl~~~~~~~~f   26 (175)
T cd01874           3 KCVVVGDGAVGKTCLLISYTTNKF   26 (175)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCC
Confidence            699999999999999999987765


No 207
>cd01892 Miro2 Miro2 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the putative GTPase domain in the C terminus of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=97.92  E-value=3.6e-05  Score=79.20  Aligned_cols=25  Identities=36%  Similarity=0.688  Sum_probs=23.0

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -+++++|+.++||||++.++.+..|
T Consensus         5 ~kv~~vG~~~vGKTsli~~~~~~~f   29 (169)
T cd01892           5 FLCFVLGAKGSGKSALLRAFLGRSF   29 (169)
T ss_pred             EEEEEECCCCCcHHHHHHHHhCCCC
Confidence            4799999999999999999998876


No 208
>PRK05433 GTP-binding protein LepA; Provisional
Probab=97.92  E-value=9.5e-05  Score=90.98  Aligned_cols=23  Identities=17%  Similarity=0.375  Sum_probs=20.5

Q ss_pred             CceEEeCcCCCChhhHHhhhcCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      --|+++|..++|||||+++|...
T Consensus         8 RNi~IiGhvd~GKTTL~~rLl~~   30 (600)
T PRK05433          8 RNFSIIAHIDHGKSTLADRLIEL   30 (600)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHh
Confidence            46899999999999999999754


No 209
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=97.92  E-value=6e-05  Score=72.81  Aligned_cols=61  Identities=13%  Similarity=0.064  Sum_probs=41.4

Q ss_pred             hhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhh
Q psy5059         372 AKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMAT  451 (1036)
Q Consensus       372 a~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~  451 (1036)
                      .......+.++|+|+||.|+.+......                       .   ............+...+||..+...
T Consensus        95 ~~~~~~~~~~~ivv~nk~D~~~~~~~~~-----------------------~---~~~~~~~~~~~~~~~~~s~~~~~~i  148 (157)
T cd00882          95 LINKEGENIPIILVGNKIDLPEERVVSE-----------------------E---ELAEQLAKELGVPYFETSAKTGENV  148 (157)
T ss_pred             HHhhccCCCcEEEEEeccccccccchHH-----------------------H---HHHHHHHhhcCCcEEEEecCCCCCh
Confidence            3445566899999999999987543321                       0   0122233445678899999999988


Q ss_pred             HHHHHHh
Q psy5059         452 SESLKLA  458 (1036)
Q Consensus       452 qeil~la  458 (1036)
                      .+++...
T Consensus       149 ~~~~~~l  155 (157)
T cd00882         149 EELFEEL  155 (157)
T ss_pred             HHHHHHH
Confidence            8887654


No 210
>TIGR00483 EF-1_alpha translation elongation factor EF-1 alpha. This model represents the counterpart of bacterial EF-Tu for the Archaea (aEF-1 alpha) and Eukaryotes (eEF-1 alpha). The trusted cutoff is set fairly high so that incomplete sequences will score between suggested and trusted cutoff levels.
Probab=97.92  E-value=0.00012  Score=86.76  Aligned_cols=23  Identities=26%  Similarity=0.439  Sum_probs=20.4

Q ss_pred             CceEEeCcCCCChhhHHhhhcCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      -.|+++|..++|||||+++|+..
T Consensus         8 ~~v~i~Ghvd~GKSTL~~~ll~~   30 (426)
T TIGR00483         8 INVAFIGHVDHGKSTTVGHLLYK   30 (426)
T ss_pred             eEEEEEeccCCcHHHHHHHHHHH
Confidence            45899999999999999999853


No 211
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]
Probab=97.91  E-value=3.7e-05  Score=92.86  Aligned_cols=68  Identities=16%  Similarity=0.049  Sum_probs=50.4

Q ss_pred             HHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccch
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTD  448 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td  448 (1036)
                      +.|.-++-.-|.++|.++|++|...+..-.+            |                .+.+....-+|++.++|+++
T Consensus        98 LyltlQLlE~g~p~ilaLNm~D~A~~~Gi~I------------D----------------~~~L~~~LGvPVv~tvA~~g  149 (653)
T COG0370          98 LYLTLQLLELGIPMILALNMIDEAKKRGIRI------------D----------------IEKLSKLLGVPVVPTVAKRG  149 (653)
T ss_pred             HHHHHHHHHcCCCeEEEeccHhhHHhcCCcc------------c----------------HHHHHHHhCCCEEEEEeecC
Confidence            5677788888999999999999876521111            0                12334455789999999999


Q ss_pred             hhhHHHHHHhhhcCcC
Q psy5059         449 MATSESLKLAKETDVD  464 (1036)
Q Consensus       449 ~~~qeil~la~~vd~~  464 (1036)
                      ...+++++.+-+..+.
T Consensus       150 ~G~~~l~~~i~~~~~~  165 (653)
T COG0370         150 EGLEELKRAIIELAES  165 (653)
T ss_pred             CCHHHHHHHHHHhccc
Confidence            9999999888766543


No 212
>cd01871 Rac1_like Rac1-like subfamily.  The Rac1-like subfamily consists of Rac1, Rac2, and Rac3 proteins, plus the splice variant Rac1b that contains a 19-residue insertion near switch II relative to Rac1.  While Rac1 is ubiquitously expressed, Rac2 and Rac3 are largely restricted to hematopoietic and neural tissues respectively.  Rac1 stimulates the formation of actin lamellipodia and membrane ruffles.  It also plays a role in cell-matrix adhesion and cell anoikis.  In intestinal epithelial cells, Rac1 is an important regulator of migration and mediates apoptosis.  Rac1 is also essential for RhoA-regulated actin stress fiber and focal adhesion complex formation.  In leukocytes, Rac1 and Rac2 have distinct roles in regulating cell morphology, migration, and invasion, but are not essential for macrophage migration or chemotaxis.  Rac3 has biochemical properties that are closely related to Rac1, such as effector interaction, nucleotide binding, and hydrolysis; Rac2 has a slower nucleoti
Probab=97.91  E-value=0.00011  Score=76.00  Aligned_cols=24  Identities=33%  Similarity=0.551  Sum_probs=21.7

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++.++.+-.|
T Consensus         3 ki~iiG~~~vGKSsli~~~~~~~f   26 (174)
T cd01871           3 KCVVVGDGAVGKTCLLISYTTNAF   26 (174)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCC
Confidence            689999999999999999987665


No 213
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily.  Rnd3/RhoE/Rho8 is a member of the novel Rho subfamily Rnd, together with Rnd1/Rho6 and Rnd2/Rho7.  Rnd3/RhoE is known to bind the serine-threonine kinase ROCK I.  Unphosphorylated Rnd3/RhoE associates primarily with membranes, but ROCK I-phosphorylated Rnd3/RhoE localizes in the cytosol.  Phosphorylation of Rnd3/RhoE correlates with its activity in disrupting RhoA-induced stress fibers and inhibiting Ras-induced fibroblast transformation.  In cells that lack stress fibers, such as macrophages and monocytes, Rnd3/RhoE induces a redistribution of actin, causing morphological changes in the cell.  In addition, Rnd3/RhoE has been shown to inhibit cell cycle progression in G1 phase at a point upstream of the pRb family pocket protein checkpoint.  Rnd3/RhoE has also been shown to inhibit Ras- and Raf-induced fibroblast transformation.  In mammary epithelial tumor cells, Rnd3/RhoE regulates the assembly of the apical junction complex and tight
Probab=97.91  E-value=0.0002  Score=75.01  Aligned_cols=25  Identities=32%  Similarity=0.596  Sum_probs=22.7

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .+|+++|+.++||||++..+.+-.|
T Consensus         6 ~KivvvGd~~vGKTsli~~~~~~~f   30 (182)
T cd04172           6 CKIVVVGDSQCGKTALLHVFAKDCF   30 (182)
T ss_pred             EEEEEECCCCCCHHHHHHHHHhCCC
Confidence            4799999999999999999988775


No 214
>cd04174 Rnd1_Rho6 Rnd1/Rho6 subfamily.  Rnd1/Rho6 is a member of the novel Rho subfamily Rnd, together with Rnd2/Rho7 and Rnd3/RhoE/Rho8.  Rnd1/Rho6 binds GTP but does not hydrolyze it to GDP, indicating that it is constitutively active.  In rat, Rnd1/Rho6 is highly expressed in the cerebral cortex and hippocampus during synapse formation, and plays a role in spine formation.  Rnd1/Rho6 is also expressed in the liver and in endothelial cells, and is upregulated in uterine myometrial cells during pregnancy.  Like Rnd3/RhoE/Rho8, Rnd1/Rho6 is believed to function as an antagonist to RhoA.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=97.89  E-value=6.5e-05  Score=81.81  Aligned_cols=26  Identities=23%  Similarity=0.503  Sum_probs=23.3

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .-+|+++|+.++||||++..+++-.|
T Consensus        13 ~~KIvvvGd~~VGKTsLi~r~~~~~F   38 (232)
T cd04174          13 RCKLVLVGDVQCGKTAMLQVLAKDCY   38 (232)
T ss_pred             eEEEEEECCCCCcHHHHHHHHhcCCC
Confidence            35899999999999999999988776


No 215
>TIGR01394 TypA_BipA GTP-binding protein TypA/BipA. This bacterial (and Arabidopsis) protein, termed TypA or BipA, a GTP-binding protein, is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways, but the precise function is unknown.
Probab=97.88  E-value=6.4e-05  Score=92.28  Aligned_cols=21  Identities=19%  Similarity=0.575  Sum_probs=19.3

Q ss_pred             ceEEeCcCCCChhhHHhhhcC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVG  105 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G  105 (1036)
                      -|+++|..++|||||+++|..
T Consensus         3 NIaIiGHvd~GKTTLv~~LL~   23 (594)
T TIGR01394         3 NIAIIAHVDHGKTTLVDALLK   23 (594)
T ss_pred             EEEEEcCCCCCHHHHHHHHHH
Confidence            389999999999999999975


No 216
>KOG1489|consensus
Probab=97.88  E-value=8.8e-05  Score=82.13  Aligned_cols=51  Identities=27%  Similarity=0.326  Sum_probs=36.9

Q ss_pred             ceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhh
Q psy5059         381 RTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKE  460 (1036)
Q Consensus       381 rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~  460 (1036)
                      +.++|.||+|+.+..                          +.+-+.+..++++.   -++-+||+++....+++...++
T Consensus       314 p~liVaNKiD~~eae--------------------------~~~l~~L~~~lq~~---~V~pvsA~~~egl~~ll~~lr~  364 (366)
T KOG1489|consen  314 PALIVANKIDLPEAE--------------------------KNLLSSLAKRLQNP---HVVPVSAKSGEGLEELLNGLRE  364 (366)
T ss_pred             ceEEEEeccCchhHH--------------------------HHHHHHHHHHcCCC---cEEEeeeccccchHHHHHHHhh
Confidence            478999999997432                          33445666777666   5677899999888888776554


No 217
>TIGR00484 EF-G translation elongation factor EF-G. After peptide bond formation, this elongation factor of bacteria and organelles catalyzes the translocation of the tRNA-mRNA complex, with its attached nascent polypeptide chain, from the A-site to the P-site of the ribosome. Every completed bacterial genome has at least one copy, but some species have additional EF-G-like proteins. The closest homolog to canonical (e.g. E. coli) EF-G in the spirochetes clusters as if it is derived from mitochondrial forms, while a more distant second copy is also present. Synechocystis PCC6803 has a few proteins more closely related to EF-G than to any other characterized protein. Two of these resemble E. coli EF-G more closely than does the best match from the spirochetes; it may be that both function as authentic EF-G.
Probab=97.87  E-value=0.0001  Score=92.36  Aligned_cols=35  Identities=9%  Similarity=-0.102  Sum_probs=27.8

Q ss_pred             HHhhccCCCcceeeeecccchhhhHHHHHHhhhcC
Q psy5059         428 VLHYISNPNSIILAVVTANTDMATSESLKLAKETD  462 (1036)
Q Consensus       428 v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd  462 (1036)
                      +...+......|+.+.||.++..++.+++.....-
T Consensus       244 l~~~~~~~~~~PV~~gSa~~~~Gv~~LLd~I~~~l  278 (689)
T TIGR00484       244 IRKGVLNCEFFPVLCGSAFKNKGVQLLLDAVVDYL  278 (689)
T ss_pred             HHHHHhcCCEEEEEeccccCCccHHHHHHHHHHHC
Confidence            44444556788999999999999999999986653


No 218
>cd01875 RhoG RhoG subfamily.  RhoG is a GTPase with high sequence similarity to members of the Rac subfamily, including the regions involved in effector recognition and binding.  However, RhoG does not bind to known Rac1 and Cdc42 effectors, including proteins containing a Cdc42/Rac interacting binding (CRIB) motif.  Instead, RhoG interacts directly with Elmo, an upstream regulator of Rac1, in a GTP-dependent manner and forms a ternary complex with Dock180 to induce activation of Rac1.  The RhoG-Elmo-Dock180 pathway is required for activation of Rac1 and cell spreading mediated by integrin, as well as for neurite outgrowth induced by nerve growth factor.  Thus RhoG activates Rac1 through Elmo and Dock180 to control cell morphology.  RhoG has also been shown to play a role in caveolar trafficking and has a novel role in signaling the neutrophil respiratory burst stimulated by G protein-coupled receptor (GPCR) agonists.  Most Rho proteins contain a lipid modification site at the C-termin
Probab=97.85  E-value=0.00024  Score=74.67  Aligned_cols=25  Identities=28%  Similarity=0.466  Sum_probs=22.4

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -+|+++|+.++||||++..+..-.|
T Consensus         4 ~ki~~vG~~~vGKTsli~~~~~~~f   28 (191)
T cd01875           4 IKCVVVGDGAVGKTCLLICYTTNAF   28 (191)
T ss_pred             EEEEEECCCCCCHHHHHHHHHhCCC
Confidence            4799999999999999999987665


No 219
>cd04131 Rnd Rnd subfamily.  The Rnd subfamily contains Rnd1/Rho6, Rnd2/Rho7, and Rnd3/RhoE/Rho8.  These novel Rho family proteins have substantial structural differences compared to other Rho members, including N- and C-terminal extensions relative to other Rhos.  Rnd3/RhoE is farnesylated at the C-terminal prenylation site, unlike most other Rho proteins that are geranylgeranylated.  In addition, Rnd members are unable to hydrolyze GTP and are resistant to GAP activity.  They are believed to exist only in the GTP-bound conformation, and are antagonists of RhoA activity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=97.85  E-value=0.00019  Score=74.82  Aligned_cols=24  Identities=29%  Similarity=0.632  Sum_probs=22.2

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++.++.+-.|
T Consensus         3 Kiv~vG~~~vGKTsli~~~~~~~f   26 (178)
T cd04131           3 KIVVVGDVQCGKTALLQVFAKDCY   26 (178)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCcC
Confidence            699999999999999999998775


No 220
>PF02421 FeoB_N:  Ferrous iron transport protein B;  InterPro: IPR011619  Escherichia coli has an iron(II) transport system (feo) which may make an important contribution to the iron supply of the cell under anaerobic conditions. FeoB has been identified as part of this transport system and may play a role in the transport of ferrous iron. FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent [].; GO: 0005525 GTP binding, 0015093 ferrous iron transmembrane transporter activity, 0015684 ferrous iron transport, 0016021 integral to membrane; PDB: 3TAH_B 3B1X_A 3SS8_A 3B1W_C 3B1V_A 3LX5_A 3B1Y_A 3LX8_A 3B1Z_A 3K53_B ....
Probab=97.84  E-value=2.2e-05  Score=80.25  Aligned_cols=23  Identities=35%  Similarity=0.670  Sum_probs=21.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .||+||+||||||||||+|.|..
T Consensus         2 ~ialvG~PNvGKStLfN~Ltg~~   24 (156)
T PF02421_consen    2 RIALVGNPNVGKSTLFNALTGAK   24 (156)
T ss_dssp             EEEEEESTTSSHHHHHHHHHTTS
T ss_pred             EEEEECCCCCCHHHHHHHHHCCC
Confidence            58999999999999999999954


No 221
>cd04105 SR_beta Signal recognition particle receptor, beta subunit (SR-beta).  SR-beta and SR-alpha form the heterodimeric signal recognition particle (SRP or SR) receptor that binds SRP to regulate protein translocation across the ER membrane.  Nascent polypeptide chains are synthesized with an N-terminal hydrophobic signal sequence that binds SRP54, a component of the SRP.  SRP directs targeting of the ribosome-nascent chain complex (RNC) to the ER membrane via interaction with the SR, which is localized to the ER membrane.  The RNC is then transferred to the protein-conducting channel, or translocon, which facilitates polypeptide translation across the ER membrane or integration into the ER membrane.  SR-beta is found only in eukaryotes; it is believed to control the release of the signal sequence from SRP54 upon binding of the ribosome to the translocon.  High expression of SR-beta has been observed in human colon cancer, suggesting it may play a role in the development of this typ
Probab=97.84  E-value=0.00018  Score=76.72  Aligned_cols=25  Identities=24%  Similarity=0.639  Sum_probs=22.9

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      |.|+++|..+||||||+..|.+..|
T Consensus         1 ~~vll~G~~~sGKTsL~~~l~~~~~   25 (203)
T cd04105           1 PTVLLLGPSDSGKTALFTKLTTGKY   25 (203)
T ss_pred             CeEEEEcCCCCCHHHHHHHHhcCCC
Confidence            7899999999999999999988764


No 222
>PRK00741 prfC peptide chain release factor 3; Provisional
Probab=97.84  E-value=0.00017  Score=87.37  Aligned_cols=94  Identities=14%  Similarity=0.117  Sum_probs=58.9

Q ss_pred             HHhhhccccCCceEEEEecccccCCCch-----hhhhhcCccccccccc------ccccc--------------------
Q psy5059         370 KLAKETDVDGRRTLAVVTKIDLMDAGTD-----AIDILCGRVIPVKLDV------DGRRT--------------------  418 (1036)
Q Consensus       370 ~la~~~d~~g~rti~VitK~Dl~~~g~~-----~~~~l~~~~~~~~~~~------~~~~~--------------------  418 (1036)
                      ++.+.+...|.+.|.|+||+|+......     ..+.|.-+++|+.+++      .|+.+                    
T Consensus       122 ~l~~~~~~~~iPiiv~iNK~D~~~a~~~~~l~~i~~~l~~~~~p~~~Pig~~~~f~Gvvdl~~~~~~~~~~~~~~~~~~~  201 (526)
T PRK00741        122 KLMEVCRLRDTPIFTFINKLDRDGREPLELLDEIEEVLGIACAPITWPIGMGKRFKGVYDLYNDEVELYQPGEGHTIQEV  201 (526)
T ss_pred             HHHHHHHhcCCCEEEEEECCcccccCHHHHHHHHHHHhCCCCeeEEeccccCCceeEEEEeecceeeecccCCCCcceee
Confidence            3445555678999999999998765532     1244555677776532      11110                    


Q ss_pred             ---------hHH--------HHHHHHH-----------HhhccCCCcceeeeecccchhhhHHHHHHhhhcCc
Q psy5059         419 ---------YIE--------AQIKQLV-----------LHYISNPNSIILAVVTANTDMATSESLKLAKETDV  463 (1036)
Q Consensus       419 ---------~~~--------~~l~~~v-----------~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd~  463 (1036)
                               .+.        +++.+.+           ...+..-.-.|+.+.||+++..++.+++.....-|
T Consensus       202 e~~~~~dd~lle~~l~~~~~~~l~~~lel~~~~~~~~~~~~~~~~~~~PV~~GSA~~n~Gv~~LLd~i~~~~P  274 (526)
T PRK00741        202 EIIKGLDNPELDELLGEDLAEQLREELELVQGASNEFDLEAFLAGELTPVFFGSALNNFGVQEFLDAFVEWAP  274 (526)
T ss_pred             eeccCCCHHHHHHHhcccHHHHHHHHHHhhhhcccchhHHHHhcCCeEEEEEeecccCcCHHHHHHHHHHHCC
Confidence                     011        1111122           33444556789999999999999999999877744


No 223
>PRK09435 membrane ATPase/protein kinase; Provisional
Probab=97.84  E-value=0.00013  Score=83.40  Aligned_cols=57  Identities=12%  Similarity=-0.011  Sum_probs=40.7

Q ss_pred             EEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCC-----Cc-ceeeeecccchhhhHHHHH
Q psy5059         383 LAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNP-----NS-IILAVVTANTDMATSESLK  456 (1036)
Q Consensus       383 i~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~-----~~-ipla~ISA~td~~~qeil~  456 (1036)
                      |.|+||||+..... +                       +.....+...+...     .| .|++.+||+++.++.++++
T Consensus       198 IiVVNKaDl~~~~~-a-----------------------~~~~~el~~~L~l~~~~~~~w~~pVi~vSA~~g~GIdeL~~  253 (332)
T PRK09435        198 LIVINKADGDNKTA-A-----------------------RRAAAEYRSALRLLRPKDPGWQPPVLTCSALEGEGIDEIWQ  253 (332)
T ss_pred             eEEeehhcccchhH-H-----------------------HHHHHHHHHHHhcccccccCCCCCEEEEECCCCCCHHHHHH
Confidence            89999999986531 1                       23334455555443     35 7899999999999999998


Q ss_pred             HhhhcCc
Q psy5059         457 LAKETDV  463 (1036)
Q Consensus       457 la~~vd~  463 (1036)
                      ...+..+
T Consensus       254 ~I~~~~~  260 (332)
T PRK09435        254 AIEDHRA  260 (332)
T ss_pred             HHHHHHH
Confidence            8766533


No 224
>PRK10218 GTP-binding protein; Provisional
Probab=97.84  E-value=6e-05  Score=92.53  Aligned_cols=24  Identities=21%  Similarity=0.555  Sum_probs=21.4

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCC
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      +-.|+++|..++|||||+++|.+.
T Consensus         5 iRnIaIiGh~d~GKTTLv~~Ll~~   28 (607)
T PRK10218          5 LRNIAIIAHVDHGKTTLVDKLLQQ   28 (607)
T ss_pred             ceEEEEECCCCCcHHHHHHHHHHh
Confidence            457999999999999999999863


No 225
>TIGR03680 eif2g_arch translation initiation factor 2 subunit gamma. eIF-2 functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA.
Probab=97.82  E-value=0.00011  Score=86.49  Aligned_cols=58  Identities=14%  Similarity=0.183  Sum_probs=38.1

Q ss_pred             CceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhcc--CCCcceeeeecccchhhhHHHHHH
Q psy5059         380 RRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYIS--NPNSIILAVVTANTDMATSESLKL  457 (1036)
Q Consensus       380 ~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~--~~~~ipla~ISA~td~~~qeil~l  457 (1036)
                      ++.|.|+||+|+.+.....                       .. ...+...+.  .....++..+||+++.+..++++.
T Consensus       135 ~~iIVvvNK~Dl~~~~~~~-----------------------~~-~~~i~~~l~~~~~~~~~ii~vSA~~g~gi~~L~e~  190 (406)
T TIGR03680       135 KNIVIVQNKIDLVSKEKAL-----------------------EN-YEEIKEFVKGTVAENAPIIPVSALHNANIDALLEA  190 (406)
T ss_pred             CeEEEEEEccccCCHHHHH-----------------------HH-HHHHHhhhhhcccCCCeEEEEECCCCCChHHHHHH
Confidence            4689999999998642111                       11 112222222  123568889999999999999988


Q ss_pred             hhhc
Q psy5059         458 AKET  461 (1036)
Q Consensus       458 a~~v  461 (1036)
                      ....
T Consensus       191 L~~~  194 (406)
T TIGR03680       191 IEKF  194 (406)
T ss_pred             HHHh
Confidence            8764


No 226
>PTZ00141 elongation factor 1- alpha; Provisional
Probab=97.81  E-value=9.6e-05  Score=87.96  Aligned_cols=60  Identities=13%  Similarity=0.112  Sum_probs=38.1

Q ss_pred             HhhhccccCCc-eEEEEecccccCCCc--hhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCC----cceeeee
Q psy5059         371 LAKETDVDGRR-TLAVVTKIDLMDAGT--DAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPN----SIILAVV  443 (1036)
Q Consensus       371 la~~~d~~g~r-ti~VitK~Dl~~~g~--~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~----~ipla~I  443 (1036)
                      .+..++..|.+ .|.|+||+|+...++  +..                      +.+.+.+..++....    .+|++-+
T Consensus       136 h~~~~~~~gi~~iiv~vNKmD~~~~~~~~~~~----------------------~~i~~~i~~~l~~~g~~~~~~~~ipi  193 (446)
T PTZ00141        136 HALLAFTLGVKQMIVCINKMDDKTVNYSQERY----------------------DEIKKEVSAYLKKVGYNPEKVPFIPI  193 (446)
T ss_pred             HHHHHHHcCCCeEEEEEEccccccchhhHHHH----------------------HHHHHHHHHHHHhcCCCcccceEEEe
Confidence            44455566865 578999999542221  111                      344555666665443    3889999


Q ss_pred             cccchhhhH
Q psy5059         444 TANTDMATS  452 (1036)
Q Consensus       444 SA~td~~~q  452 (1036)
                      ||.+|.+..
T Consensus       194 Sa~~g~ni~  202 (446)
T PTZ00141        194 SGWQGDNMI  202 (446)
T ss_pred             ecccCCCcc
Confidence            999998764


No 227
>PRK04000 translation initiation factor IF-2 subunit gamma; Validated
Probab=97.79  E-value=0.00018  Score=84.80  Aligned_cols=58  Identities=14%  Similarity=0.200  Sum_probs=38.5

Q ss_pred             CceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhcc--CCCcceeeeecccchhhhHHHHHH
Q psy5059         380 RRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYIS--NPNSIILAVVTANTDMATSESLKL  457 (1036)
Q Consensus       380 ~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~--~~~~ipla~ISA~td~~~qeil~l  457 (1036)
                      .+.|.|+||+|+.+....                        ....+.+...+.  .....++..+||+++.+..++++.
T Consensus       140 ~~iiVVlNK~Dl~~~~~~------------------------~~~~~~i~~~l~~~~~~~~~ii~vSA~~g~gI~~L~~~  195 (411)
T PRK04000        140 KNIVIVQNKIDLVSKERA------------------------LENYEQIKEFVKGTVAENAPIIPVSALHKVNIDALIEA  195 (411)
T ss_pred             CcEEEEEEeeccccchhH------------------------HHHHHHHHHHhccccCCCCeEEEEECCCCcCHHHHHHH
Confidence            358999999999864221                        111122233332  234578889999999999999988


Q ss_pred             hhhc
Q psy5059         458 AKET  461 (1036)
Q Consensus       458 a~~v  461 (1036)
                      ....
T Consensus       196 L~~~  199 (411)
T PRK04000        196 IEEE  199 (411)
T ss_pred             HHHh
Confidence            7664


No 228
>cd04167 Snu114p Snu114p subfamily.  Snu114p is one of several proteins that make up the U5 small nuclear ribonucleoprotein (snRNP) particle.  U5 is a component of the spliceosome, which catalyzes the splicing of pre-mRNA to remove introns.  Snu114p is homologous to EF-2, but typically contains an additional N-terminal domain not found in Ef-2.  This protein is part of the GTP translation factor family and the Ras superfamily, characterized by five G-box motifs.
Probab=97.78  E-value=9.7e-05  Score=79.08  Aligned_cols=24  Identities=21%  Similarity=0.556  Sum_probs=21.4

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .|+++|..++|||||+++|++..+
T Consensus         2 nv~iiG~~~~GKTtL~~~l~~~~~   25 (213)
T cd04167           2 NVAIAGHLHHGKTSLLDMLIEQTH   25 (213)
T ss_pred             cEEEEcCCCCCHHHHHHHHHHhcC
Confidence            489999999999999999998663


No 229
>PRK13351 elongation factor G; Reviewed
Probab=97.76  E-value=0.00035  Score=87.71  Aligned_cols=30  Identities=7%  Similarity=-0.022  Sum_probs=25.1

Q ss_pred             cCCCcceeeeecccchhhhHHHHHHhhhcC
Q psy5059         433 SNPNSIILAVVTANTDMATSESLKLAKETD  462 (1036)
Q Consensus       433 ~~~~~ipla~ISA~td~~~qeil~la~~vd  462 (1036)
                      ..-.+.|+.+.||+++..++.+++.....-
T Consensus       248 ~~~~~~PV~~gSA~~~~Gv~~LLd~I~~~l  277 (687)
T PRK13351        248 RSGHLVPVLFGSALKNIGIEPLLDAVVDYL  277 (687)
T ss_pred             HhCCEEEEEecccCcCccHHHHHHHHHHHC
Confidence            344589999999999999999998876653


No 230
>COG2262 HflX GTPases [General function prediction only]
Probab=97.74  E-value=0.00037  Score=80.04  Aligned_cols=62  Identities=18%  Similarity=0.135  Sum_probs=44.0

Q ss_pred             HHHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccc
Q psy5059         368 SLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANT  447 (1036)
Q Consensus       368 ~~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~t  447 (1036)
                      +..+-.++.-...++|.|+||+|++.... .                              ...+....+ ..++|||++
T Consensus       293 v~~vL~el~~~~~p~i~v~NKiD~~~~~~-~------------------------------~~~~~~~~~-~~v~iSA~~  340 (411)
T COG2262         293 VEDVLAEIGADEIPIILVLNKIDLLEDEE-I------------------------------LAELERGSP-NPVFISAKT  340 (411)
T ss_pred             HHHHHHHcCCCCCCEEEEEecccccCchh-h------------------------------hhhhhhcCC-CeEEEEecc
Confidence            35677888788899999999999987643 0                              011111112 578999999


Q ss_pred             hhhhHHHHHHhhhc
Q psy5059         448 DMATSESLKLAKET  461 (1036)
Q Consensus       448 d~~~qeil~la~~v  461 (1036)
                      +.+...+.+...+.
T Consensus       341 ~~gl~~L~~~i~~~  354 (411)
T COG2262         341 GEGLDLLRERIIEL  354 (411)
T ss_pred             CcCHHHHHHHHHHH
Confidence            99998888776554


No 231
>KOG0094|consensus
Probab=97.68  E-value=0.00032  Score=72.89  Aligned_cols=63  Identities=14%  Similarity=0.015  Sum_probs=40.6

Q ss_pred             hccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHH
Q psy5059         374 ETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSE  453 (1036)
Q Consensus       374 ~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qe  453 (1036)
                      +=++++...+.|.||.||.++.                           ++..+-..+......+...-+||+.|.++.+
T Consensus       123 e~gs~~viI~LVGnKtDL~dkr---------------------------qvs~eEg~~kAkel~a~f~etsak~g~NVk~  175 (221)
T KOG0094|consen  123 ERGSDDVIIFLVGNKTDLSDKR---------------------------QVSIEEGERKAKELNAEFIETSAKAGENVKQ  175 (221)
T ss_pred             ccCCCceEEEEEcccccccchh---------------------------hhhHHHHHHHHHHhCcEEEEecccCCCCHHH
Confidence            3344556667788999999873                           2222222233333444666789999999999


Q ss_pred             HHHHhhhcCc
Q psy5059         454 SLKLAKETDV  463 (1036)
Q Consensus       454 il~la~~vd~  463 (1036)
                      +|.-+...-+
T Consensus       176 lFrrIaa~l~  185 (221)
T KOG0094|consen  176 LFRRIAAALP  185 (221)
T ss_pred             HHHHHHHhcc
Confidence            9877555433


No 232
>cd01885 EF2 EF2 (for archaea and eukarya).  Translocation requires hydrolysis of a molecule of GTP and is mediated by EF-G in bacteria and by eEF2 in eukaryotes.  The eukaryotic elongation factor eEF2 is a GTPase involved in the translocation of the peptidyl-tRNA from the A site to the P site on the ribosome.  The 95-kDa protein is highly conserved, with 60% amino acid sequence identity between the human and yeast proteins.  Two major mechanisms are known to regulate protein elongation and both involve eEF2.  First, eEF2 can be modulated by reversible phosphorylation.  Increased levels of phosphorylated eEF2 reduce elongation rates presumably because phosphorylated eEF2 fails to bind the ribosomes.  Treatment of mammalian cells with agents that raise the cytoplasmic Ca2+ and cAMP levels reduce elongation rates by activating the kinase responsible for phosphorylating eEF2.  In contrast, treatment of cells with insulin increases elongation rates by promoting eEF2 dephosphorylation.  Seco
Probab=97.68  E-value=0.00027  Score=76.46  Aligned_cols=21  Identities=24%  Similarity=0.529  Sum_probs=19.3

Q ss_pred             eEEeCcCCCChhhHHhhhcCC
Q psy5059          86 IVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        86 IvVvG~QSsGKSSlLEal~G~  106 (1036)
                      |+++|.-.+|||||+++|+..
T Consensus         3 vaiiGhvd~GKTTL~d~Ll~~   23 (222)
T cd01885           3 ICIIAHVDHGKTTLSDSLLAS   23 (222)
T ss_pred             EEEECCCCCCHHHHHHHHHHH
Confidence            799999999999999999754


No 233
>cd04133 Rop_like Rop subfamily.  The Rop (Rho-related protein from plants) subfamily plays a role in diverse cellular processes, including cytoskeletal organization, pollen and vegetative cell growth, hormone responses, stress responses, and pathogen resistance.  Rops are able to regulate several downstream pathways to amplify a specific signal by acting as master switches early in the signaling cascade.  They transmit a variety of extracellular and intracellular signals.  Rops are involved in establishing cell polarity in root-hair development, root-hair elongation, pollen-tube growth, cell-shape formation, responses to hormones such as abscisic acid (ABA) and auxin, responses to abiotic stresses such as oxygen deprivation, and disease resistance and disease susceptibility.  An individual Rop can have a unique function or an overlapping function shared with other Rop proteins; in addition, a given Rop-regulated function can be controlled by one or multiple Rop proteins.  For example, 
Probab=97.65  E-value=0.00027  Score=73.66  Aligned_cols=24  Identities=25%  Similarity=0.479  Sum_probs=21.7

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++..+..-.|
T Consensus         3 kivv~G~~~vGKTsli~~~~~~~f   26 (176)
T cd04133           3 KCVTVGDGAVGKTCMLICYTSNKF   26 (176)
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCC
Confidence            689999999999999999987665


No 234
>KOG0448|consensus
Probab=97.65  E-value=0.00021  Score=85.84  Aligned_cols=42  Identities=36%  Similarity=0.578  Sum_probs=38.6

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEE
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQ  124 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~  124 (1036)
                      --++++.|+-|+|||+|++|+.-.+.||-|.|.||-|=+++.
T Consensus       109 ~mKV~ifGrts~GKSt~iNAmL~~klLP~g~gh~TncF~~Ve  150 (749)
T KOG0448|consen  109 HMKVAIFGRTSAGKSTVINAMLHKKLLPSGIGHTTNCFLEVE  150 (749)
T ss_pred             ccEEEEeCCCCCcHHHHHHHHHHHhhCcccccccceeeeeec
Confidence            468999999999999999999999999999999998877654


No 235
>smart00176 RAN Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran is involved in the active transport of proteins through nuclear pores.
Probab=97.62  E-value=0.00019  Score=76.45  Aligned_cols=37  Identities=14%  Similarity=0.149  Sum_probs=26.3

Q ss_pred             cccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccc
Q psy5059         240 VLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTAN  289 (1036)
Q Consensus       240 ~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An  289 (1036)
                      ...|.|.|+||--             ..+.|...|.+..+++|++....+
T Consensus        43 ~~~l~iwDt~G~e-------------~~~~l~~~~~~~ad~~ilV~D~t~   79 (200)
T smart00176       43 PIRFNVWDTAGQE-------------KFGGLRDGYYIQGQCAIIMFDVTA   79 (200)
T ss_pred             EEEEEEEECCCch-------------hhhhhhHHHhcCCCEEEEEEECCC
Confidence            3567889999942             245677789999998777765433


No 236
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=97.61  E-value=7.1e-05  Score=76.13  Aligned_cols=23  Identities=35%  Similarity=0.537  Sum_probs=21.1

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .|+++|.+|+|||||+++|.|..
T Consensus       104 ~v~~~G~~nvGKStliN~l~~~~  126 (157)
T cd01858         104 SVGFIGYPNVGKSSIINTLRSKK  126 (157)
T ss_pred             EEEEEeCCCCChHHHHHHHhcCC
Confidence            57899999999999999999876


No 237
>PRK12740 elongation factor G; Reviewed
Probab=97.59  E-value=0.0005  Score=86.07  Aligned_cols=34  Identities=6%  Similarity=-0.127  Sum_probs=27.1

Q ss_pred             HhhccCCCcceeeeecccchhhhHHHHHHhhhcC
Q psy5059         429 LHYISNPNSIILAVVTANTDMATSESLKLAKETD  462 (1036)
Q Consensus       429 ~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd  462 (1036)
                      ...+..-.+.|+.+.||.++..++.+++.....-
T Consensus       228 ~~~~~~~~~~Pv~~gSA~~~~Gv~~LLd~i~~~l  261 (668)
T PRK12740        228 RKATLAGEIVPVFCGSALKNKGVQRLLDAVVDYL  261 (668)
T ss_pred             HHHHHcCCEEEEEeccccCCccHHHHHHHHHHHC
Confidence            3334455789999999999999999998876653


No 238
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=97.57  E-value=0.0011  Score=70.61  Aligned_cols=25  Identities=40%  Similarity=0.735  Sum_probs=23.2

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      =+|+|+|+.|+||||++.++.+..|
T Consensus         6 ~kivv~G~~g~GKTtl~~~l~~~~~   30 (219)
T COG1100           6 FKIVVLGDGGVGKTTLLNRLVGDEF   30 (219)
T ss_pred             EEEEEEcCCCccHHHHHHHHhcCcC
Confidence            3799999999999999999999886


No 239
>PF00071 Ras:  Ras family;  InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....
Probab=97.56  E-value=0.00064  Score=68.53  Aligned_cols=24  Identities=46%  Similarity=0.771  Sum_probs=22.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|+.++||||++..+.+..|
T Consensus         1 Ki~vvG~~~vGKtsl~~~~~~~~~   24 (162)
T PF00071_consen    1 KIVVVGDSGVGKTSLINRLINGEF   24 (162)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHSST
T ss_pred             CEEEECCCCCCHHHHHHHHHhhcc
Confidence            589999999999999999988775


No 240
>PTZ00327 eukaryotic translation initiation factor 2 gamma subunit; Provisional
Probab=97.55  E-value=0.00066  Score=80.96  Aligned_cols=57  Identities=11%  Similarity=0.189  Sum_probs=39.0

Q ss_pred             CceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhcc--CCCcceeeeecccchhhhHHHHHH
Q psy5059         380 RRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYIS--NPNSIILAVVTANTDMATSESLKL  457 (1036)
Q Consensus       380 ~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~--~~~~ipla~ISA~td~~~qeil~l  457 (1036)
                      ++.|.|+||+|+.+...-                        ......+..+++  +....+++.+||+++.+...+++.
T Consensus       172 ~~iIVvlNKiDlv~~~~~------------------------~~~~~ei~~~l~~~~~~~~~iipVSA~~G~nI~~Ll~~  227 (460)
T PTZ00327        172 KHIIILQNKIDLVKEAQA------------------------QDQYEEIRNFVKGTIADNAPIIPISAQLKYNIDVVLEY  227 (460)
T ss_pred             CcEEEEEecccccCHHHH------------------------HHHHHHHHHHHHhhccCCCeEEEeeCCCCCCHHHHHHH
Confidence            467899999999863211                        112223333332  246789999999999999999988


Q ss_pred             hhh
Q psy5059         458 AKE  460 (1036)
Q Consensus       458 a~~  460 (1036)
                      ..+
T Consensus       228 L~~  230 (460)
T PTZ00327        228 ICT  230 (460)
T ss_pred             HHh
Confidence            874


No 241
>PF00025 Arf:  ADP-ribosylation factor family The prints entry specific to Sar1 proteins The Prosite entry specific to Sar1 proteins;  InterPro: IPR006689 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain.  This entry represents a branch of the small GTPase superfamily that includes the ADP ribosylation factor Arf, Arl (Arf-like), Arp (Arf-related proteins) and the remotely related Sar (Secretion-associated and Ras-related) proteins. Arf proteins are major regulators of vesicle biogenesis in intracellular traffic []. They cycle between inactive GDP-bound and active GTP-bound forms that bind selectively to effectors. The classical structural GDP/GTP switch is characterised by conformational changes at the so-called switch 1 and switch 2 regions, which bind tightly to the gamma-phosphate of GTP but poorly or not at all to the GDP nucleotide. Structural studies of Arf1 and Arf6 have revealed that although these proteins feature the switch 1 and 2 conformational changes, they depart from other small GTP-binding proteins in that they use an additional, unique switch to propagate structural information from one side of the protein to the other.   The GDP/GTP structural cycles of human Arf1 and Arf6 feature a unique conformational change that affects the beta2-beta3 strands connecting switch 1 and switch 2 (interswitch) and also the amphipathic helical N terminus. In GDP-bound Arf1 and Arf6, the interswitch is retracted and forms a pocket to which the N-terminal helix binds, the latter serving as a molecular hasp to maintain the inactive conformation. In the GTP-bound form of these proteins, the interswitch undergoes a two-residue register shift that pulls switch 1 and switch 2 up, restoring an active conformation that can bind GTP. In this conformation, the interswitch projects out of the protein and extrudes the N-terminal hasp by occluding its binding pocket.; GO: 0005525 GTP binding; PDB: 2H57_B 2W83_B 3N5C_B 2J5X_A 3LVR_E 2BAO_A 3LVQ_E 2A5F_A 3PCR_B 1E0S_A ....
Probab=97.55  E-value=0.00024  Score=73.78  Aligned_cols=58  Identities=24%  Similarity=0.286  Sum_probs=40.3

Q ss_pred             ccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHH-HhhccCCCcceeeeecccchhhhHHHH
Q psy5059         377 VDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLV-LHYISNPNSIILAVVTANTDMATSESL  455 (1036)
Q Consensus       377 ~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v-~~~i~~~~~ipla~ISA~td~~~qeil  455 (1036)
                      -.+.+.++++||-|+.+.-..                        .++...+ .+.+.+-....+.-+||.+|.++.+.+
T Consensus       113 ~~~~piLIl~NK~D~~~~~~~------------------------~~i~~~l~l~~l~~~~~~~v~~~sa~~g~Gv~e~l  168 (175)
T PF00025_consen  113 LKDIPILILANKQDLPDAMSE------------------------EEIKEYLGLEKLKNKRPWSVFSCSAKTGEGVDEGL  168 (175)
T ss_dssp             GTTSEEEEEEESTTSTTSSTH------------------------HHHHHHTTGGGTTSSSCEEEEEEBTTTTBTHHHHH
T ss_pred             cccceEEEEeccccccCcchh------------------------hHHHhhhhhhhcccCCceEEEeeeccCCcCHHHHH
Confidence            357899999999998765332                        2233322 344454566677789999999999988


Q ss_pred             HHh
Q psy5059         456 KLA  458 (1036)
Q Consensus       456 ~la  458 (1036)
                      +..
T Consensus       169 ~WL  171 (175)
T PF00025_consen  169 EWL  171 (175)
T ss_dssp             HHH
T ss_pred             HHH
Confidence            764


No 242
>COG4917 EutP Ethanolamine utilization protein [Amino acid transport and metabolism]
Probab=97.53  E-value=0.00024  Score=68.92  Aligned_cols=28  Identities=32%  Similarity=0.540  Sum_probs=24.7

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCcCccc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSFLPRG  112 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~flPrg  112 (1036)
                      +|++||.-++||++|.++|-|...+|+.
T Consensus         3 ri~~vG~~gcGKTtL~q~L~G~~~lykK   30 (148)
T COG4917           3 RIAFVGQVGCGKTTLFQSLYGNDTLYKK   30 (148)
T ss_pred             eeEEecccccCchhHHHHhhcchhhhcc
Confidence            6899999999999999999998865543


No 243
>PF05049 IIGP:  Interferon-inducible GTPase (IIGP);  InterPro: IPR007743 Interferon-inducible GTPase (IIGP) is thought to play a role in in intracellular defence. IIGP is predominantly associated with the Golgi apparatus and also localizes to the endoplasmic reticulum and exerts a distinct role in IFN-induced intracellular membrane trafficking or processing [].; GO: 0005525 GTP binding, 0016817 hydrolase activity, acting on acid anhydrides, 0016020 membrane; PDB: 1TPZ_A 1TQD_A 1TQ6_A 1TQ2_B 1TQ4_A.
Probab=97.53  E-value=0.00013  Score=84.06  Aligned_cols=44  Identities=30%  Similarity=0.479  Sum_probs=29.3

Q ss_pred             hhHHHHHHHHHhhhhcCCCCCCCCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          61 TAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        61 ~~~~l~~kL~~~~~~~g~~~i~lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .+-+...++++.+......   --.|+|+|+.+|||||++|||-|..
T Consensus        16 ~~~~~~s~i~~~l~~~~~~---~l~IaV~G~sGsGKSSfINalrGl~   59 (376)
T PF05049_consen   16 NLQEVVSKIREALKDIDNA---PLNIAVTGESGSGKSSFINALRGLG   59 (376)
T ss_dssp             -HHHHHHHHHHHHHHHHH-----EEEEEEESTTSSHHHHHHHHTT--
T ss_pred             CHHHHHHHHHHHHHHhhcC---ceEEEEECCCCCCHHHHHHHHhCCC
Confidence            3445566666654433221   2279999999999999999998875


No 244
>COG0218 Predicted GTPase [General function prediction only]
Probab=97.52  E-value=7.8e-05  Score=78.32  Aligned_cols=36  Identities=33%  Similarity=0.477  Sum_probs=31.5

Q ss_pred             CCCeEEEeccCCCchHHHHHhhhcCCcccccCCccc
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVT   41 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~t   41 (1036)
                      ++|.||++||.||||||++|+|+|+.-|-|-+++|-
T Consensus        23 ~~~EIaF~GRSNVGKSSlIN~l~~~k~LArtSktPG   58 (200)
T COG0218          23 DLPEIAFAGRSNVGKSSLINALTNQKNLARTSKTPG   58 (200)
T ss_pred             CCcEEEEEccCcccHHHHHHHHhCCcceeecCCCCC
Confidence            689999999999999999999999776777766643


No 245
>cd01857 HSR1_MMR1 HSR1/MMR1.  Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.
Probab=97.43  E-value=0.00027  Score=70.69  Aligned_cols=60  Identities=30%  Similarity=0.279  Sum_probs=38.9

Q ss_pred             ccEEEeeccCCCchhhhhhhHHHHHHHHHhhhhcCC------CCCCCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          43 RPLILQLYYCPKDDREKRTAAAVINKLQDVFNTVGT------DAIQLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        43 rpl~l~l~~~~~~~~~~~~~~~l~~kL~~~~~~~g~------~~i~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++.+||+|-....  ......+.++    ..|.      ..-.-..++++|.+|+||||++++|.|..+
T Consensus        43 k~~iivlNK~DL~~~~--~~~~~~~~~~----~~~~~ii~iSa~~~~~~~~~~G~~~vGKstlin~l~~~~~  108 (141)
T cd01857          43 KKNILLLNKADLLTEE--QRKAWAEYFK----KEGIVVVFFSALKENATIGLVGYPNVGKSSLINALVGKKK  108 (141)
T ss_pred             CcEEEEEechhcCCHH--HHHHHHHHHH----hcCCeEEEEEecCCCcEEEEECCCCCCHHHHHHHHhCCCc
Confidence            4999999999863221  2222333333    2221      001123899999999999999999998763


No 246
>KOG2486|consensus
Probab=97.43  E-value=0.00044  Score=75.55  Aligned_cols=60  Identities=13%  Similarity=0.142  Sum_probs=46.6

Q ss_pred             HHHHHHHHhhhcCCCce--EEEEEecCccccchHHHHHhhhccccCCceEEEEecccccCCCc
Q psy5059         336 AQIKQLVLHYISNPNSI--ILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGT  396 (1036)
Q Consensus       336 ~~~~~~~~~y~~~~~~~--~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~Dl~~~g~  396 (1036)
                      +-|-++.+.|+.++.++  ++.+|++.....+-+ .-.|.++-..+.+.-.|+||+|.+-++-
T Consensus       204 ~d~~~~t~~Y~leR~nLv~~FLLvd~sv~i~~~D-~~~i~~~ge~~VP~t~vfTK~DK~k~~~  265 (320)
T KOG2486|consen  204 ADWDKFTKSYLLERENLVRVFLLVDASVPIQPTD-NPEIAWLGENNVPMTSVFTKCDKQKKVK  265 (320)
T ss_pred             chHhHhHHHHHHhhhhhheeeeeeeccCCCCCCC-hHHHHHHhhcCCCeEEeeehhhhhhhcc
Confidence            34677888999998887  777888877655555 3456778888999999999999987654


No 247
>COG0536 Obg Predicted GTPase [General function prediction only]
Probab=97.37  E-value=0.0015  Score=73.45  Aligned_cols=57  Identities=19%  Similarity=0.195  Sum_probs=37.5

Q ss_pred             CCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHh
Q psy5059         379 GRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLA  458 (1036)
Q Consensus       379 g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la  458 (1036)
                      .+..|.|+||+|+......                          ++...........|.+..+|||.++..++.++...
T Consensus       275 ~K~~ivv~NKiD~~~~~e~--------------------------~~~~~~~l~~~~~~~~~~~ISa~t~~g~~~L~~~~  328 (369)
T COG0536         275 EKPRIVVLNKIDLPLDEEE--------------------------LEELKKALAEALGWEVFYLISALTREGLDELLRAL  328 (369)
T ss_pred             cCceEEEEeccCCCcCHHH--------------------------HHHHHHHHHHhcCCCcceeeehhcccCHHHHHHHH
Confidence            4667899999996654322                          22222233334556655559999999999988776


Q ss_pred             hhc
Q psy5059         459 KET  461 (1036)
Q Consensus       459 ~~v  461 (1036)
                      .+.
T Consensus       329 ~~~  331 (369)
T COG0536         329 AEL  331 (369)
T ss_pred             HHH
Confidence            555


No 248
>cd04129 Rho2 Rho2 subfamily.  Rho2 is a fungal GTPase that plays a role in cell morphogenesis, control of cell wall integrity, control of growth polarity, and maintenance of growth direction.  Rho2 activates the protein kinase C homolog Pck2, and Pck2 controls Mok1, the major (1-3) alpha-D-glucan synthase.  Together with Rho1 (RhoA), Rho2 regulates the construction of the cell wall.  Unlike Rho1, Rho2 is not an essential protein, but its overexpression is lethal.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for proper intracellular localization via membrane attachment.  As with other Rho family GTPases, the GDP/GTP cycling is regulated by GEFs (guanine nucleotide exchange factors), GAPs (GTPase-activating proteins) and GDIs (guanine nucleotide dissociation inhibitors).
Probab=97.37  E-value=0.0013  Score=68.69  Aligned_cols=24  Identities=29%  Similarity=0.584  Sum_probs=21.1

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|+.++|||||+.++.+-.|
T Consensus         3 Ki~ivG~~g~GKStLl~~l~~~~~   26 (187)
T cd04129           3 KLVIVGDGACGKTSLLSVFTLGEF   26 (187)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            689999999999999999985553


No 249
>TIGR00073 hypB hydrogenase accessory protein HypB. HypB is implicated in insertion of nickel into the large subunit of NiFe hydrogenases.
Probab=97.32  E-value=0.0029  Score=67.54  Aligned_cols=57  Identities=18%  Similarity=0.163  Sum_probs=39.4

Q ss_pred             CCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHh
Q psy5059         379 GRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLA  458 (1036)
Q Consensus       379 g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la  458 (1036)
                      +...++|+||||+.+......                      +.+...+.+.   ....++..+||+++.++.++++.+
T Consensus       148 ~~a~iiv~NK~Dl~~~~~~~~----------------------~~~~~~l~~~---~~~~~i~~~Sa~~g~gv~~l~~~i  202 (207)
T TIGR00073       148 KEADLIVINKADLAEAVGFDV----------------------EKMKADAKKI---NPEAEIILMSLKTGEGLDEWLEFL  202 (207)
T ss_pred             hhCCEEEEEHHHccccchhhH----------------------HHHHHHHHHh---CCCCCEEEEECCCCCCHHHHHHHH
Confidence            455699999999986422211                      2333334332   245789999999999999999887


Q ss_pred             hh
Q psy5059         459 KE  460 (1036)
Q Consensus       459 ~~  460 (1036)
                      .+
T Consensus       203 ~~  204 (207)
T TIGR00073       203 EG  204 (207)
T ss_pred             HH
Confidence            54


No 250
>COG1159 Era GTPase [General function prediction only]
Probab=97.31  E-value=0.00035  Score=77.35  Aligned_cols=83  Identities=27%  Similarity=0.380  Sum_probs=54.6

Q ss_pred             eEEEeccCCCchHHHHHhhhc-----CCccc-----ccCCccccccEEEeeccCCCchhhhhhhHHHHHHHHHhhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVG-----KSFLP-----RGIGIVTRRPLILQLYYCPKDDREKRTAAAVINKLQDVFNTVGT   78 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g-----~~~~p-----r~~~~~trrpl~l~l~~~~~~~~~~~~~~~l~~kL~~~~~~~g~   78 (1036)
                      -|+|||+||||||||+|+|+|     ++-.|     +=.|+.|...--+.+.-+|+--...+.+...+++.-.  .++  
T Consensus         8 fVaIiGrPNvGKSTLlN~l~G~KisIvS~k~QTTR~~I~GI~t~~~~QiIfvDTPGih~pk~~l~~~m~~~a~--~sl--   83 (298)
T COG1159           8 FVAIIGRPNVGKSTLLNALVGQKISIVSPKPQTTRNRIRGIVTTDNAQIIFVDTPGIHKPKHALGELMNKAAR--SAL--   83 (298)
T ss_pred             EEEEEcCCCCcHHHHHHHHhcCceEeecCCcchhhhheeEEEEcCCceEEEEeCCCCCCcchHHHHHHHHHHH--HHh--
Confidence            489999999999999999999     44334     2356666666666666667644556667776665543  222  


Q ss_pred             CCCCCCceEEeCcCCCC
Q psy5059          79 DAIQLPQIVVVGTQSSG   95 (1036)
Q Consensus        79 ~~i~lPqIvVvG~QSsG   95 (1036)
                      .++++-=.+|=++++-|
T Consensus        84 ~dvDlilfvvd~~~~~~  100 (298)
T COG1159          84 KDVDLILFVVDADEGWG  100 (298)
T ss_pred             ccCcEEEEEEeccccCC
Confidence            34566556666655433


No 251
>TIGR00503 prfC peptide chain release factor 3. This translation releasing factor, RF-3 (prfC) was originally described as stop codon-independent, in contrast to peptide chain release factor 1 (RF-1, prfA) and RF-2 (prfB). RF-1 and RF-2 are closely related to each other, while RF-3 is similar to elongation factors EF-Tu and EF-G; RF-1 is active at UAA and UAG and RF-2 is active at UAA and UGA. More recently, RF-3 was shown to be active primarily at UGA stop codons in E. coli. All bacteria and organelles have RF-1. The Mycoplasmas and organelles, which translate UGA as Trp rather than as a stop codon, lack RF-2. RF-3, in contrast, seems to be rare among bacteria and is found so far only in Escherichia coli and some other gamma subdivision Proteobacteria, in Synechocystis PCC6803, and in Staphylococcus aureus.
Probab=97.30  E-value=0.0022  Score=77.86  Aligned_cols=32  Identities=9%  Similarity=-0.119  Sum_probs=26.7

Q ss_pred             ccCCCcceeeeecccchhhhHHHHHHhhhcCc
Q psy5059         432 ISNPNSIILAVVTANTDMATSESLKLAKETDV  463 (1036)
Q Consensus       432 i~~~~~ipla~ISA~td~~~qeil~la~~vd~  463 (1036)
                      +..-.-.|+.+.||+++..++.+++.....-|
T Consensus       244 ~~~~~~~PV~~GSA~~n~Gv~~LLd~i~~~~P  275 (527)
T TIGR00503       244 FHGGEMTPVFFGTALGNFGVDHFLDGLLQWAP  275 (527)
T ss_pred             HhcCCeeEEEEeecccCccHHHHHHHHHHHCC
Confidence            34556789999999999999999999877744


No 252
>KOG0078|consensus
Probab=97.29  E-value=0.0012  Score=69.60  Aligned_cols=65  Identities=18%  Similarity=0.137  Sum_probs=43.0

Q ss_pred             HhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhh
Q psy5059         371 LAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMA  450 (1036)
Q Consensus       371 la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~  450 (1036)
                      ..++.-+++...|.|.||+|+-++..-                           ..+--+.+..-.-++..-+||+++.+
T Consensus       109 ~I~e~a~~~v~~~LvGNK~D~~~~R~V---------------------------~~e~ge~lA~e~G~~F~EtSAk~~~N  161 (207)
T KOG0078|consen  109 NIDEHASDDVVKILVGNKCDLEEKRQV---------------------------SKERGEALAREYGIKFFETSAKTNFN  161 (207)
T ss_pred             HHHhhCCCCCcEEEeeccccccccccc---------------------------cHHHHHHHHHHhCCeEEEccccCCCC
Confidence            334445668889999999999874321                           11222233333356677899999999


Q ss_pred             hHHHH-HHhhhcC
Q psy5059         451 TSESL-KLAKETD  462 (1036)
Q Consensus       451 ~qeil-~la~~vd  462 (1036)
                      +.+.| .+|+++-
T Consensus       162 I~eaF~~La~~i~  174 (207)
T KOG0078|consen  162 IEEAFLSLARDIL  174 (207)
T ss_pred             HHHHHHHHHHHHH
Confidence            99985 6676664


No 253
>cd04103 Centaurin_gamma Centaurin gamma.  The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains.  Centaurin gamma contains an additional GTPase domain near its N-terminus.  The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism.  Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP.  Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments.  A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. 
Probab=97.29  E-value=0.0017  Score=66.24  Aligned_cols=24  Identities=29%  Similarity=0.563  Sum_probs=21.3

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++..+.+..|
T Consensus         2 ki~vvG~~gvGKTsli~~~~~~~f   25 (158)
T cd04103           2 KLGIVGNLQSGKSALVHRYLTGSY   25 (158)
T ss_pred             EEEEECCCCCcHHHHHHHHHhCCC
Confidence            689999999999999998876665


No 254
>COG2229 Predicted GTPase [General function prediction only]
Probab=97.28  E-value=0.0047  Score=64.02  Aligned_cols=77  Identities=12%  Similarity=0.131  Sum_probs=50.4

Q ss_pred             EEEEEecCccccchHHHHHhhhccccC-CceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhh
Q psy5059         353 ILAVVTANTDMATSESLKLAKETDVDG-RRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHY  431 (1036)
Q Consensus       353 ~~~~v~~~~d~~~~~~~~la~~~d~~g-~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~  431 (1036)
                      .+.+|+++.+... .+.++........ -+.++.+||-||.+.-.-.                            .+.++
T Consensus        95 aivlVDss~~~~~-~a~~ii~f~~~~~~ip~vVa~NK~DL~~a~ppe----------------------------~i~e~  145 (187)
T COG2229          95 AIVLVDSSRPITF-HAEEIIDFLTSRNPIPVVVAINKQDLFDALPPE----------------------------KIREA  145 (187)
T ss_pred             EEEEEecCCCcch-HHHHHHHHHhhccCCCEEEEeeccccCCCCCHH----------------------------HHHHH
Confidence            4555565555555 6677777777777 8999999999999864321                            23333


Q ss_pred             ccCC-CcceeeeecccchhhhHHHHHHh
Q psy5059         432 ISNP-NSIILAVVTANTDMATSESLKLA  458 (1036)
Q Consensus       432 i~~~-~~ipla~ISA~td~~~qeil~la  458 (1036)
                      +... ...|.+.++|..+....+.+...
T Consensus       146 l~~~~~~~~vi~~~a~e~~~~~~~L~~l  173 (187)
T COG2229         146 LKLELLSVPVIEIDATEGEGARDQLDVL  173 (187)
T ss_pred             HHhccCCCceeeeecccchhHHHHHHHH
Confidence            3333 57777778887666555555443


No 255
>cd01900 YchF YchF subfamily.  YchF is a member of the Obg family, which includes four other subfamilies of GTPases: Obg, DRG, Ygr210, and NOG1.  Obg is an essential gene that is involved in DNA replication in C. crescentus and Streptomyces griseus and is associated with the ribosome.  Several members of the family, including YchF, possess the TGS domain related to the RNA-binding proteins.  Experimental data and genomic analysis suggest that YchF may be part of a nucleoprotein complex and may function as a GTP-dependent translational factor.
Probab=97.21  E-value=0.00061  Score=75.98  Aligned_cols=37  Identities=24%  Similarity=0.319  Sum_probs=28.1

Q ss_pred             eEEeCcCCCChhhHHhhhcCCCcCcccccccccCceE
Q psy5059          86 IVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLI  122 (1036)
Q Consensus        86 IvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~  122 (1036)
                      |++||-+|+||||++++|+|...-+.+-.-||+-|..
T Consensus         1 igivG~PN~GKSTLfn~Lt~~~~~~~n~pftTi~p~~   37 (274)
T cd01900           1 IGIVGLPNVGKSTLFNALTKAGAEAANYPFCTIEPNV   37 (274)
T ss_pred             CeEeCCCCCcHHHHHHHHhCCCCccccccccchhcee
Confidence            5789999999999999999988533333456666643


No 256
>PLN00043 elongation factor 1-alpha; Provisional
Probab=97.10  E-value=0.0024  Score=76.19  Aligned_cols=21  Identities=43%  Similarity=0.589  Sum_probs=19.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVG  105 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G  105 (1036)
                      -|+++|.-.+|||||+++|.-
T Consensus         9 ni~i~Ghvd~GKSTL~g~Ll~   29 (447)
T PLN00043          9 NIVVIGHVDSGKSTTTGHLIY   29 (447)
T ss_pred             EEEEEecCCCCHHHHHHHHHH
Confidence            389999999999999999973


No 257
>KOG1490|consensus
Probab=97.09  E-value=0.0029  Score=73.88  Aligned_cols=40  Identities=15%  Similarity=0.238  Sum_probs=27.9

Q ss_pred             HHHHHHhhhhcCCCCCCCCceEEeCcCCCChhhHHhhhcC
Q psy5059          66 INKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVG  105 (1036)
Q Consensus        66 ~~kL~~~~~~~g~~~i~lPqIvVvG~QSsGKSSlLEal~G  105 (1036)
                      +..++..+..+-.-+.+.+.+.|||-+++||||+++-++-
T Consensus       151 LeqVrqhl~rlPsIDp~trTlllcG~PNVGKSSf~~~vtr  190 (620)
T KOG1490|consen  151 LEQVRQHLSRLPAIDPNTRTLLVCGYPNVGKSSFNNKVTR  190 (620)
T ss_pred             HHHHHHHHhcCCCCCCCcCeEEEecCCCCCcHhhcccccc
Confidence            3333443344444566789999999999999997776653


No 258
>cd04102 RabL3 RabL3 (Rab-like3) subfamily.  RabL3s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL3 lacks a prenylation site at the C-terminus.  The specific function of RabL3 remains unknown.
Probab=97.09  E-value=0.0022  Score=68.46  Aligned_cols=24  Identities=29%  Similarity=0.551  Sum_probs=22.5

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+++|+.++||||++..+++-.|
T Consensus         2 KIvlvGd~gVGKTSLi~~~~~~~f   25 (202)
T cd04102           2 RVLVVGDSGVGKSSLVHLICKNQV   25 (202)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCC
Confidence            689999999999999999998876


No 259
>cd01873 RhoBTB RhoBTB subfamily.  Members of the RhoBTB subfamily of Rho GTPases are present in vertebrates, Drosophila, and Dictyostelium.  RhoBTB proteins are characterized by a modular organization, consisting of a GTPase domain, a proline rich region, a tandem of two BTB (Broad-Complex, Tramtrack, and Bric a brac) domains, and a C-terminal region of unknown function.  RhoBTB proteins may act as docking points for multiple components participating in signal transduction cascades.  RhoBTB genes appeared upregulated in some cancer cell lines, suggesting a participation of RhoBTB proteins in the pathogenesis of particular tumors.  Note that the Dictyostelium RacA GTPase domain is more closely related to Rac proteins than to RhoBTB proteins, where RacA actually belongs.  Thus, the Dictyostelium RacA is not included here.  Most Rho proteins contain a lipid modification site at the C-terminus; however, RhoBTB is one of few Rho subfamilies that lack this feature.
Probab=97.07  E-value=0.0025  Score=67.61  Aligned_cols=23  Identities=35%  Similarity=0.517  Sum_probs=19.2

Q ss_pred             ceEEeCcCCCChhhHHh-hhcCCC
Q psy5059          85 QIVVVGTQSSGKSSVIE-SLVGKS  107 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLE-al~G~~  107 (1036)
                      +|+++|+.++||||++. .+.+..
T Consensus         4 Kiv~vG~~~vGKTsLi~~~~~~~~   27 (195)
T cd01873           4 KCVVVGDNAVGKTRLICARACNKT   27 (195)
T ss_pred             EEEEECCCCcCHHHHHHHHHhCCC
Confidence            79999999999999996 555444


No 260
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF. Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members.
Probab=97.04  E-value=0.0011  Score=74.09  Aligned_cols=24  Identities=38%  Similarity=0.638  Sum_probs=22.1

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .+++|+|.+|+||||++++|.|..
T Consensus       119 ~~~~~vG~~nvGKSslin~l~~~~  142 (276)
T TIGR03596       119 IRAMIVGIPNVGKSTLINRLAGKK  142 (276)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCCC
Confidence            579999999999999999998875


No 261
>PTZ00258 GTP-binding protein; Provisional
Probab=97.03  E-value=0.0013  Score=76.77  Aligned_cols=42  Identities=19%  Similarity=0.245  Sum_probs=31.1

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEE
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLIL  123 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l  123 (1036)
                      .-.+|++||-+|+|||||+++|+|.......---||+-|..-
T Consensus        20 ~~~kvgIVG~PNvGKSTLfnaLt~~~~~v~n~pftTi~p~~g   61 (390)
T PTZ00258         20 NNLKMGIVGLPNVGKSTTFNALCKQQVPAENFPFCTIDPNTA   61 (390)
T ss_pred             CCcEEEEECCCCCChHHHHHHHhcCcccccCCCCCcccceEE
Confidence            346899999999999999999999874222333466666543


No 262
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=97.02  E-value=0.00032  Score=67.16  Aligned_cols=24  Identities=46%  Similarity=0.785  Sum_probs=21.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +|+|+|+.+||||||+++|.+..+
T Consensus         1 kI~V~G~~g~GKTsLi~~l~~~~~   24 (119)
T PF08477_consen    1 KIVVLGDSGVGKTSLIRRLCGGEF   24 (119)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHSS-
T ss_pred             CEEEECcCCCCHHHHHHHHhcCCC
Confidence            589999999999999999999885


No 263
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=96.99  E-value=0.00077  Score=70.72  Aligned_cols=24  Identities=38%  Similarity=0.624  Sum_probs=22.2

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ..++++|.+++||||++++|.+..
T Consensus       128 ~~~~~~G~~nvGKStliN~l~~~~  151 (190)
T cd01855         128 GDVYVVGATNVGKSTLINALLKKD  151 (190)
T ss_pred             CcEEEEcCCCCCHHHHHHHHHHhc
Confidence            589999999999999999998765


No 264
>PRK12289 GTPase RsgA; Reviewed
Probab=96.92  E-value=0.0021  Score=74.30  Aligned_cols=23  Identities=39%  Similarity=0.528  Sum_probs=20.9

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .++++|..++||||||++|.|..
T Consensus       174 i~v~iG~SgVGKSSLIN~L~~~~  196 (352)
T PRK12289        174 ITVVAGPSGVGKSSLINRLIPDV  196 (352)
T ss_pred             eEEEEeCCCCCHHHHHHHHcCcc
Confidence            47999999999999999998765


No 265
>PF01926 MMR_HSR1:  50S ribosome-binding GTPase;  InterPro: IPR002917 Human HSR1, has been localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has both prokaryote and eukaryote members [].; GO: 0005525 GTP binding, 0005622 intracellular; PDB: 2DWQ_B 2DBY_A 3CNN_A 3CNO_A 3CNL_A 3IBY_A 1PUI_B 1WXQ_A 1LNZ_A 3GEE_A ....
Probab=96.90  E-value=0.00098  Score=63.99  Aligned_cols=36  Identities=33%  Similarity=0.586  Sum_probs=27.0

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcccc-cCCcccccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPR-GIGIVTRRP   44 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr-~~~~~trrp   44 (1036)
                      .|+|+|.+|||||||+|+|.|....+. ....+|+.+
T Consensus         1 ~V~iiG~~~~GKSTlin~l~~~~~~~~~~~~~~T~~~   37 (116)
T PF01926_consen    1 RVAIIGRPNVGKSTLINALTGKKLAKVSNIPGTTRDP   37 (116)
T ss_dssp             EEEEEESTTSSHHHHHHHHHTSTSSEESSSTTSSSSE
T ss_pred             CEEEECCCCCCHHHHHHHHhccccccccccccceeee
Confidence            589999999999999999999654332 233455555


No 266
>cd01856 YlqF YlqF.  Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.
Probab=96.88  E-value=0.0017  Score=67.07  Aligned_cols=25  Identities=40%  Similarity=0.590  Sum_probs=22.9

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +.++++|.+++||||++++|.+..+
T Consensus       116 ~~~~~~G~~~vGKstlin~l~~~~~  140 (171)
T cd01856         116 IRAMVVGIPNVGKSTLINRLRGKKV  140 (171)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCCCc
Confidence            5899999999999999999998764


No 267
>PRK09601 GTP-binding protein YchF; Reviewed
Probab=96.87  E-value=0.0023  Score=73.94  Aligned_cols=38  Identities=21%  Similarity=0.232  Sum_probs=28.9

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCcCcccccccccCce
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPL  121 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl  121 (1036)
                      .+|.+||-+|+|||||+++|+|.......-.-||+-|.
T Consensus         3 ~~vgIVG~PNvGKSTLfnaLt~~~~~v~nypftTi~p~   40 (364)
T PRK09601          3 LKCGIVGLPNVGKSTLFNALTKAGAEAANYPFCTIEPN   40 (364)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCCCeecccccccccce
Confidence            57999999999999999999998732222245666664


No 268
>cd04178 Nucleostemin_like Nucleostemin-like.  Nucleostemin (NS) is a nucleolar protein that functions as a regulator of cell growth and proliferation in stem cells and in several types of cancer cells, but is not expressed in the differentiated cells of most mammalian adult tissues.  NS shuttles between the nucleolus and nucleoplasm bidirectionally at a rate that is fast and independent of cell type.  Lowering GTP levels decreases the nucleolar retention of NS, and expression of NS is abruptly down-regulated during differentiation prior to terminal cell division.  Found only in eukaryotes, NS consists of an N-terminal basic domain, a coiled-coil domain, a GTP-binding domain, an intermediate domain, and a C-terminal acidic domain.  Experimental evidence indicates that NS uses its GTP-binding property as a molecular switch to control the transition between the nucleolus and nucleoplasm, and this process involves interaction between the basic, GTP-binding, and intermediate domains of the 
Probab=96.85  E-value=0.00072  Score=70.34  Aligned_cols=24  Identities=42%  Similarity=0.451  Sum_probs=22.5

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .+++|+|.+|+|||||+++|+|..
T Consensus       118 ~~~~~vG~pnvGKSslin~l~~~~  141 (172)
T cd04178         118 ITVGVVGFPNVGKSSLINSLKRSR  141 (172)
T ss_pred             cEEEEEcCCCCCHHHHHHHHhCcc
Confidence            589999999999999999999876


No 269
>PRK09563 rbgA GTPase YlqF; Reviewed
Probab=96.84  E-value=0.0018  Score=72.88  Aligned_cols=24  Identities=33%  Similarity=0.634  Sum_probs=22.2

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .+++++|.+|+||||++++|.|..
T Consensus       122 ~~~~~~G~pnvGKSsliN~l~~~~  145 (287)
T PRK09563        122 IRAMIIGIPNVGKSTLINRLAGKK  145 (287)
T ss_pred             eEEEEECCCCCCHHHHHHHHhcCC
Confidence            479999999999999999999876


No 270
>PLN00116 translation elongation factor EF-2 subunit; Provisional
Probab=96.84  E-value=0.0076  Score=77.40  Aligned_cols=26  Identities=27%  Similarity=0.494  Sum_probs=22.9

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ....|+|+|...+|||||+|+|+...
T Consensus        18 ~Irni~iiGhvd~GKTTL~~~Ll~~~   43 (843)
T PLN00116         18 NIRNMSVIAHVDHGKSTLTDSLVAAA   43 (843)
T ss_pred             CccEEEEEcCCCCCHHHHHHHHHHhc
Confidence            56789999999999999999998554


No 271
>KOG0084|consensus
Probab=96.83  E-value=0.0059  Score=63.86  Aligned_cols=119  Identities=18%  Similarity=0.226  Sum_probs=76.1

Q ss_pred             EEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCCCCCccc
Q psy5059         233 LKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTL  312 (1036)
Q Consensus       233 L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp~g~RTi  312 (1036)
                      +++.|.. .-|.+=|+.|-             +..|+++.+|-+..|.||++-+-     +.+..|..            
T Consensus        51 ~e~~gk~-iKlQIWDTAGQ-------------ERFrtit~syYR~ahGii~vyDi-----T~~~SF~~------------   99 (205)
T KOG0084|consen   51 VELDGKT-IKLQIWDTAGQ-------------ERFRTITSSYYRGAHGIIFVYDI-----TKQESFNN------------   99 (205)
T ss_pred             eeecceE-EEEEeeecccc-------------HHHhhhhHhhccCCCeEEEEEEc-----ccHHHhhh------------
Confidence            3444422 36677789982             46789999999999998887653     33332222            


Q ss_pred             ceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCceEEEEeccccc
Q psy5059         313 DLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLM  392 (1036)
Q Consensus       313 gvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~Dl~  392 (1036)
                                            ...|-+=+++|-.++                              ...+.|.||.|+.
T Consensus       100 ----------------------v~~Wi~Ei~~~~~~~------------------------------v~~lLVGNK~Dl~  127 (205)
T KOG0084|consen  100 ----------------------VKRWIQEIDRYASEN------------------------------VPKLLVGNKCDLT  127 (205)
T ss_pred             ----------------------HHHHHHHhhhhccCC------------------------------CCeEEEeeccccH
Confidence                                  234445555554433                              3567899999998


Q ss_pred             CCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcce-eeeecccchhhhHHHHH-Hhhhc
Q psy5059         393 DAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSII-LAVVTANTDMATSESLK-LAKET  461 (1036)
Q Consensus       393 ~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ip-la~ISA~td~~~qeil~-la~~v  461 (1036)
                      +.-                           .+..+..+.+.....+| ..-+||+...++..+|. +|...
T Consensus       128 ~~~---------------------------~v~~~~a~~fa~~~~~~~f~ETSAK~~~NVe~~F~~la~~l  171 (205)
T KOG0084|consen  128 EKR---------------------------VVSTEEAQEFADELGIPIFLETSAKDSTNVEDAFLTLAKEL  171 (205)
T ss_pred             hhe---------------------------ecCHHHHHHHHHhcCCcceeecccCCccCHHHHHHHHHHHH
Confidence            752                           22223334455556666 88899999999999874 44443


No 272
>TIGR00490 aEF-2 translation elongation factor aEF-2. This model represents archaeal elongation factor 2, a protein more similar to eukaryotic EF-2 than to bacterial EF-G, both in sequence similarity and in sharing with eukaryotes the property of having a diphthamide (modified His) residue at a conserved position. The diphthamide can be ADP-ribosylated by diphtheria toxin in the presence of NAD.
Probab=96.78  E-value=0.0045  Score=78.21  Aligned_cols=24  Identities=21%  Similarity=0.397  Sum_probs=21.4

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcC
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVG  105 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G  105 (1036)
                      ..-.|+++|..++|||||+++|..
T Consensus        18 ~irnI~ivGh~~~GKTTL~~~ll~   41 (720)
T TIGR00490        18 FIRNIGIVAHIDHGKTTLSDNLLA   41 (720)
T ss_pred             cccEEEEEEeCCCCHHHHHHHHHH
Confidence            356899999999999999999974


No 273
>TIGR03156 GTP_HflX GTP-binding protein HflX. This protein family is one of a number of homologous small, well-conserved GTP-binding proteins with pleiotropic effects. Bacterial members are designated HflX, following the naming convention in Escherichia coli where HflX is encoded immediately downstream of the RNA chaperone Hfq, and immediately upstream of HflKC, a membrane-associated protease pair with an important housekeeping function. Over large numbers of other bacterial genomes, the pairing with hfq is more significant than with hflK and hlfC. The gene from Homo sapiens in this family has been named PGPL (pseudoautosomal GTP-binding protein-like).
Probab=96.76  E-value=0.0014  Score=75.69  Aligned_cols=44  Identities=25%  Similarity=0.441  Sum_probs=34.3

Q ss_pred             CCCeEEEeccCCCchHHHHHhhhcCCcccccCCccccccEEEee
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQL   49 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~l~l   49 (1036)
                      ..|.|++||.+|||||||||+|+|.++........|+-|..-.+
T Consensus       188 ~~~~ValvG~~NvGKSSLln~L~~~~~~v~~~~~tT~d~~~~~i  231 (351)
T TIGR03156       188 DVPTVALVGYTNAGKSTLFNALTGADVYAADQLFATLDPTTRRL  231 (351)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHhCCceeeccCCccccCCEEEEE
Confidence            46999999999999999999999987655544445666654433


No 274
>PTZ00416 elongation factor 2; Provisional
Probab=96.74  E-value=0.0068  Score=77.74  Aligned_cols=25  Identities=32%  Similarity=0.519  Sum_probs=21.9

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .--|+++|..++|||||+++|.+..
T Consensus        19 irni~iiGh~d~GKTTL~~~Ll~~~   43 (836)
T PTZ00416         19 IRNMSVIAHVDHGKSTLTDSLVCKA   43 (836)
T ss_pred             cCEEEEECCCCCCHHHHHHHHHHhc
Confidence            3479999999999999999998643


No 275
>cd04104 p47_IIGP_like p47 (47-kDa) family.  The p47 GTPase family consists of several highly homologous proteins, including IGTP, TGTP/Mg21, IRG-47, GTPI, LRG-47, and IIGP1.  They are found in higher eukaryotes where they play a role in immune resistance against intracellular pathogens.  p47 proteins exist at low resting levels in mouse cells, but are strongly induced by Type II interferon (IFN-gamma).  ITGP is critical for resistance to Toxoplasma gondii infection and in involved in inhibition of Coxsackievirus-B3-induced apoptosis.  TGTP was shown to limit vesicular stomatitis virus (VSV) infection of fibroblasts in vitro.  IRG-47 is involved in resistance to T. gondii infection.  LRG-47 has been implicated in resistance to T. gondii, Listeria monocytogenes, Leishmania, and mycobacterial infections.  IIGP1 has been shown to localize to the ER and to the Golgi membranes in IFN-induced cells and inflamed tissues.  In macrophages, IIGP1 interacts with hook3, a microtubule binding protei
Probab=96.63  E-value=0.0048  Score=65.32  Aligned_cols=23  Identities=43%  Similarity=0.638  Sum_probs=21.1

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .|+++|.+|||||||+|+|.|..
T Consensus         3 kI~i~G~~g~GKSSLin~L~g~~   25 (197)
T cd04104           3 NIAVTGESGAGKSSFINALRGVG   25 (197)
T ss_pred             EEEEECCCCCCHHHHHHHHhccC
Confidence            69999999999999999999943


No 276
>PRK00454 engB GTP-binding protein YsxC; Reviewed
Probab=96.62  E-value=0.0016  Score=67.89  Aligned_cols=32  Identities=34%  Similarity=0.509  Sum_probs=27.9

Q ss_pred             CCCeEEEeccCCCchHHHHHhhhcCCcccccC
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGI   37 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~   37 (1036)
                      .+|.|++||.+|||||||+|+|+|..|.+.-+
T Consensus        23 ~~~~v~ivG~~~~GKSsli~~l~~~~~~~~~~   54 (196)
T PRK00454         23 DGPEIAFAGRSNVGKSSLINALTNRKNLARTS   54 (196)
T ss_pred             CCCEEEEEcCCCCCHHHHHHHHhCCCCccccc
Confidence            57899999999999999999999987665543


No 277
>cd01878 HflX HflX subfamily.  A distinct conserved domain with a glycine-rich segment N-terminal of the GTPase domain characterizes the HflX subfamily.  The E. coli HflX has been implicated in the control of the lambda cII repressor proteolysis, but the actual biological functions of these GTPases remain unclear.  HflX is widespread, but not universally represented in all three superkingdoms.
Probab=96.62  E-value=0.002  Score=68.12  Aligned_cols=39  Identities=26%  Similarity=0.486  Sum_probs=30.9

Q ss_pred             CCCeEEEeccCCCchHHHHHhhhcCCcccccCCcccccc
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRP   44 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrp   44 (1036)
                      ..|.|+|+|.+||||||++++|+|..+.+.+....|..|
T Consensus        40 ~~~~I~iiG~~g~GKStLl~~l~~~~~~~~~~~~~t~~~   78 (204)
T cd01878          40 GIPTVALVGYTNAGKSTLFNALTGADVYAEDQLFATLDP   78 (204)
T ss_pred             CCCeEEEECCCCCCHHHHHHHHhcchhccCCccceeccc
Confidence            468999999999999999999999876555544444444


No 278
>PRK07560 elongation factor EF-2; Reviewed
Probab=96.61  E-value=0.0085  Score=75.91  Aligned_cols=25  Identities=20%  Similarity=0.433  Sum_probs=21.6

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCC
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      ..--|+++|...+|||||+|+|...
T Consensus        19 ~iRni~iigh~d~GKTTL~e~ll~~   43 (731)
T PRK07560         19 QIRNIGIIAHIDHGKTTLSDNLLAG   43 (731)
T ss_pred             cccEEEEEEeCCCCHHHHHHHHHHH
Confidence            3557999999999999999999744


No 279
>PLN00023 GTP-binding protein; Provisional
Probab=96.60  E-value=0.0081  Score=68.32  Aligned_cols=29  Identities=31%  Similarity=0.404  Sum_probs=25.2

Q ss_pred             CCCCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          80 AIQLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        80 ~i~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ....-+|+++|+.++||||++..+++-.|
T Consensus        18 ~~~~iKIVLLGdsGVGKTSLI~rf~~g~F   46 (334)
T PLN00023         18 PCGQVRVLVVGDSGVGKSSLVHLIVKGSS   46 (334)
T ss_pred             CccceEEEEECCCCCcHHHHHHHHhcCCc
Confidence            34456899999999999999999998776


No 280
>PRK11058 GTPase HflX; Provisional
Probab=96.59  E-value=0.002  Score=76.31  Aligned_cols=41  Identities=20%  Similarity=0.379  Sum_probs=30.6

Q ss_pred             CCCeEEEeccCCCchHHHHHhhhcCCcccccCCccccccEE
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLI   46 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~   46 (1036)
                      .+|.|++||.+|||||||||+|+|.++.....-..|+-|..
T Consensus       196 ~~p~ValVG~~NaGKSSLlN~Lt~~~~~v~~~~~tTld~~~  236 (426)
T PRK11058        196 DVPTVSLVGYTNAGKSTLFNRITEARVYAADQLFATLDPTL  236 (426)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCceeeccCCCCCcCCce
Confidence            56999999999999999999999976543222233555544


No 281
>TIGR00157 ribosome small subunit-dependent GTPase A. The Aquifex aeolicus ortholog is split into consecutive open reading frames. Consequently, this model was build in fragment mode (-f option).
Probab=96.58  E-value=0.0072  Score=66.46  Aligned_cols=24  Identities=33%  Similarity=0.360  Sum_probs=21.9

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ...+++|..++||||||++|.|..
T Consensus       121 ~~~~~~G~sgvGKStLiN~L~~~~  144 (245)
T TIGR00157       121 RISVFAGQSGVGKSSLINALDPSV  144 (245)
T ss_pred             CEEEEECCCCCCHHHHHHHHhhhh
Confidence            588999999999999999999765


No 282
>TIGR02836 spore_IV_A stage IV sporulation protein A. A comparative genome analysis of all sequenced genomes of shows a number of proteins conserved strictly among the endospore-forming subset of the Firmicutes. This protein, a member of this panel, is designated stage IV sporulation protein A. It acts in the mother cell compartment and plays a role in spore coat morphogenesis.
Probab=96.56  E-value=0.037  Score=64.47  Aligned_cols=51  Identities=8%  Similarity=0.066  Sum_probs=35.5

Q ss_pred             HHhhhcCCCceEEEEE-ecC-----ccccchHHHHHhhhccccCCceEEEEeccccc
Q psy5059         342 VLHYISNPNSIILAVV-TAN-----TDMATSESLKLAKETDVDGRRTLAVVTKIDLM  392 (1036)
Q Consensus       342 ~~~y~~~~~~~~~~~v-~~~-----~d~~~~~~~~la~~~d~~g~rti~VitK~Dl~  392 (1036)
                      +++-|+...+|-++|. ++.     .+.-..+-.++..++...|++.|+|+||.|-.
T Consensus       137 T~kVI~dhstIgivVtTDgsi~dI~Re~y~~aEe~~i~eLk~~~kPfiivlN~~dp~  193 (492)
T TIGR02836       137 TRKVIQEHSTIGVVVTTDGTITDIPREDYVEAEERVIEELKELNKPFIILLNSTHPY  193 (492)
T ss_pred             HHHHHHhcCcEEEEEEcCCCccccccccchHHHHHHHHHHHhcCCCEEEEEECcCCC
Confidence            4556666677766666 332     02223334788899999999999999999944


No 283
>PRK12288 GTPase RsgA; Reviewed
Probab=96.55  E-value=0.0082  Score=69.32  Aligned_cols=24  Identities=33%  Similarity=0.511  Sum_probs=21.6

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ..++++|..++||||||++|.|..
T Consensus       206 ki~~~vG~sgVGKSTLiN~Ll~~~  229 (347)
T PRK12288        206 RISIFVGQSGVGKSSLINALLPEA  229 (347)
T ss_pred             CCEEEECCCCCCHHHHHHHhcccc
Confidence            358999999999999999999875


No 284
>KOG1191|consensus
Probab=96.54  E-value=0.0018  Score=75.65  Aligned_cols=42  Identities=31%  Similarity=0.323  Sum_probs=30.6

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCcccc--cCCccccccEEEeec
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLPR--GIGIVTRRPLILQLY   50 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~pr--~~~~~trrpl~l~l~   50 (1036)
                      +|||+||+||||||||+|+|+..+---.  -.|. ||--+..++.
T Consensus       269 l~iaIvGrPNvGKSSLlNaL~~~drsIVSpv~GT-TRDaiea~v~  312 (531)
T KOG1191|consen  269 LQIAIVGRPNVGKSSLLNALSREDRSIVSPVPGT-TRDAIEAQVT  312 (531)
T ss_pred             CeEEEEcCCCCCHHHHHHHHhcCCceEeCCCCCc-chhhheeEee
Confidence            6999999999999999999998542211  2333 6666666655


No 285
>PRK04213 GTP-binding protein; Provisional
Probab=96.49  E-value=0.003  Score=66.51  Aligned_cols=40  Identities=38%  Similarity=0.521  Sum_probs=29.8

Q ss_pred             CCCeEEEeccCCCchHHHHHhhhcCCcccccCCccccccE
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPL   45 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl   45 (1036)
                      ..|.|+++|.+|||||||+|+|.|..+.......+|+.+.
T Consensus         8 ~~~~i~i~G~~~~GKSsLin~l~~~~~~~~~~~~~t~~~~   47 (201)
T PRK04213          8 RKPEIVFVGRSNVGKSTLVRELTGKKVRVGKRPGVTRKPN   47 (201)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhCCCCccCCCCceeeCce
Confidence            4689999999999999999999997754322223454443


No 286
>COG0486 ThdF Predicted GTPase [General function prediction only]
Probab=96.49  E-value=0.0015  Score=76.32  Aligned_cols=23  Identities=35%  Similarity=0.821  Sum_probs=21.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .||+||+||||||||||+|.|++
T Consensus       219 kvvIiG~PNvGKSSLLNaL~~~d  241 (454)
T COG0486         219 KVVIIGRPNVGKSSLLNALLGRD  241 (454)
T ss_pred             eEEEECCCCCcHHHHHHHHhcCC
Confidence            58999999999999999999966


No 287
>cd01858 NGP_1 NGP-1.  Autoantigen NGP-1 (Nucleolar G-protein gene 1) has been shown to localize in the nucleolus and nucleolar organizers in all cell types analyzed, which is indicative of a function in ribosomal assembly. NGP-1 and its homologs show a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with NKXD motif) are relocated to the N terminus.
Probab=96.49  E-value=0.0018  Score=65.81  Aligned_cols=26  Identities=31%  Similarity=0.450  Sum_probs=22.8

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      .|++||.||||||||+|+|.|....+
T Consensus       104 ~v~~~G~~nvGKStliN~l~~~~~~~  129 (157)
T cd01858         104 SVGFIGYPNVGKSSIINTLRSKKVCK  129 (157)
T ss_pred             EEEEEeCCCCChHHHHHHHhcCCcee
Confidence            57899999999999999999976544


No 288
>TIGR00101 ureG urease accessory protein UreG. This model represents UreG, a GTP hydrolase that acts in the assembly of the nickel metallocenter of urease. It is found only in urease-positive species, although some urease-positive species (e.g. Bacillus subtilis) lack this protein. A similar protein, hypB, is an accessory protein for expression of hydrogenase, which also uses nickel.
Probab=96.45  E-value=0.044  Score=58.43  Aligned_cols=53  Identities=13%  Similarity=0.124  Sum_probs=37.5

Q ss_pred             EEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhh
Q psy5059         383 LAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKE  460 (1036)
Q Consensus       383 i~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~  460 (1036)
                      ++|+||.|+.+.-....                      +.+...++..   ....++..+||+++.++.+++.+..+
T Consensus       141 ~~~~~k~d~~~~~~~~~----------------------~~~~~~~~~~---~~~~~i~~~Sa~~g~gi~el~~~i~~  193 (199)
T TIGR00101       141 LLVINKIDLAPMVGADL----------------------GVMERDAKKM---RGEKPFIFTNLKTKEGLDTVIDWIEH  193 (199)
T ss_pred             EEEEEhhhccccccccH----------------------HHHHHHHHHh---CCCCCEEEEECCCCCCHHHHHHHHHh
Confidence            88999999985311111                      3344444444   23588889999999999999988753


No 289
>KOG1423|consensus
Probab=96.44  E-value=0.0042  Score=68.85  Aligned_cols=66  Identities=24%  Similarity=0.414  Sum_probs=46.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc----------ccCCccccccEEEeeccCCCc--hhhhhhhHHHHHHHHHhhh
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP----------RGIGIVTRRPLILQLYYCPKD--DREKRTAAAVINKLQDVFN   74 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p----------r~~~~~trrpl~l~l~~~~~~--~~~~~~~~~l~~kL~~~~~   74 (1036)
                      .|||||.||+|||||.|.++|...-|          +-.|++|..-.-|.+.-+|+-  ..+.+.-....+.+++.-.
T Consensus        74 ~vavIG~PNvGKStLtN~mig~kv~~vS~K~~TTr~~ilgi~ts~eTQlvf~DTPGlvs~~~~r~~~l~~s~lq~~~~  151 (379)
T KOG1423|consen   74 YVAVIGAPNVGKSTLTNQMIGQKVSAVSRKVHTTRHRILGIITSGETQLVFYDTPGLVSKKMHRRHHLMMSVLQNPRD  151 (379)
T ss_pred             EEEEEcCCCcchhhhhhHhhCCccccccccccceeeeeeEEEecCceEEEEecCCcccccchhhhHHHHHHhhhCHHH
Confidence            79999999999999999999977777          346677777788888887762  2222333333444554333


No 290
>cd01859 MJ1464 MJ1464.  This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.
Probab=96.43  E-value=0.0073  Score=61.16  Aligned_cols=96  Identities=24%  Similarity=0.260  Sum_probs=63.8

Q ss_pred             HHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccc
Q psy5059         337 QIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGR  416 (1036)
Q Consensus       337 ~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~  416 (1036)
                      +|++|++.++.+- .++++|++++. +..+....+.+.+...|++.|.|+||+|+.++.  ..                 
T Consensus         1 ~~~~~~~~i~~~a-D~vl~V~D~~~-~~~~~~~~l~~~~~~~~~p~iiv~NK~Dl~~~~--~~-----------------   59 (156)
T cd01859           1 MWKRLVRRIIKES-DVVLEVLDARD-PELTRSRKLERYVLELGKKLLIVLNKADLVPKE--VL-----------------   59 (156)
T ss_pred             CHHHHHHHHHhhC-CEEEEEeeCCC-CcccCCHHHHHHHHhCCCcEEEEEEhHHhCCHH--HH-----------------
Confidence            4888988888753 57778889864 222233456666666789999999999996431  00                 


Q ss_pred             cchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhhcCc
Q psy5059         417 RTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDV  463 (1036)
Q Consensus       417 ~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd~  463 (1036)
                           ....    .+.. ....+...+||+++.+..++++...+.-+
T Consensus        60 -----~~~~----~~~~-~~~~~~~~iSa~~~~gi~~L~~~l~~~~~   96 (156)
T cd01859          60 -----EKWK----SIKE-SEGIPVVYVSAKERLGTKILRRTIKELAK   96 (156)
T ss_pred             -----HHHH----HHHH-hCCCcEEEEEccccccHHHHHHHHHHHHh
Confidence                 1111    1111 12356789999999999999888776644


No 291
>PF09439 SRPRB:  Signal recognition particle receptor beta subunit;  InterPro: IPR019009  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.   The beta subunit of the signal recognition particle receptor (SRP) is a transmembrane GTPase, which anchors the alpha subunit to the endoplasmic reticulum membrane []. ; PDB: 2GED_B 1NRJ_B 2GO5_2 2FH5_B.
Probab=96.43  E-value=0.0041  Score=65.19  Aligned_cols=25  Identities=32%  Similarity=0.632  Sum_probs=19.9

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      -|.++++|..+|||++|+..|+.-.
T Consensus         3 ~~~vlL~Gps~SGKTaLf~~L~~~~   27 (181)
T PF09439_consen    3 RPTVLLVGPSGSGKTALFSQLVNGK   27 (181)
T ss_dssp             --EEEEE-STTSSHHHHHHHHHHSS
T ss_pred             CceEEEEcCCCCCHHHHHHHHhcCC
Confidence            4789999999999999999998654


No 292
>cd01852 AIG1 AIG1 (avrRpt2-induced gene 1).  This represents Arabidoposis protein AIG1 that appears to be involved in plant resistance to bacteria.  The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2.  AIG1 exhibits RPS2- and avrRpt1-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2. This subfamily also includes IAN-4 protein, which has GTP-binding activity and shares sequence homology with a novel family of putative GTP-binding proteins: the immuno-associated nucleotide (IAN) family.  The evolutionary conservation of the IAN family provides a unique example of a plant pathogen response gene conserved in animals. The IAN/IMAP subfamily has been proposed to regulate apoptosis in vertebrates and angiosperm plants, particularly in relation to cancer, diabetes, and infections.  The human IAN genes were renamed GIMAP (GTPase of the immunity associated proteins).
Probab=96.41  E-value=0.0024  Score=67.37  Aligned_cols=28  Identities=25%  Similarity=0.554  Sum_probs=24.1

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPRG   36 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr~   36 (1036)
                      .|++||++||||||++|+|+|......+
T Consensus         2 ~i~lvG~~g~GKSsl~N~ilg~~~~~~~   29 (196)
T cd01852           2 RLVLVGKTGAGKSATGNTILGREVFESK   29 (196)
T ss_pred             EEEEECCCCCCHHHHHHHhhCCCccccc
Confidence            5899999999999999999997655444


No 293
>cd01898 Obg Obg subfamily.  The Obg nucleotide binding protein subfamily has been implicated in stress response, chromosome partitioning, replication initiation, mycelium development, and sporulation.  Obg proteins are among a large group of GTP binding proteins conserved from bacteria to humans.  The E. coli homolog, ObgE is believed to function in ribosomal biogenesis.  Members of the subfamily contain two equally and highly conserved domains, a C-terminal GTP binding domain and an N-terminal glycine-rich domain.
Probab=96.36  E-value=0.0029  Score=64.18  Aligned_cols=24  Identities=21%  Similarity=0.425  Sum_probs=21.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      -|++||++||||||++|+|.|...
T Consensus         2 ~v~ivG~~~~GKStl~~~l~~~~~   25 (170)
T cd01898           2 DVGLVGLPNAGKSTLLSAISNAKP   25 (170)
T ss_pred             CeEEECCCCCCHHHHHHHHhcCCc
Confidence            389999999999999999998654


No 294
>cd01859 MJ1464 MJ1464.  This family represents archaeal GTPase typified by the protein MJ1464 from Methanococcus jannaschii. The members of this family show a circular permutation of the GTPase signature motifs so that C-terminal strands 5, 6, and 7 (strands 6 contain the NKxD motif) are relocated to the N terminus.
Probab=96.35  E-value=0.0064  Score=61.60  Aligned_cols=25  Identities=40%  Similarity=0.571  Sum_probs=22.0

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCC
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      ..+++++|.+++||||+++++.|..
T Consensus       101 ~~~~~~ig~~~~Gkssl~~~l~~~~  125 (156)
T cd01859         101 EGKVGVVGYPNVGKSSIINALKGRH  125 (156)
T ss_pred             CcEEEEECCCCCCHHHHHHHHhCCC
Confidence            4678999999999999999998654


No 295
>TIGR00750 lao LAO/AO transport system ATPase. Mutations have also been found that do not phosphorylate the periplasmic binding proteins, yet still allow transport. The ATPase activity of this protein seems to be necessary, however.
Probab=96.34  E-value=0.046  Score=61.95  Aligned_cols=25  Identities=28%  Similarity=0.460  Sum_probs=22.2

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCC
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      .-+-|.++|.++|||||+++.|.+.
T Consensus        33 ~~~~i~i~G~~G~GKttl~~~l~~~   57 (300)
T TIGR00750        33 NAHRVGITGTPGAGKSTLLEALGME   57 (300)
T ss_pred             CceEEEEECCCCCCHHHHHHHHHHH
Confidence            4578899999999999999999875


No 296
>cd01897 NOG NOG1 is a nucleolar GTP-binding protein present in eukaryotes ranging from trypanosomes to humans.  NOG1 is functionally linked to ribosome biogenesis and found in association with the nuclear pore complexes and identified in many preribosomal complexes.  Thus, defects in NOG1 can lead to defects in 60S biogenesis.  The S. cerevisiae NOG1 gene is essential for cell viability, and mutations in the predicted G motifs abrogate function.  It is a member of the ODN family of GTP-binding proteins that also includes the bacterial Obg and DRG proteins.
Probab=96.33  E-value=0.0036  Score=63.39  Aligned_cols=25  Identities=32%  Similarity=0.539  Sum_probs=23.5

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      |.|++||.+||||||++++|.|..+
T Consensus         1 ~~i~~~G~~~~GKssli~~l~~~~~   25 (168)
T cd01897           1 PTLVIAGYPNVGKSSLVNKLTRAKP   25 (168)
T ss_pred             CeEEEEcCCCCCHHHHHHHHhcCCC
Confidence            7899999999999999999999765


No 297
>cd01900 YchF YchF subfamily.  YchF is a member of the Obg family, which includes four other subfamilies of GTPases: Obg, DRG, Ygr210, and NOG1.  Obg is an essential gene that is involved in DNA replication in C. crescentus and Streptomyces griseus and is associated with the ribosome.  Several members of the family, including YchF, possess the TGS domain related to the RNA-binding proteins.  Experimental data and genomic analysis suggest that YchF may be part of a nucleoprotein complex and may function as a GTP-dependent translational factor.
Probab=96.30  E-value=0.0026  Score=70.98  Aligned_cols=37  Identities=24%  Similarity=0.319  Sum_probs=29.1

Q ss_pred             EEEeccCCCchHHHHHhhhcCCcccccCCccccccEE
Q psy5059          10 IVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLI   46 (1036)
Q Consensus        10 i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~   46 (1036)
                      |++||.||||||||||+|.|....+.....+|+.|..
T Consensus         1 igivG~PN~GKSTLfn~Lt~~~~~~~n~pftTi~p~~   37 (274)
T cd01900           1 IGIVGLPNVGKSTLFNALTKAGAEAANYPFCTIEPNV   37 (274)
T ss_pred             CeEeCCCCCcHHHHHHHHhCCCCccccccccchhcee
Confidence            6899999999999999999977544444556766754


No 298
>cd01861 Rab6 Rab6 subfamily.  Rab6 is involved in microtubule-dependent transport pathways through the Golgi and from endosomes to the Golgi. Rab6A of mammals is implicated in retrograde transport through the Golgi stack, and is also required for a slow, COPI-independent, retrograde transport pathway from the Golgi to the endoplasmic reticulum (ER). This pathway may allow Golgi residents to be recycled through the ER for scrutiny by ER quality-control systems. Yeast Ypt6p, the homolog of the mammalian Rab6 GTPase, is not essential for cell viability. Ypt6p acts in endosome-to-Golgi, in intra-Golgi retrograde transport, and possibly also in Golgi-to-ER trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate
Probab=96.27  E-value=0.0044  Score=62.23  Aligned_cols=28  Identities=32%  Similarity=0.496  Sum_probs=24.8

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPRG   36 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr~   36 (1036)
                      .|+++|.+||||||++++++|.++.+..
T Consensus         2 ki~liG~~~~GKSsli~~l~~~~~~~~~   29 (161)
T cd01861           2 KLVFLGDQSVGKTSIITRFMYDTFDNQY   29 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCCCccC
Confidence            4899999999999999999998886643


No 299
>TIGR02528 EutP ethanolamine utilization protein, EutP. This protein is found within operons which code for polyhedral organelles containing the enzyme ethanolamine ammonia lyase. The function of this gene is unknown, although the presence of an N-terminal GxxGxGK motif implies a GTP-binding site.
Probab=96.26  E-value=0.003  Score=62.37  Aligned_cols=24  Identities=25%  Similarity=0.635  Sum_probs=22.2

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||.+|||||||+|+++|..+
T Consensus         2 kv~liG~~~vGKSsL~~~l~~~~~   25 (142)
T TIGR02528         2 RIMFIGSVGCGKTTLTQALQGEEI   25 (142)
T ss_pred             eEEEECCCCCCHHHHHHHHcCCcc
Confidence            589999999999999999999765


No 300
>PTZ00258 GTP-binding protein; Provisional
Probab=96.26  E-value=0.0036  Score=73.05  Aligned_cols=43  Identities=19%  Similarity=0.271  Sum_probs=32.9

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCcccccCCccccccEEEeec
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLY   50 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~l~l~   50 (1036)
                      .+|++||.||||||||||+|.|..-......-+|+.|..=.+.
T Consensus        22 ~kvgIVG~PNvGKSTLfnaLt~~~~~v~n~pftTi~p~~g~v~   64 (390)
T PTZ00258         22 LKMGIVGLPNVGKSTTFNALCKQQVPAENFPFCTIDPNTARVN   64 (390)
T ss_pred             cEEEEECCCCCChHHHHHHHhcCcccccCCCCCcccceEEEEe
Confidence            4899999999999999999999764334445567777765543


No 301
>PTZ00132 GTP-binding nuclear protein Ran; Provisional
Probab=96.21  E-value=0.04  Score=58.89  Aligned_cols=152  Identities=13%  Similarity=0.153  Sum_probs=0.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhccCCCCccccccccccccccccchhh
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFDD  164 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~df~~  164 (1036)
                      +|+++|+.+|||||++..+....|                                                        
T Consensus        11 kv~liG~~g~GKTtLi~~~~~~~~--------------------------------------------------------   34 (215)
T PTZ00132         11 KLILVGDGGVGKTTFVKRHLTGEF--------------------------------------------------------   34 (215)
T ss_pred             eEEEECCCCCCHHHHHHHHHhCCC--------------------------------------------------------


Q ss_pred             hhhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHHHHHHhcCCCCCcCCCcEEEEEe-ecCcccc
Q psy5059         165 IRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICSEPIILKIY-STSVLNL  243 (1036)
Q Consensus       165 ~r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~~~~~~g~~~~~S~d~I~L~I~-~P~~~~L  243 (1036)
                                                                            ......++..+...+.+. ......+
T Consensus        35 ------------------------------------------------------~~~~~~t~~~~~~~~~~~~~~~~i~i   60 (215)
T PTZ00132         35 ------------------------------------------------------EKKYIPTLGVEVHPLKFYTNCGPICF   60 (215)
T ss_pred             ------------------------------------------------------CCCCCCccceEEEEEEEEECCeEEEE


Q ss_pred             eeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccchhhhhhhhcCCCCCcccceeccCCCCcc
Q psy5059         244 TLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLDLLDIDLPGIT  323 (1036)
Q Consensus       244 tlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s~al~l~r~~Dp~g~RTigvl~~~~~g~~  323 (1036)
                      .+.|+||             ....+.+...|....+++|++....+...-..-                           
T Consensus        61 ~~~Dt~g-------------~~~~~~~~~~~~~~~~~~i~v~d~~~~~s~~~~---------------------------  100 (215)
T PTZ00132         61 NVWDTAG-------------QEKFGGLRDGYYIKGQCAIIMFDVTSRITYKNV---------------------------  100 (215)
T ss_pred             EEEECCC-------------chhhhhhhHHHhccCCEEEEEEECcCHHHHHHH---------------------------


Q ss_pred             cccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhc--cccCCceEEEEecccccCCCchhhhh
Q psy5059         324 KVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKET--DVDGRRTLAVVTKIDLMDAGTDAIDI  401 (1036)
Q Consensus       324 ~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~--d~~g~rti~VitK~Dl~~~g~~~~~~  401 (1036)
                                                                   ......+  -.+..+.+.|.||+|+.+......  
T Consensus       101 ---------------------------------------------~~~~~~i~~~~~~~~i~lv~nK~Dl~~~~~~~~--  133 (215)
T PTZ00132        101 ---------------------------------------------PNWHRDIVRVCENIPIVLVGNKVDVKDRQVKAR--  133 (215)
T ss_pred             ---------------------------------------------HHHHHHHHHhCCCCCEEEEEECccCccccCCHH--


Q ss_pred             hcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhh
Q psy5059         402 LCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKE  460 (1036)
Q Consensus       402 l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~  460 (1036)
                                                 ...+..........+||+++..+++++....+
T Consensus       134 ---------------------------~~~~~~~~~~~~~e~Sa~~~~~v~~~f~~ia~  165 (215)
T PTZ00132        134 ---------------------------QITFHRKKNLQYYDISAKSNYNFEKPFLWLAR  165 (215)
T ss_pred             ---------------------------HHHHHHHcCCEEEEEeCCCCCCHHHHHHHHHH


No 302
>cd01849 YlqF_related_GTPase YlqF-related GTPases.  These proteins are found in bacteria, eukaryotes, and archaea.  They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=96.21  E-value=0.0052  Score=62.41  Aligned_cols=44  Identities=32%  Similarity=0.285  Sum_probs=32.2

Q ss_pred             CCCeEEEeccCCCchHHHHHhhhcCCcccccCC-ccccccEEEee
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIG-IVTRRPLILQL   49 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~-~~trrpl~l~l   49 (1036)
                      .-+.|++||.+||||||++|+|.|..-.+.+.+ ..|+++....+
T Consensus        99 ~~~~~~~~G~~~~GKstlin~l~~~~~~~~~~~~~~t~~~~~~~~  143 (155)
T cd01849          99 KSITVGVIGYPNVGKSSVINALLNKLKLKVGNVPGTTTSQQEVKL  143 (155)
T ss_pred             cCcEEEEEccCCCCHHHHHHHHHccccccccCCCCcccceEEEEe
Confidence            457899999999999999999999654443322 34677665543


No 303
>PRK12298 obgE GTPase CgtA; Reviewed
Probab=96.21  E-value=0.0048  Score=72.36  Aligned_cols=45  Identities=18%  Similarity=0.187  Sum_probs=31.6

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCcccccCCccccccEEEeecc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYY   51 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~l~l~~   51 (1036)
                      ++.|++||+||||||||||+|++....-...--.||.|..-.++.
T Consensus       159 iadValVG~PNaGKSTLln~Lt~~k~~vs~~p~TT~~p~~Giv~~  203 (390)
T PRK12298        159 LADVGLLGLPNAGKSTFIRAVSAAKPKVADYPFTTLVPNLGVVRV  203 (390)
T ss_pred             cccEEEEcCCCCCHHHHHHHHhCCcccccCCCCCccCcEEEEEEe
Confidence            458999999999999999999985411111122477777766543


No 304
>cd01887 IF2_eIF5B IF2/eIF5B (initiation factors 2/ eukaryotic initiation factor 5B) subfamily.  IF2/eIF5B contribute to ribosomal subunit joining and function as GTPases that are maximally activated by the presence of both ribosomal subunits.  As seen in other GTPases, IF2/IF5B undergoes conformational changes between its GTP- and GDP-bound states.  Eukaryotic IF2/eIF5Bs possess three characteristic segments, including a divergent N-terminal region followed by conserved central and C-terminal segments.  This core region is conserved among all known eukaryotic and archaeal IF2/eIF5Bs and eubacterial IF2s.
Probab=96.20  E-value=0.0033  Score=63.55  Aligned_cols=27  Identities=19%  Similarity=0.487  Sum_probs=24.3

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      |.|+|||.+||||||++|+|.+..+.+
T Consensus         1 ~~i~iiG~~~~GKtsli~~l~~~~~~~   27 (168)
T cd01887           1 PVVTVMGHVDHGKTTLLDKIRKTNVAA   27 (168)
T ss_pred             CEEEEEecCCCCHHHHHHHHHhccccc
Confidence            789999999999999999999876643


No 305
>cd04178 Nucleostemin_like Nucleostemin-like.  Nucleostemin (NS) is a nucleolar protein that functions as a regulator of cell growth and proliferation in stem cells and in several types of cancer cells, but is not expressed in the differentiated cells of most mammalian adult tissues.  NS shuttles between the nucleolus and nucleoplasm bidirectionally at a rate that is fast and independent of cell type.  Lowering GTP levels decreases the nucleolar retention of NS, and expression of NS is abruptly down-regulated during differentiation prior to terminal cell division.  Found only in eukaryotes, NS consists of an N-terminal basic domain, a coiled-coil domain, a GTP-binding domain, an intermediate domain, and a C-terminal acidic domain.  Experimental evidence indicates that NS uses its GTP-binding property as a molecular switch to control the transition between the nucleolus and nucleoplasm, and this process involves interaction between the basic, GTP-binding, and intermediate domains of the 
Probab=96.17  E-value=0.0034  Score=65.36  Aligned_cols=27  Identities=37%  Similarity=0.343  Sum_probs=23.5

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      -+|+|||.||||||||+|+|.|..-.+
T Consensus       118 ~~~~~vG~pnvGKSslin~l~~~~~~~  144 (172)
T cd04178         118 ITVGVVGFPNVGKSSLINSLKRSRACN  144 (172)
T ss_pred             cEEEEEcCCCCCHHHHHHHHhCcccce
Confidence            389999999999999999999966433


No 306
>KOG0091|consensus
Probab=96.16  E-value=0.13  Score=52.51  Aligned_cols=24  Identities=29%  Similarity=0.635  Sum_probs=21.1

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      +++|+||.-+||||||...+.-.|
T Consensus        10 rlivigdstvgkssll~~ft~gkf   33 (213)
T KOG0091|consen   10 RLIVIGDSTVGKSSLLRYFTEGKF   33 (213)
T ss_pred             EEEEEcCCcccHHHHHHHHhcCcc
Confidence            689999999999999999876654


No 307
>PRK09601 GTP-binding protein YchF; Reviewed
Probab=96.14  E-value=0.0046  Score=71.45  Aligned_cols=39  Identities=21%  Similarity=0.253  Sum_probs=29.8

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCcccccCCccccccEE
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLI   46 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~   46 (1036)
                      .+|++||.||||||||||+|.|..-.......+|+.|..
T Consensus         3 ~~vgIVG~PNvGKSTLfnaLt~~~~~v~nypftTi~p~~   41 (364)
T PRK09601          3 LKCGIVGLPNVGKSTLFNALTKAGAEAANYPFCTIEPNV   41 (364)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCCCeecccccccccceE
Confidence            589999999999999999999976332333445666754


No 308
>KOG0092|consensus
Probab=96.10  E-value=0.0082  Score=62.63  Aligned_cols=25  Identities=32%  Similarity=0.562  Sum_probs=22.0

Q ss_pred             CceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      -+||++|+-|+||||++...+--+|
T Consensus         6 ~KvvLLG~~~VGKSSlV~Rfvk~~F   30 (200)
T KOG0092|consen    6 FKVVLLGDSGVGKSSLVLRFVKDQF   30 (200)
T ss_pred             EEEEEECCCCCCchhhhhhhhhCcc
Confidence            3799999999999999999887766


No 309
>cd04159 Arl10_like Arl10-like subfamily.  Arl9/Arl10 was identified from a human cancer-derived EST dataset.  No functional information about the subfamily is available at the current time, but crystal structures of human Arl10b and Arl10c have been solved.
Probab=96.05  E-value=0.0041  Score=61.44  Aligned_cols=24  Identities=38%  Similarity=0.767  Sum_probs=22.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      +|++||.+|||||||+++|.|..|
T Consensus         1 ~i~i~G~~~~GKssl~~~l~~~~~   24 (159)
T cd04159           1 EITLVGLQNSGKTTLVNVIAGGQF   24 (159)
T ss_pred             CEEEEcCCCCCHHHHHHHHccCCC
Confidence            589999999999999999999876


No 310
>cd01868 Rab11_like Rab11-like.  Rab11a, Rab11b, and Rab25 are closely related, evolutionary conserved Rab proteins that are differentially expressed. Rab11a is ubiquitously synthesized, Rab11b is enriched in brain and heart and Rab25 is only found in epithelia. Rab11/25 proteins seem to regulate recycling pathways from endosomes to the plasma membrane and to the trans-Golgi network. Furthermore, Rab11a is thought to function in the histamine-induced fusion of tubulovesicles containing H+, K+ ATPase with the plasma membrane in gastric parietal cells and in insulin-stimulated insertion of GLUT4 in the plasma membrane of cardiomyocytes. Overexpression of Rab25 has recently been observed in ovarian cancer and breast cancer, and has been correlated with worsened outcomes in both diseases. In addition, Rab25 overexpression has also been observed in prostate cancer, transitional cell carcinoma of the bladder, and invasive breast tumor cells. GTPase activating proteins (GAPs) interact with GTP
Probab=96.01  E-value=0.0072  Score=61.10  Aligned_cols=29  Identities=24%  Similarity=0.432  Sum_probs=25.7

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCccccc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLPRG   36 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~pr~   36 (1036)
                      ..|+|||.+||||||+++++.+..|.+..
T Consensus         4 ~ki~vvG~~~~GKSsli~~l~~~~~~~~~   32 (165)
T cd01868           4 FKIVLIGDSGVGKSNLLSRFTRNEFNLDS   32 (165)
T ss_pred             eEEEEECCCCCCHHHHHHHHhcCCCCCCC
Confidence            57999999999999999999998876543


No 311
>PRK09602 translation-associated GTPase; Reviewed
Probab=96.01  E-value=0.0054  Score=72.03  Aligned_cols=41  Identities=20%  Similarity=0.129  Sum_probs=32.4

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCcccccCCccccccEEEe
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQ   48 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~l~   48 (1036)
                      .+|++||.||||||||||+|.|..+......-+|+.|.+=.
T Consensus         2 ~kigivG~pnvGKSTlfn~Lt~~~~~~~~y~f~t~~p~~g~   42 (396)
T PRK09602          2 ITIGLVGKPNVGKSTFFNAATLADVEIANYPFTTIDPNVGV   42 (396)
T ss_pred             cEEEEECCCCCCHHHHHHHHhCCcccccCCCCcceeeeeee
Confidence            47999999999999999999998765444445677777643


No 312
>PRK09866 hypothetical protein; Provisional
Probab=95.97  E-value=0.0064  Score=73.91  Aligned_cols=43  Identities=30%  Similarity=0.488  Sum_probs=38.5

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCcccccCCccccccEEEeec
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLY   50 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~l~l~   50 (1036)
                      |.|||||..|+|||||+|+|+|.+.+|.|.+-+|..|..+...
T Consensus        70 ~~valvG~sgaGKSTLiNaL~G~~Vlpt~~~~~t~lpT~i~~~  112 (741)
T PRK09866         70 MVLAIVGTMKAGKSTTINAIVGTEVLPNRNRPMTALPTLIRHT  112 (741)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCCccccCCCcccccccEEEEec
Confidence            8999999999999999999999999999988888888865543


No 313
>TIGR00436 era GTP-binding protein Era. Era is an essential GTPase in Escherichia coli and many other bacteria. It plays a role in ribosome biogenesis. Few bacteria lack this protein.
Probab=95.89  E-value=0.0048  Score=68.66  Aligned_cols=24  Identities=25%  Similarity=0.584  Sum_probs=21.8

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      -|++||+||||||||+|+|+|..+
T Consensus         2 ~V~liG~pnvGKSTLln~L~~~~~   25 (270)
T TIGR00436         2 FVAILGRPNVGKSTLLNQLHGQKI   25 (270)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCcE
Confidence            489999999999999999999753


No 314
>COG1084 Predicted GTPase [General function prediction only]
Probab=95.86  E-value=0.0054  Score=68.88  Aligned_cols=27  Identities=41%  Similarity=0.586  Sum_probs=24.5

Q ss_pred             CCCCeEEEeccCCCchHHHHHhhhcCC
Q psy5059           5 IQLPQIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         5 ~~lp~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .++|+|+|.|.|||||||++..|.|-+
T Consensus       166 p~~pTivVaG~PNVGKSSlv~~lT~Ak  192 (346)
T COG1084         166 PDLPTIVVAGYPNVGKSSLVRKLTTAK  192 (346)
T ss_pred             CCCCeEEEecCCCCcHHHHHHHHhcCC
Confidence            479999999999999999999998844


No 315
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription]
Probab=95.78  E-value=0.039  Score=58.09  Aligned_cols=52  Identities=19%  Similarity=0.186  Sum_probs=38.5

Q ss_pred             EEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhh
Q psy5059         383 LAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAK  459 (1036)
Q Consensus       383 i~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~  459 (1036)
                      +.||||.||.+.                   +|      +.++.+.+.--+--.-.|+.++|+++|+..+++++..+
T Consensus       146 llVInK~DLa~~-------------------v~------~dlevm~~da~~~np~~~ii~~n~ktg~G~~~~~~~i~  197 (202)
T COG0378         146 LLVINKTDLAPY-------------------VG------ADLEVMARDAKEVNPEAPIIFTNLKTGEGLDEWLRFIE  197 (202)
T ss_pred             EEEEehHHhHHH-------------------hC------ccHHHHHHHHHHhCCCCCEEEEeCCCCcCHHHHHHHHH
Confidence            789999999853                   22      33344444445556778999999999999999987754


No 316
>PRK00089 era GTPase Era; Reviewed
Probab=95.78  E-value=0.0098  Score=66.80  Aligned_cols=25  Identities=32%  Similarity=0.638  Sum_probs=22.6

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      -|+|||.+|||||||+|+|+|..+-
T Consensus         7 ~V~iiG~pn~GKSTLin~L~g~~~~   31 (292)
T PRK00089          7 FVAIVGRPNVGKSTLLNALVGQKIS   31 (292)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCcee
Confidence            5899999999999999999997653


No 317
>cd01854 YjeQ_engC YjeQ/EngC.  YjeQ (YloQ in Bacillus subtilis) represents a protein family whose members are broadly conserved in bacteria and have been shown to be essential to the growth of E. coli and B. subtilis. Proteins of the YjeQ family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. All YjeQ family proteins display a unique domain architecture, which includes an N-terminal OB-fold RNA-binding domain, the central permuted GTPase domain, and a zinc knuckle-like C-terminal cysteine domain. This domain architecture suggests a role for YjeQ as a regulator of translation.
Probab=95.78  E-value=0.022  Score=64.18  Aligned_cols=109  Identities=16%  Similarity=0.260  Sum_probs=0.0

Q ss_pred             ccccEEEeeccCCCch-----------------------hhhhhhHHHHHHHHHhhhhcCCCCCCCCceEEeCcCCCChh
Q psy5059          41 TRRPLILQLYYCPKDD-----------------------REKRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKS   97 (1036)
Q Consensus        41 trrpl~l~l~~~~~~~-----------------------~~~~~~~~l~~kL~~~~~~~g~~~i~lPqIvVvG~QSsGKS   97 (1036)
                      ...|+++.+||+|-..                       ....++-++.+.|..            ..++++|..++|||
T Consensus       108 ~~ip~iIVlNK~DL~~~~~~~~~~~~~~~~g~~v~~vSA~~g~gi~~L~~~L~~------------k~~~~~G~sg~GKS  175 (287)
T cd01854         108 AGIEPVIVLTKADLLDDEEEELELVEALALGYPVLAVSAKTGEGLDELREYLKG------------KTSVLVGQSGVGKS  175 (287)
T ss_pred             cCCCEEEEEEHHHCCChHHHHHHHHHHHhCCCeEEEEECCCCccHHHHHhhhcc------------ceEEEECCCCCCHH


Q ss_pred             hHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhccCCCCccccccccccccccccchhhhhhhhhHHHHHhh
Q psy5059          98 SVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLA  177 (1036)
Q Consensus        98 SlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~df~~~r~ei~~e~~r~~  177 (1036)
                      ||+++|+|..                                                                      
T Consensus       176 Tlin~l~~~~----------------------------------------------------------------------  185 (287)
T cd01854         176 TLINALLPDL----------------------------------------------------------------------  185 (287)
T ss_pred             HHHHHHhchh----------------------------------------------------------------------


Q ss_pred             ccCCCcccccccccccccccCCcccCChhHHHHHHHHHHHHhcC---CCCCcCCCcEEEEEeecCcccceeecCCCcccc
Q psy5059         178 GKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAG---KNKGICSEPIILKIYSTSVLNLTLVDLPGITKV  254 (1036)
Q Consensus       178 ~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~~~~~~g---~~~~~S~d~I~L~I~~P~~~~LtlVDLPGi~~~  254 (1036)
                                                         ...+..+..   .++..+.+.-.+.+.+-.    .++|+||+...
T Consensus       186 -----------------------------------~~~~g~v~~~~~~g~~tT~~~~~~~~~~~~----~liDtPG~~~~  226 (287)
T cd01854         186 -----------------------------------DLATGEISEKLGRGRHTTTHRELFPLPGGG----LLIDTPGFREF  226 (287)
T ss_pred             -----------------------------------hccccceeccCCCCCcccceEEEEEcCCCC----EEEECCCCCcc


Q ss_pred             C-CCCCchhHHHHHHHH
Q psy5059         255 P-VGDQPDDIEAQIKQL  270 (1036)
Q Consensus       255 ~-~~~q~~di~~~ir~l  270 (1036)
                      . ....+.++.....++
T Consensus       227 ~~~~~~~~~~~~~f~~~  243 (287)
T cd01854         227 GLLHIDPEELAHYFPEF  243 (287)
T ss_pred             CCccCCHHHHHHHhHHH


No 318
>cd04163 Era Era subfamily.  Era (E. coli Ras-like protein) is a multifunctional GTPase found in all bacteria except some eubacteria.  It binds to the 16S ribosomal RNA (rRNA) of the 30S subunit and appears to play a role in the assembly of the 30S subunit, possibly by chaperoning the 16S rRNA.  It also contacts several assembly elements of the 30S subunit.  Era couples cell growth with cytokinesis and plays a role in cell division and energy metabolism.  Homologs have also been found in eukaryotes. Era contains two domains: the N-terminal GTPase domain and a C-terminal domain KH domain that is critical for RNA binding.  Both domains are important for Era function.  Era is functionally able to compensate for deletion of RbfA, a cold-shock adaptation protein that is required for efficient processing of the 16S rRNA.
Probab=95.78  E-value=0.011  Score=58.69  Aligned_cols=29  Identities=28%  Similarity=0.455  Sum_probs=25.0

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCcccc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSFLPR   35 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~~pr   35 (1036)
                      -..|+++|.+||||||++|+|.|.++-+.
T Consensus         3 ~~~i~~~G~~g~GKttl~~~l~~~~~~~~   31 (168)
T cd04163           3 SGFVAIVGRPNVGKSTLLNALVGQKISIV   31 (168)
T ss_pred             eeEEEEECCCCCCHHHHHHHHhCCceEec
Confidence            35799999999999999999999876443


No 319
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=95.76  E-value=0.06  Score=62.80  Aligned_cols=23  Identities=17%  Similarity=0.450  Sum_probs=20.6

Q ss_pred             CceEEeCcCCCChhhHHhhhcCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      ..|+++|..++|||+++-.|++.
T Consensus       242 ~vI~LVGptGvGKTTTiaKLA~~  264 (436)
T PRK11889        242 QTIALIGPTGVGKTTTLAKMAWQ  264 (436)
T ss_pred             cEEEEECCCCCcHHHHHHHHHHH
Confidence            47899999999999999999864


No 320
>cd01866 Rab2 Rab2 subfamily.  Rab2 is localized on cis-Golgi membranes and interacts with Golgi matrix proteins. Rab2 is also implicated in the maturation of vesicular tubular clusters (VTCs), which are microtubule-associated intermediates in transport between the ER and Golgi apparatus. In plants, Rab2 regulates vesicle trafficking between the ER and the Golgi bodies and is important to pollen tube growth.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key featur
Probab=95.75  E-value=0.01  Score=60.52  Aligned_cols=30  Identities=23%  Similarity=0.416  Sum_probs=25.9

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCcccccC
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLPRGI   37 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~pr~~   37 (1036)
                      ..|+|||.+||||||+++++++..|.+..+
T Consensus         5 ~ki~vvG~~~vGKSsLl~~l~~~~~~~~~~   34 (168)
T cd01866           5 FKYIIIGDTGVGKSCLLLQFTDKRFQPVHD   34 (168)
T ss_pred             eEEEEECCCCCCHHHHHHHHHcCCCCCCCC
Confidence            579999999999999999999988765443


No 321
>KOG0090|consensus
Probab=95.74  E-value=0.074  Score=56.61  Aligned_cols=23  Identities=26%  Similarity=0.248  Sum_probs=19.3

Q ss_pred             cccCCceEEEEecccccCCCchh
Q psy5059         376 DVDGRRTLAVVTKIDLMDAGTDA  398 (1036)
Q Consensus       376 d~~g~rti~VitK~Dl~~~g~~~  398 (1036)
                      -.++-..++..||-|+..+.+..
T Consensus       142 ~~~~~~vLIaCNKqDl~tAkt~~  164 (238)
T KOG0090|consen  142 KKNKPPVLIACNKQDLFTAKTAE  164 (238)
T ss_pred             ccCCCCEEEEecchhhhhcCcHH
Confidence            46788899999999999887764


No 322
>cd04119 RJL RJL (RabJ-Like) subfamily.  RJLs are found in many protists and as chimeras with C-terminal DNAJ domains in deuterostome metazoa. They are not found in plants, fungi, and protostome metazoa, suggesting a horizontal gene transfer between protists and deuterostome metazoa.  RJLs lack any known membrane targeting signal and contain a degenerate phosphate/magnesium-binding 3 (PM3) motif, suggesting an impaired ability to hydrolyze GTP.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.
Probab=95.74  E-value=0.0072  Score=60.74  Aligned_cols=25  Identities=24%  Similarity=0.559  Sum_probs=22.9

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|++||.+||||||+++++.|..|.
T Consensus         2 ki~~vG~~~vGKTsli~~l~~~~~~   26 (168)
T cd04119           2 KVISMGNSGVGKSCIIKRYCEGRFV   26 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCCC
Confidence            5899999999999999999998764


No 323
>cd01876 YihA_EngB The YihA (EngB) subfamily.  This subfamily of GTPases is typified by the E. coli YihA, an essential protein involved in cell division control.  YihA and its orthologs are small proteins that typically contain less than 200 amino acid residues and consists of the GTPase domain only (some of the eukaryotic homologs contain an N-terminal extension of about 120 residues that might be involved in organellar targeting).  Homologs of yihA are found in most Gram-positive and Gram-negative pathogenic bacteria, with the exception of Mycobacterium tuberculosis.  The broad-spectrum nature of YihA and its essentiality for cell viability in bacteria make it an attractive antibacterial target.
Probab=95.74  E-value=0.0075  Score=60.17  Aligned_cols=31  Identities=32%  Similarity=0.461  Sum_probs=26.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcccccCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPRGIGI   39 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~   39 (1036)
                      +|+++|.+|||||||+|+|+|..+.|.-++.
T Consensus         1 ~i~l~G~~g~GKTtL~~~l~~~~~~~~~~~~   31 (170)
T cd01876           1 EIAFAGRSNVGKSSLINALTNRKKLARTSKT   31 (170)
T ss_pred             CEEEEcCCCCCHHHHHHHHhcCCceeeecCC
Confidence            5899999999999999999986666766554


No 324
>KOG1707|consensus
Probab=95.73  E-value=0.017  Score=68.89  Aligned_cols=159  Identities=22%  Similarity=0.277  Sum_probs=0.0

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhccCCCCccccccccccccccccchhh
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFDD  164 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~df~~  164 (1036)
                      +||+|||+++|||||+=+|++.+|                                                        
T Consensus        11 RIvliGD~G~GKtSLImSL~~eef--------------------------------------------------------   34 (625)
T KOG1707|consen   11 RIVLIGDEGVGKTSLIMSLLEEEF--------------------------------------------------------   34 (625)
T ss_pred             EEEEECCCCccHHHHHHHHHhhhc--------------------------------------------------------


Q ss_pred             hhhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHHHHHHhcCCCCCcCCCcEEEEEeecCcccce
Q psy5059         165 IRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICSEPIILKIYSTSVLNLT  244 (1036)
Q Consensus       165 ~r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~~~~~~g~~~~~S~d~I~L~I~~P~~~~Lt  244 (1036)
                                                                         .+.++..    -+....=.=..|+..+.+
T Consensus        35 ---------------------------------------------------~~~VP~r----l~~i~IPadvtPe~vpt~   59 (625)
T KOG1707|consen   35 ---------------------------------------------------VDAVPRR----LPRILIPADVTPENVPTS   59 (625)
T ss_pred             ---------------------------------------------------ccccccc----CCccccCCccCcCcCceE


Q ss_pred             eecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEecccc----ccccchhhhhhhhcCCCCCcccceeccCCC
Q psy5059         245 LVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANT----DMATSESLKLAKETDVDGRRTLDLLDIDLP  320 (1036)
Q Consensus       245 lVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~----D~~~s~al~l~r~~Dp~g~RTigvl~~~~~  320 (1036)
                      +||++-             ..+.+.-+.+-|++.| +|.+|-+.+.    |-..+-|+-++|..-.++-||=.||     
T Consensus        60 ivD~ss-------------~~~~~~~l~~EirkA~-vi~lvyavd~~~T~D~ist~WLPlir~~~~~~~~~PVIL-----  120 (625)
T KOG1707|consen   60 IVDTSS-------------DSDDRLCLRKEIRKAD-VICLVYAVDDESTVDRISTKWLPLIRQLFGDYHETPVIL-----  120 (625)
T ss_pred             EEeccc-------------ccchhHHHHHHHhhcC-EEEEEEecCChHHhhhhhhhhhhhhhcccCCCccCCEEE-----


Q ss_pred             CcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCceEEEEecccccCCCchhhh
Q psy5059         321 GITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAID  400 (1036)
Q Consensus       321 g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~  400 (1036)
                                                                                      |-||.|+.+..+...+
T Consensus       121 ----------------------------------------------------------------vGNK~d~~~~~~~s~e  136 (625)
T KOG1707|consen  121 ----------------------------------------------------------------VGNKSDNGDNENNSDE  136 (625)
T ss_pred             ----------------------------------------------------------------EeeccCCccccccchh


Q ss_pred             hhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhhc
Q psy5059         401 ILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKET  461 (1036)
Q Consensus       401 ~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~v  461 (1036)
                      .   .++|+-.-+-..-+-+.                     +||++..+..+++=+|++.
T Consensus       137 ~---~~~pim~~f~EiEtcie---------------------cSA~~~~n~~e~fYyaqKa  173 (625)
T KOG1707|consen  137 V---NTLPIMIAFAEIETCIE---------------------CSALTLANVSELFYYAQKA  173 (625)
T ss_pred             H---HHHHHHHHhHHHHHHHh---------------------hhhhhhhhhHhhhhhhhhe


No 325
>PF08477 Miro:  Miro-like protein;  InterPro: IPR013684 Mitochondrial Rho proteins (Miro-1, Q8IXI2 from SWISSPROT and Miro-2, Q8IXI1 from SWISSPROT) are atypical Rho GTPases. They have a unique domain organisation, with tandem GTP-binding domains and two EF hand domains (IPR002048 from INTERPRO), that may bind calcium. They are also larger than classical small GTPases. It has been proposed that they are involved in mitochondrial homeostasis and apoptosis []. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction, 0005622 intracellular; PDB: 2IWR_A 2BMJ_A 3IHW_A 2ZEJ_A 3D6T_B 3DPU_A.
Probab=95.72  E-value=0.0068  Score=57.94  Aligned_cols=25  Identities=44%  Similarity=0.723  Sum_probs=21.8

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|+|+|..|||||||+++|+|..+.
T Consensus         1 kI~V~G~~g~GKTsLi~~l~~~~~~   25 (119)
T PF08477_consen    1 KIVVLGDSGVGKTSLIRRLCGGEFP   25 (119)
T ss_dssp             EEEEECSTTSSHHHHHHHHHHSS--
T ss_pred             CEEEECcCCCCHHHHHHHHhcCCCc
Confidence            4899999999999999999998864


No 326
>COG5256 TEF1 Translation elongation factor EF-1alpha (GTPase) [Translation, ribosomal structure and biogenesis]
Probab=95.71  E-value=0.019  Score=66.39  Aligned_cols=20  Identities=30%  Similarity=0.662  Sum_probs=17.6

Q ss_pred             ceEEeCcCCCChhhHHhhhc
Q psy5059          85 QIVVVGTQSSGKSSVIESLV  104 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~  104 (1036)
                      .++++|.--+|||+++=.|.
T Consensus         9 nl~~iGHVD~GKSTl~GrLl   28 (428)
T COG5256           9 NLVFIGHVDAGKSTLVGRLL   28 (428)
T ss_pred             EEEEEcCCCCCchhhhhhhH
Confidence            58999999999999887764


No 327
>COG0532 InfB Translation initiation factor 2 (IF-2; GTPase) [Translation, ribosomal structure and biogenesis]
Probab=95.71  E-value=0.086  Score=62.89  Aligned_cols=69  Identities=25%  Similarity=0.263  Sum_probs=43.3

Q ss_pred             chHHHHHhhhccccCCceEEEEecccccCCCchhh--hhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeee
Q psy5059         365 TSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAI--DILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAV  442 (1036)
Q Consensus       365 ~~~~~~la~~~d~~g~rti~VitK~Dl~~~g~~~~--~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~  442 (1036)
                      +-+|.+.|+..   |.++|..+||+|+.+..-+..  +...-       |++.             .   .+-.-...+-
T Consensus        96 TiEAI~hak~a---~vP~iVAiNKiDk~~~np~~v~~el~~~-------gl~~-------------E---~~gg~v~~Vp  149 (509)
T COG0532          96 TIEAINHAKAA---GVPIVVAINKIDKPEANPDKVKQELQEY-------GLVP-------------E---EWGGDVIFVP  149 (509)
T ss_pred             HHHHHHHHHHC---CCCEEEEEecccCCCCCHHHHHHHHHHc-------CCCH-------------h---hcCCceEEEE
Confidence            34556666655   899999999999996544422  00000       1110             0   1111256778


Q ss_pred             ecccchhhhHHHHHHhh
Q psy5059         443 VTANTDMATSESLKLAK  459 (1036)
Q Consensus       443 ISA~td~~~qeil~la~  459 (1036)
                      +||++|.+..+++.+..
T Consensus       150 vSA~tg~Gi~eLL~~il  166 (509)
T COG0532         150 VSAKTGEGIDELLELIL  166 (509)
T ss_pred             eeccCCCCHHHHHHHHH
Confidence            99999999999987753


No 328
>cd00154 Rab Rab family.  Rab GTPases form the largest family within the Ras superfamily.  There are at least 60 Rab genes in the human genome, and a number of Rab GTPases are conserved from yeast to humans. Rab GTPases are small, monomeric proteins that function as molecular switches to regulate vesicle trafficking pathways.  The different Rab GTPases are localized to the cytosolic face of specific intracellular membranes, where they regulate distinct steps in membrane traffic pathways. In the GTP-bound form, Rab GTPases recruit specific sets of effector proteins onto membranes. Through their effectors, Rab GTPases regulate vesicle formation, actin- and tubulin-dependent vesicle movement, and membrane fusion.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide di
Probab=95.69  E-value=0.012  Score=58.03  Aligned_cols=27  Identities=30%  Similarity=0.524  Sum_probs=24.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPR   35 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr   35 (1036)
                      .|++||.++|||||+++++.+..+.+.
T Consensus         2 ~i~~~G~~~~GKStl~~~l~~~~~~~~   28 (159)
T cd00154           2 KIVLIGDSGVGKTSLLLRFVDGKFDEN   28 (159)
T ss_pred             eEEEECCCCCCHHHHHHHHHhCcCCCc
Confidence            689999999999999999999887664


No 329
>PRK15467 ethanolamine utilization protein EutP; Provisional
Probab=95.66  E-value=0.0078  Score=61.45  Aligned_cols=23  Identities=30%  Similarity=0.608  Sum_probs=21.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .|++||++|||||||||+|.|..
T Consensus         3 ~i~~iG~~~~GKstl~~~l~~~~   25 (158)
T PRK15467          3 RIAFVGAVGAGKTTLFNALQGNY   25 (158)
T ss_pred             EEEEECCCCCCHHHHHHHHcCCC
Confidence            69999999999999999999864


No 330
>PRK10416 signal recognition particle-docking protein FtsY; Provisional
Probab=95.65  E-value=0.066  Score=61.24  Aligned_cols=22  Identities=41%  Similarity=0.604  Sum_probs=20.7

Q ss_pred             eEEEeccCCCchHHHHHhhhcC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGK   30 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~   30 (1036)
                      .|++||.+||||||++-.|.+.
T Consensus       116 vi~lvGpnGsGKTTt~~kLA~~  137 (318)
T PRK10416        116 VILVVGVNGVGKTTTIGKLAHK  137 (318)
T ss_pred             EEEEECCCCCcHHHHHHHHHHH
Confidence            6889999999999999999985


No 331
>cd01899 Ygr210 Ygr210 subfamily.  Ygr210 is a member of Obg-like family and present in archaea and fungi.  They are characterized by a distinct glycine-rich motif immediately following the Walker B motif.  The Ygr210 and YyaF/YchF subfamilies appear to form one major branch of the Obg-like family.  Among eukaryotes, the Ygr210 subfamily is represented only in fungi.  These fungal proteins form a tight cluster with their archaeal orthologs, which suggests the possibility of horizontal transfer from archaea to fungi.
Probab=95.63  E-value=0.0085  Score=68.42  Aligned_cols=37  Identities=22%  Similarity=0.238  Sum_probs=28.6

Q ss_pred             EEEeccCCCchHHHHHhhhcCCcccccCCccccccEE
Q psy5059          10 IVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLI   46 (1036)
Q Consensus        10 i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~   46 (1036)
                      |++||.|||||||+||+|.+..+.+....-+|+.|.+
T Consensus         1 i~ivG~pnvGKStLfn~lt~~~~~~~~~pftT~~p~~   37 (318)
T cd01899           1 IGLVGKPNAGKSTFFNAATLADVEIANYPFTTIDPNV   37 (318)
T ss_pred             CEEECCCCCCHHHHHHHHhCCCCcccCCCCcccccee
Confidence            6899999999999999999977643333346666765


No 332
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily.  H-Ras, N-Ras, and K-Ras4A/4B are the prototypical members of the Ras family.  These isoforms generate distinct signal outputs despite interacting with a common set of activators and effectors, and are strongly associated with oncogenic progression in tumor initiation.  Mutated versions of Ras that are insensitive to GAP stimulation (and are therefore constitutively active) are found in a significant fraction of human cancers.  Many Ras guanine nucleotide exchange factors (GEFs) have been identified.  They are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active (GTP-bound) Ras interacts with several effector proteins that stimulate a variety of diverse cytoplasmic signaling activities.  Some are known to positively mediate the oncogenic properties of Ras, including Raf, phosphatidylinositol 3-kinase (PI3K), RalGEFs, and Tiam1.  
Probab=95.63  E-value=0.0082  Score=59.93  Aligned_cols=26  Identities=35%  Similarity=0.568  Sum_probs=23.2

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      ..|+++|.+||||||+++++++..|.
T Consensus         2 ~ki~iiG~~~vGKTsl~~~~~~~~~~   27 (162)
T cd04138           2 YKLVVVGAGGVGKSALTIQLIQNHFV   27 (162)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhCCCc
Confidence            36999999999999999999987763


No 333
>COG1161 Predicted GTPases [General function prediction only]
Probab=95.61  E-value=0.0077  Score=68.89  Aligned_cols=23  Identities=43%  Similarity=0.679  Sum_probs=21.5

Q ss_pred             EEEeccCCCchHHHHHhhhcCCc
Q psy5059          10 IVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus        10 i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      +.|||.|||||||++|+|+|+.-
T Consensus       135 v~vvG~PNVGKSslIN~L~~k~~  157 (322)
T COG1161         135 VGVVGYPNVGKSTLINRLLGKKV  157 (322)
T ss_pred             EEEEcCCCCcHHHHHHHHhcccc
Confidence            89999999999999999999764


No 334
>PF00448 SRP54:  SRP54-type protein, GTPase domain;  InterPro: IPR000897  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. This entry represents the GTPase domain of the 54 kDa SRP54 component, a GTP-binding protein that interacts with the signal sequence when it emerges from the ribosome. SRP54 of the signal recognition particle has a three-domain structure: an N-terminal helical bundle domain, a GTPase domain, and the M-domain that binds the 7s RNA and also binds the signal sequence. The extreme C-terminal region is glycine-rich and lower in complexity and poorly conserved between species. The GTPase domain is evolutionary related to P-loop NTPase domains found in a variety of other proteins []. These proteins include Escherichia coli and Bacillus subtilis ffh protein (P48), which seems to be the prokaryotic counterpart of SRP54; signal recognition particle receptor alpha subunit (docking protein), an integral membrane GTP-binding protein which ensures, in conjunction with SRP, the correct targeting of nascent secretory proteins to the endoplasmic reticulum membrane; bacterial FtsY protein, which is believed to play a similar role to that of the docking protein in eukaryotes; the pilA protein from Neisseria gonorrhoeae, the homologue of ftsY; and bacterial flagellar biosynthesis protein flhF.; GO: 0005525 GTP binding, 0006614 SRP-dependent cotranslational protein targeting to membrane; PDB: 2OG2_A 3B9Q_A 3DM9_B 3DMD_B 3E70_C 3DM5_B 2XXA_C 2J28_9 1ZU5_B 1ZU4_A ....
Probab=95.56  E-value=0.1  Score=55.53  Aligned_cols=23  Identities=30%  Similarity=0.523  Sum_probs=19.8

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .|++||.+||||||.+=.|.-+-
T Consensus         3 vi~lvGptGvGKTTt~aKLAa~~   25 (196)
T PF00448_consen    3 VIALVGPTGVGKTTTIAKLAARL   25 (196)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHHH
T ss_pred             EEEEECCCCCchHhHHHHHHHHH
Confidence            47899999999999998887643


No 335
>cd01862 Rab7 Rab7 subfamily.  Rab7 is a small Rab GTPase that regulates vesicular traffic from early to late endosomal stages of the endocytic pathway.  The yeast Ypt7 and mammalian Rab7 are both involved in transport to the vacuole/lysosome, whereas Ypt7 is also required for homotypic vacuole fusion.  Mammalian Rab7 is an essential participant in the autophagic pathway for sequestration and targeting of cytoplasmic components to the lytic compartment. Mammalian Rab7 is also proposed to function as a tumor suppressor. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-
Probab=95.55  E-value=0.014  Score=59.26  Aligned_cols=28  Identities=25%  Similarity=0.552  Sum_probs=24.3

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPRG   36 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr~   36 (1036)
                      .|+|||.+||||||+++++++..+.+..
T Consensus         2 ki~viG~~~~GKSsl~~~l~~~~~~~~~   29 (172)
T cd01862           2 KVIILGDSGVGKTSLMNQYVNKKFSNQY   29 (172)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCcCc
Confidence            4899999999999999999998775543


No 336
>cd04171 SelB SelB subfamily.  SelB is an elongation factor needed for the co-translational incorporation of selenocysteine.  Selenocysteine is coded by a UGA stop codon in combination with a specific downstream mRNA hairpin.  In bacteria, the C-terminal part of SelB recognizes this hairpin, while the N-terminal part binds GTP and tRNA in analogy with elongation factor Tu (EF-Tu).  It specifically recognizes the selenocysteine charged tRNAsec, which has a UCA anticodon, in an EF-Tu like manner. This allows insertion of selenocysteine at in-frame UGA stop codons.  In E. coli SelB binds GTP, selenocysteyl-tRNAsec, and a stem-loop structure immediately downstream of the UGA codon (the SECIS sequence).  The absence of active SelB prevents the participation of selenocysteyl-tRNAsec in translation.  Archaeal and animal mechanisms of selenocysteine incorporation are more complex.  Although the SECIS elements have different secondary structures and conserved elements between archaea and eukaryo
Probab=95.52  E-value=0.0079  Score=60.27  Aligned_cols=22  Identities=32%  Similarity=0.501  Sum_probs=20.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGK   30 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~   30 (1036)
                      .|+|+|.+||||||++++|+|.
T Consensus         2 ~i~i~G~~~~GKssl~~~l~~~   23 (164)
T cd04171           2 IIGTAGHIDHGKTTLIKALTGI   23 (164)
T ss_pred             EEEEEecCCCCHHHHHHHHhCc
Confidence            5899999999999999999874


No 337
>cd01895 EngA2 EngA2 subfamily.  This CD represents the second GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family.  Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability. A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=95.51  E-value=0.013  Score=58.87  Aligned_cols=28  Identities=29%  Similarity=0.523  Sum_probs=24.7

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      .++|+++|.+||||||++|+|+|..+.+
T Consensus         2 ~~~i~i~G~~~~GKstli~~l~~~~~~~   29 (174)
T cd01895           2 PIRIAIIGRPNVGKSSLVNALLGEERVI   29 (174)
T ss_pred             CcEEEEEcCCCCCHHHHHHHHhCcccee
Confidence            5789999999999999999999976543


No 338
>cd01867 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2.  Rab8/Sec4/Ypt2 are known or suspected to be involved in post-Golgi transport to the plasma membrane. It is likely that these Rabs have functions that are specific to the mammalian lineage and have no orthologs in plants. Rab8 modulates polarized membrane transport through reorganization of actin and microtubules, induces the formation of new surface extensions, and has an important role in directed membrane transport to cell surfaces. The Ypt2 gene of the fission yeast Schizosaccharomyces pombe encodes a member of the Ypt/Rab family of small GTP-binding proteins, related in sequence to Sec4p of Saccharomyces cerevisiae but closer to mammalian Rab8.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhi
Probab=95.50  E-value=0.0096  Score=60.66  Aligned_cols=27  Identities=26%  Similarity=0.470  Sum_probs=24.2

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      ...|++||.+||||||+++++.+..|-
T Consensus         3 ~~ki~vvG~~~~GKSsl~~~~~~~~f~   29 (167)
T cd01867           3 LFKLLLIGDSGVGKSCLLLRFSEDSFN   29 (167)
T ss_pred             ceEEEEECCCCCCHHHHHHHHhhCcCC
Confidence            367999999999999999999997763


No 339
>cd01855 YqeH YqeH.  YqeH is an essential GTP-binding protein. Depletion of YqeH induces an excess initiation of DNA replication, suggesting that it negatively controls initiation of chromosome replication. The YqeH subfamily is common in eukaryotes and sporadically present in bacteria with probable acquisition by plants from chloroplasts.  Proteins of the YqeH family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases.
Probab=95.48  E-value=0.012  Score=61.70  Aligned_cols=25  Identities=36%  Similarity=0.558  Sum_probs=22.4

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      ..|++||.+|||||||+|+|.|...
T Consensus       128 ~~~~~~G~~nvGKStliN~l~~~~~  152 (190)
T cd01855         128 GDVYVVGATNVGKSTLINALLKKDN  152 (190)
T ss_pred             CcEEEEcCCCCCHHHHHHHHHHhcc
Confidence            4799999999999999999998553


No 340
>cd01857 HSR1_MMR1 HSR1/MMR1.  Human HSR1, is localized to the human MHC class I region and is highly homologous to a putative GTP-binding protein, MMR1 from mouse. These proteins represent a new subfamily of GTP-binding proteins that has only eukaryote members. This subfamily shows a circular permutation of the GTPase signature motifs so that the C-terminal strands 5, 6, and 7 (strand 6 contains the G4 box with sequence NKXD) are relocated to the N terminus.
Probab=95.47  E-value=0.017  Score=57.78  Aligned_cols=26  Identities=46%  Similarity=0.622  Sum_probs=23.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      .++++|.+|||||||+|+|.|..+.+
T Consensus        85 ~~~~~G~~~vGKstlin~l~~~~~~~  110 (141)
T cd01857          85 TIGLVGYPNVGKSSLINALVGKKKVS  110 (141)
T ss_pred             EEEEECCCCCCHHHHHHHHhCCCcee
Confidence            68999999999999999999977653


No 341
>PF03029 ATP_bind_1:  Conserved hypothetical ATP binding protein;  InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity.; GO: 0000166 nucleotide binding; PDB: 1YR7_A 1YRA_B 1YR8_A 1YR6_A 1YR9_A 1YRB_A 2OXR_A.
Probab=95.45  E-value=0.038  Score=60.64  Aligned_cols=72  Identities=11%  Similarity=0.114  Sum_probs=43.6

Q ss_pred             cCCceEEEEecccccCCCchhhhhhcCcccccccccccccchH-------HHHHHHHHHhhccCCCcc-eeeeecccchh
Q psy5059         378 DGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYI-------EAQIKQLVLHYISNPNSI-ILAVVTANTDM  449 (1036)
Q Consensus       378 ~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~-------~~~l~~~v~~~i~~~~~i-pla~ISA~td~  449 (1036)
                      -+-+.|-|+||+|+..+..+           ..+.|......+       .+.+...+...+...... ....+|+.++.
T Consensus       155 ~~lP~vnvlsK~Dl~~~~~~-----------~~l~~~~d~~~l~~~~~~~~~~l~~~i~~~l~~~~~~~~f~pls~~~~~  223 (238)
T PF03029_consen  155 LELPHVNVLSKIDLLSKYLE-----------FILEWFEDPDSLEDLLESDYKKLNEEIAELLDDFGLVIRFIPLSSKDGE  223 (238)
T ss_dssp             HTSEEEEEE--GGGS-HHHH-----------HHHHHHHSHHHHHHHHHT-HHHHHHHHHHHCCCCSSS---EE-BTTTTT
T ss_pred             CCCCEEEeeeccCcccchhH-----------HHHHHhcChHHHHHHHHHHHHHHHHHHHHHHhhcCCCceEEEEECCChH
Confidence            47899999999999974311           011111111111       356777788888777777 88889999999


Q ss_pred             hhHHHHHHhhh
Q psy5059         450 ATSESLKLAKE  460 (1036)
Q Consensus       450 ~~qeil~la~~  460 (1036)
                      ...+++..+.+
T Consensus       224 ~~~~L~~~id~  234 (238)
T PF03029_consen  224 GMEELLAAIDK  234 (238)
T ss_dssp             THHHHHHHHHH
T ss_pred             HHHHHHHHHHH
Confidence            99998887654


No 342
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion]
Probab=95.45  E-value=0.18  Score=58.97  Aligned_cols=43  Identities=19%  Similarity=0.385  Sum_probs=27.5

Q ss_pred             CcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEecc
Q psy5059         239 SVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTA  288 (1036)
Q Consensus       239 ~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~A  288 (1036)
                      ...|+.+|||.|=.+     ..++..+.++++  +-+-+|+-++|+++.+
T Consensus       181 ~~~DvvIvDTAGRl~-----ide~Lm~El~~I--k~~~~P~E~llVvDam  223 (451)
T COG0541         181 EGYDVVIVDTAGRLH-----IDEELMDELKEI--KEVINPDETLLVVDAM  223 (451)
T ss_pred             cCCCEEEEeCCCccc-----ccHHHHHHHHHH--HhhcCCCeEEEEEecc
Confidence            346788999999432     345555555555  5566777666666544


No 343
>KOG0075|consensus
Probab=95.45  E-value=0.056  Score=54.18  Aligned_cols=37  Identities=27%  Similarity=0.473  Sum_probs=28.5

Q ss_pred             cceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccc
Q psy5059         242 NLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTD  291 (1036)
Q Consensus       242 ~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D  291 (1036)
                      ...+.|+||-        |     ..|+|-..|-+.-+.|+-+|++|..|
T Consensus        66 tiklwD~gGq--------~-----rfrsmWerycR~v~aivY~VDaad~~  102 (186)
T KOG0075|consen   66 TIKLWDLGGQ--------P-----RFRSMWERYCRGVSAIVYVVDAADPD  102 (186)
T ss_pred             EEEEEecCCC--------c-----cHHHHHHHHhhcCcEEEEEeecCCcc
Confidence            3346789993        3     46899999999999888888877644


No 344
>TIGR01425 SRP54_euk signal recognition particle protein SRP54. This model represents examples from the eukaryotic cytosol of the signal recognition particle protein component, SRP54. This GTP-binding protein is a component of the eukaryotic signal recognition particle, along with several other protein subunits and a 7S RNA. Some species, including Arabidopsis, have several closely related forms. The extreme C-terminal region is glycine-rich and lower in complexity, poorly conserved between species, and excluded from this model.
Probab=95.43  E-value=0.081  Score=62.64  Aligned_cols=32  Identities=19%  Similarity=0.236  Sum_probs=22.8

Q ss_pred             CCceEEEEecccccCCCchhhhhhcCcccccc
Q psy5059         379 GRRTLAVVTKIDLMDAGTDAIDILCGRVIPVK  410 (1036)
Q Consensus       379 g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~  410 (1036)
                      ...+-.|+||+|-..+|..++.+..---.|++
T Consensus       239 ~~~~g~IlTKlD~~argG~aLs~~~~t~~PI~  270 (429)
T TIGR01425       239 VDVGSVIITKLDGHAKGGGALSAVAATKSPII  270 (429)
T ss_pred             cCCcEEEEECccCCCCccHHhhhHHHHCCCeE
Confidence            34567899999999888777755554445555


No 345
>TIGR03598 GTPase_YsxC ribosome biogenesis GTP-binding protein YsxC/EngB. Members of this protein family are a GTPase associated with ribosome biogenesis, typified by YsxC from Bacillus subutilis. The family is widely but not universally distributed among bacteria. Members commonly are called EngB based on homology to EngA, one of several other GTPases of ribosome biogenesis. Cutoffs as set find essentially all bacterial members, but also identify large numbers of eukaryotic (probably organellar) sequences. This protein is found in about 80 percent of bacterial genomes.
Probab=95.41  E-value=0.014  Score=60.59  Aligned_cols=30  Identities=37%  Similarity=0.573  Sum_probs=26.0

Q ss_pred             CCCeEEEeccCCCchHHHHHhhhcCCcccc
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLVGKSFLPR   35 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~g~~~~pr   35 (1036)
                      ..|.|+|+|.+||||||++|+|+|..+.+.
T Consensus        17 ~~~~i~ivG~~~~GKStlin~l~~~~~~~~   46 (179)
T TIGR03598        17 DGPEIAFAGRSNVGKSSLINALTNRKKLAR   46 (179)
T ss_pred             CCCEEEEEcCCCCCHHHHHHHHhCCCCccc
Confidence            468999999999999999999999765543


No 346
>COG1161 Predicted GTPases [General function prediction only]
Probab=95.39  E-value=0.013  Score=67.20  Aligned_cols=23  Identities=43%  Similarity=0.699  Sum_probs=21.6

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKS  107 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~  107 (1036)
                      .+.|||-+|+||||++++|+|..
T Consensus       134 ~v~vvG~PNVGKSslIN~L~~k~  156 (322)
T COG1161         134 RVGVVGYPNVGKSTLINRLLGKK  156 (322)
T ss_pred             EEEEEcCCCCcHHHHHHHHhccc
Confidence            48999999999999999999987


No 347
>TIGR03596 GTPase_YlqF ribosome biogenesis GTP-binding protein YlqF. Members of this protein family are GTP-binding proteins involved in ribosome biogenesis, including the essential YlqF protein of Bacillus subtilis, which is an essential protein. They are related to Era, EngA, and other GTPases of ribosome biogenesis, but are circularly permuted. This family is not universal, and is not present in Escherichia coli, and so is not as well studied as some other GTPases. This model is built for bacterial members.
Probab=95.38  E-value=0.016  Score=64.86  Aligned_cols=42  Identities=31%  Similarity=0.419  Sum_probs=30.0

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCccccc-CCccccccEEEee
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLPRG-IGIVTRRPLILQL   49 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~pr~-~~~~trrpl~l~l   49 (1036)
                      ..|+|||.|||||||++|+|.|....+.+ ...+||.+-.+.+
T Consensus       119 ~~~~~vG~~nvGKSslin~l~~~~~~~~~~~~g~T~~~~~~~~  161 (276)
T TIGR03596       119 IRAMIVGIPNVGKSTLINRLAGKKVAKVGNRPGVTKGQQWIKL  161 (276)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCCCccccCCCCCeecceEEEEe
Confidence            46999999999999999999996644432 2234666544433


No 348
>COG1163 DRG Predicted GTPase [General function prediction only]
Probab=95.38  E-value=0.015  Score=65.27  Aligned_cols=23  Identities=30%  Similarity=0.544  Sum_probs=21.6

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      |||+||.|||||||||+.|.|..
T Consensus        65 ~v~lVGfPsvGKStLL~~LTnt~   87 (365)
T COG1163          65 TVALVGFPSVGKSTLLNKLTNTK   87 (365)
T ss_pred             EEEEEcCCCccHHHHHHHHhCCC
Confidence            89999999999999999999944


No 349
>cd04114 Rab30 Rab30 subfamily.  Rab30 appears to be associated with the Golgi stack. It is expressed in a wide variety of tissue types and in humans maps to chromosome 11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=95.38  E-value=0.016  Score=58.72  Aligned_cols=29  Identities=28%  Similarity=0.528  Sum_probs=25.7

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCcccc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSFLPR   35 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~~pr   35 (1036)
                      ++.|+++|.+||||||+++++++..+.|.
T Consensus         7 ~~~v~v~G~~~~GKSsli~~l~~~~~~~~   35 (169)
T cd04114           7 LFKIVLIGNAGVGKTCLVRRFTQGLFPPG   35 (169)
T ss_pred             eeEEEEECCCCCCHHHHHHHHHhCCCCCC
Confidence            58999999999999999999998776553


No 350
>cd01860 Rab5_related Rab5-related subfamily.  This subfamily includes Rab5 and Rab22 of mammals, Ypt51/Ypt52/Ypt53 of yeast, and RabF of plants. The members of this subfamily are involved in endocytosis and endocytic-sorting pathways.  In mammals, Rab5 GTPases localize to early endosomes and regulate fusion of clathrin-coated vesicles to early endosomes and fusion between early endosomes. In yeast, Ypt51p family members similarly regulate membrane trafficking through prevacuolar compartments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence mo
Probab=95.36  E-value=0.012  Score=59.21  Aligned_cols=26  Identities=35%  Similarity=0.579  Sum_probs=23.6

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      .|+|+|.+||||||++|++.+..+.+
T Consensus         3 ki~v~G~~~~GKSsli~~l~~~~~~~   28 (163)
T cd01860           3 KLVLLGDSSVGKSSLVLRFVKNEFSE   28 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCCCC
Confidence            58999999999999999999988654


No 351
>smart00173 RAS Ras subfamily of RAS small GTPases. Similar in fold and function to the bacterial EF-Tu GTPase. p21Ras couples receptor Tyr kinases and G protein receptors  to protein kinase cascades
Probab=95.35  E-value=0.012  Score=59.44  Aligned_cols=25  Identities=32%  Similarity=0.575  Sum_probs=22.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|+|+|.+||||||+++++++..|.
T Consensus         2 ki~v~G~~~~GKTsli~~~~~~~~~   26 (164)
T smart00173        2 KLVVLGSGGVGKSALTIQFVQGHFV   26 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCcCC
Confidence            5899999999999999999987763


No 352
>PRK12296 obgE GTPase CgtA; Reviewed
Probab=95.34  E-value=0.016  Score=69.77  Aligned_cols=25  Identities=36%  Similarity=0.534  Sum_probs=22.9

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCC
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      ++.|++||.||||||||||+|.+..
T Consensus       159 ~adV~LVG~PNAGKSTLln~Ls~ak  183 (500)
T PRK12296        159 VADVGLVGFPSAGKSSLISALSAAK  183 (500)
T ss_pred             cceEEEEEcCCCCHHHHHHHHhcCC
Confidence            5789999999999999999999853


No 353
>cd01863 Rab18 Rab18 subfamily.  Mammalian Rab18 is implicated in endocytic transport and is expressed most highly in polarized epithelial cells. However, trypanosomal Rab, TbRAB18, is upregulated in the BSF (Blood Stream Form) stage and localized predominantly to elements of the Golgi complex.  In human and mouse cells, Rab18 has been identified in lipid droplets, organelles that store neutral lipids. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of mos
Probab=95.31  E-value=0.015  Score=58.47  Aligned_cols=26  Identities=31%  Similarity=0.627  Sum_probs=23.2

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      .|+|+|.+||||||+++++.+..+.+
T Consensus         2 ki~v~G~~~~GKSsli~~l~~~~~~~   27 (161)
T cd01863           2 KILLIGDSGVGKSSLLLRFTDDTFDP   27 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCCCc
Confidence            48999999999999999999877644


No 354
>smart00175 RAB Rab subfamily of small GTPases. Rab GTPases are implicated in vesicle trafficking.
Probab=95.29  E-value=0.018  Score=57.71  Aligned_cols=27  Identities=26%  Similarity=0.562  Sum_probs=23.8

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPR   35 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr   35 (1036)
                      .|+|+|.+||||||+++++.+..+-+.
T Consensus         2 kv~v~G~~~~GKTtli~~l~~~~~~~~   28 (164)
T smart00175        2 KIILIGDSGVGKSSLLSRFTDGKFSEQ   28 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCCC
Confidence            489999999999999999999887443


No 355
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons.  The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins.  They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase.  In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins.  The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein
Probab=95.24  E-value=0.014  Score=63.22  Aligned_cols=24  Identities=42%  Similarity=0.630  Sum_probs=22.1

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcC
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGK   30 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~   30 (1036)
                      +=.|+|+|.|++|||+|+|.|+|.
T Consensus         7 v~vvsv~G~~~sGKS~llN~l~~~   30 (224)
T cd01851           7 VAVVSVFGPQSSGKSFLLNHLFGT   30 (224)
T ss_pred             EEEEEEECCCCCCHHHHHHHHhCC
Confidence            347999999999999999999998


No 356
>cd01865 Rab3 Rab3 subfamily.  The Rab3 subfamily contains Rab3A, Rab3B, Rab3C, and Rab3D.  All four isoforms were found in mouse brain and endocrine tissues, with varying levels of expression.  Rab3A, Rab3B, and Rab3C localized to synaptic and secretory vesicles; Rab3D was expressed at high levels only in adipose tissue, exocrine glands, and the endocrine pituitary, where it is localized to cytoplasmic secretory granules.  Rab3 appears to control Ca2+-regulated exocytosis. The appropriate GDP/GTP exchange cycle of Rab3A is required for Ca2+-regulated exocytosis to occur, and interaction of the GTP-bound form of Rab3A with effector molecule(s) is widely believed to be essential for this process. Functionally, most studies point toward a role for Rab3 in the secretion of hormones and neurotransmitters. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promot
Probab=95.23  E-value=0.014  Score=59.32  Aligned_cols=25  Identities=28%  Similarity=0.557  Sum_probs=22.7

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|++||.+||||||+++++++..|.
T Consensus         3 ki~i~G~~~~GKSsli~~l~~~~~~   27 (165)
T cd01865           3 KLLIIGNSSVGKTSFLFRYADDSFT   27 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCC
Confidence            6999999999999999999987763


No 357
>PF00009 GTP_EFTU:  Elongation factor Tu GTP binding domain;  InterPro: IPR000795 Elongation factors belong to a family of proteins that promote the GTP-dependent binding of aminoacyl tRNA to the A site of ribosomes during protein biosynthesis, and catalyse the translocation of the synthesised protein chain from the A to the P site. The proteins are all relatively similar in the vicinity of their C-termini, and are also highly similar to a range of proteins that includes the nodulation Q protein from Rhizobium meliloti (Sinorhizobium meliloti), bacterial tetracycline resistance proteins [] and the omnipotent suppressor protein 2 from yeast. In both prokaryotes and eukaryotes, there are three distinct types of elongation factors, EF-1alpha (EF-Tu), which binds GTP and an aminoacyl-tRNAand delivers the latter to the A site of ribosomes; EF-1beta (EF-Ts), which interacts with EF-1a/EF-Tu to displace GDP and thus allows the regeneration of GTP-EF-1a; and EF-2 (EF-G), which binds GTP and peptidyl-tRNA and translocates the latter from the A site to the P site. In EF-1-alpha, a specific region has been shown [] to be involved in a conformational change mediated by the hydrolysis of GTP to GDP. This region is conserved in both EF-1alpha/EF-Tu as well as EF-2/EF-G and thus seems typical for GTP-dependent proteins which bind non-initiator tRNAs to the ribosome. The GTP-binding protein synthesis factor family also includes the eukaryotic peptide chain release factor GTP-binding subunits [] and prokaryotic peptide chain release factor 3 (RF-3) []; the prokaryotic GTP-binding protein lepA and its homologue in yeast (GUF1) and Caenorhabditis elegans (ZK1236.1); yeast HBS1 []; rat statin S1 []; and the prokaryotic selenocysteine-specific elongation factor selB [].; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 3IZW_C 1DG1_G 2BVN_B 3IZV_C 3MMP_C 1OB2_A 1EFU_A 3FIH_Z 3TR5_A 1TUI_C ....
Probab=95.20  E-value=0.043  Score=57.43  Aligned_cols=61  Identities=18%  Similarity=0.354  Sum_probs=42.9

Q ss_pred             cccEEEeeccCCCchhhhhhhHHHHHHHHH-hhhhcCCCC-CCCCceEEeCcCCCChhhHHhhhcC
Q psy5059          42 RRPLILQLYYCPKDDREKRTAAAVINKLQD-VFNTVGTDA-IQLPQIVVVGTQSSGKSSVIESLVG  105 (1036)
Q Consensus        42 rrpl~l~l~~~~~~~~~~~~~~~l~~kL~~-~~~~~g~~~-i~lPqIvVvG~QSsGKSSlLEal~G  105 (1036)
                      +.|+++.+||+|..   ...+...++++.+ ++...+... -..|-+.+-+-.+.|--.|+++|..
T Consensus       122 ~~p~ivvlNK~D~~---~~~~~~~~~~~~~~l~~~~~~~~~~~~~vi~~Sa~~g~gi~~Ll~~l~~  184 (188)
T PF00009_consen  122 GIPIIVVLNKMDLI---EKELEEIIEEIKEKLLKEYGENGEEIVPVIPISALTGDGIDELLEALVE  184 (188)
T ss_dssp             T-SEEEEEETCTSS---HHHHHHHHHHHHHHHHHHTTSTTTSTEEEEEEBTTTTBTHHHHHHHHHH
T ss_pred             ccceEEeeeeccch---hhhHHHHHHHHHHHhccccccCccccceEEEEecCCCCCHHHHHHHHHH
Confidence            34899999999886   3345566666663 334444332 3578888999999999999999864


No 358
>PRK12299 obgE GTPase CgtA; Reviewed
Probab=95.18  E-value=0.021  Score=65.80  Aligned_cols=44  Identities=20%  Similarity=0.237  Sum_probs=30.5

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCcccccCCccccccEEEeec
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLY   50 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrpl~l~l~   50 (1036)
                      ++.|++||.|||||||||++|.+...........|+.|.+=.+.
T Consensus       158 ~adVglVG~PNaGKSTLln~ls~a~~~va~ypfTT~~p~~G~v~  201 (335)
T PRK12299        158 LADVGLVGLPNAGKSTLISAVSAAKPKIADYPFTTLHPNLGVVR  201 (335)
T ss_pred             cCCEEEEcCCCCCHHHHHHHHHcCCCccCCCCCceeCceEEEEE
Confidence            57899999999999999999998431111112236667665443


No 359
>PF00735 Septin:  Septin;  InterPro: IPR000038 Septins constitute a eukaryotic family of guanine nucleotide-binding proteins, most of which polymerise to form filaments []. Members of the family were first identified by genetic screening for Saccharomyces cerevisiae (Baker's yeast) mutants defective in cytokinesis []. Temperature-sensitive mutations in four genes, CDC3, CDC10, CDC11 and CDC12, were found to cause cell-cycle arrest and defects in bud growth and cytokinesis. The protein products of these genes localise at the division plane between mother and daughter cells, indicating a role in mother-daughter separation during cytokinesis []. Members of the family were therefore termed septins to reflect their role in septation and cell division. The identification of septin homologues in higher eukaryotes, which localise to the cleavage furrow in dividing cells, supports an orthologous function in cytokinesis. Septins have since been identified in most eukaryotes, except plants []. Septins are approximately 40-50 kDa in molecular mass, and typically comprise a conserved central core domain (more than 35% sequence identity between mammalian and yeast homologues) flanked by more divergent N- and C-termini. Most septins possess a P-loop motif in their N-terminal domain (which is characteristic of GTP-binding proteins), and a predicted C-terminal coiled-coil domain []. A number of septin interaction partners have been identified in yeast, many of which are components of the budding site selection machinery, kinase cascades or of the ubiquitination pathway. It has been proposed that septins may act as a scaffold that provides an interaction matrix for other proteins [, ]. In mammals, septins have been shown to regulate vesicle dynamics []. Mammalian septins have also been implicated in a variety of other cellular processes, including apoptosis, carcinogenesis and neurodegeneration []. This entry represents a variety of septins and homologous sequences involved in the cell division process.; GO: 0005525 GTP binding, 0007049 cell cycle; PDB: 2QAG_B 3FTQ_D 2QA5_A 2QNR_B 3TW4_A 3T5D_C.
Probab=95.18  E-value=0.022  Score=63.95  Aligned_cols=25  Identities=32%  Similarity=0.618  Sum_probs=21.4

Q ss_pred             ceEEeCcCCCChhhHHhhhcCCCcC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGKSFL  109 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~~fl  109 (1036)
                      .|.|+|..++||||++++|.+..+.
T Consensus         6 nImVvG~sG~GKTTFIntL~~~~~~   30 (281)
T PF00735_consen    6 NIMVVGESGLGKTTFINTLFNSDII   30 (281)
T ss_dssp             EEEEEECTTSSHHHHHHHHHTSS--
T ss_pred             EEEEECCCCCCHHHHHHHHHhcccc
Confidence            4789999999999999999998753


No 360
>KOG0094|consensus
Probab=95.17  E-value=0.036  Score=58.10  Aligned_cols=51  Identities=29%  Similarity=0.504  Sum_probs=36.9

Q ss_pred             CCCCeEEEeccCCCchHHHHHhh------------hcCCcccccCCccccccEEEeeccCCCch
Q psy5059           5 IQLPQIVVVGTQSSGKSSVIESL------------VGKSFLPRGIGIVTRRPLILQLYYCPKDD   56 (1036)
Q Consensus         5 ~~lp~i~vvg~~~~gkss~~~~~------------~g~~~~pr~~~~~trrpl~l~l~~~~~~~   56 (1036)
                      +..-.||++|.|||||+|++.+.            +|.||+-.. --...||+=|||=-+.+.+
T Consensus        20 ~k~~KlVflGdqsVGKTslItRf~yd~fd~~YqATIGiDFlskt-~~l~d~~vrLQlWDTAGQE   82 (221)
T KOG0094|consen   20 LKKYKLVFLGDQSVGKTSLITRFMYDKFDNTYQATIGIDFLSKT-MYLEDRTVRLQLWDTAGQE   82 (221)
T ss_pred             ceEEEEEEEccCccchHHHHHHHHHhhhcccccceeeeEEEEEE-EEEcCcEEEEEEEecccHH
Confidence            44458999999999999999987            578887532 1223458888887766533


No 361
>PRK14974 cell division protein FtsY; Provisional
Probab=95.17  E-value=0.33  Score=55.97  Aligned_cols=21  Identities=38%  Similarity=0.566  Sum_probs=19.7

Q ss_pred             eEEEeccCCCchHHHHHhhhc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVG   29 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g   29 (1036)
                      .|+++|.+||||||++..|..
T Consensus       142 vi~~~G~~GvGKTTtiakLA~  162 (336)
T PRK14974        142 VIVFVGVNGTGKTTTIAKLAY  162 (336)
T ss_pred             EEEEEcCCCCCHHHHHHHHHH
Confidence            689999999999999999986


No 362
>TIGR02729 Obg_CgtA Obg family GTPase CgtA. This model describes a univeral, mostly one-gene-per-genome GTP-binding protein that associates with ribosomal subunits and appears to play a role in ribosomal RNA maturation. This GTPase, related to the nucleolar protein Obg, is designated CgtA in bacteria. Mutations in this gene are pleiotropic, but it appears that effects on cellular functions such as chromosome partition may be secondary to the effect on ribosome structure. Recent work done in Vibrio cholerae shows an essential role in the stringent response, in which RelA-dependent ability to synthesize the alarmone ppGpp is required for deletion of this GTPase to be lethal.
Probab=95.14  E-value=0.019  Score=66.00  Aligned_cols=25  Identities=28%  Similarity=0.520  Sum_probs=22.7

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCC
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      ++.|++||.|||||||||++|.+..
T Consensus       157 ~adV~lvG~pnaGKSTLl~~lt~~~  181 (329)
T TIGR02729       157 LADVGLVGLPNAGKSTLISAVSAAK  181 (329)
T ss_pred             cccEEEEcCCCCCHHHHHHHHhcCC
Confidence            5789999999999999999999854


No 363
>PRK09563 rbgA GTPase YlqF; Reviewed
Probab=95.12  E-value=0.02  Score=64.42  Aligned_cols=39  Identities=28%  Similarity=0.404  Sum_probs=28.8

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCccccc-CCccccccEE
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLPRG-IGIVTRRPLI   46 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~pr~-~~~~trrpl~   46 (1036)
                      ..|++||.|||||||++|+|.|......+ ...+||.+-.
T Consensus       122 ~~~~~~G~pnvGKSsliN~l~~~~~~~~~~~~g~T~~~~~  161 (287)
T PRK09563        122 IRAMIIGIPNVGKSTLINRLAGKKIAKTGNRPGVTKAQQW  161 (287)
T ss_pred             eEEEEECCCCCCHHHHHHHHhcCCccccCCCCCeEEEEEE
Confidence            36999999999999999999997654332 2235666533


No 364
>PF03193 DUF258:  Protein of unknown function, DUF258;  InterPro: IPR004881 This entry contains Escherichia coli (strain K12) RsgA, which may play a role in 30S ribosomal subunit biogenesis. RsgA is an unusual circulary permuted GTPase that catalyzes rapid hydrolysis of GTP with a slow catalytic turnover. It is dispensible for viability, but important for overall fitness. The intrinsic GTPase activity is stimulated by the presence of 30S (160-fold increase in kcat) or 70S (96 fold increase in kcat) ribosomes []. The GTPase is inhibited by aminoglycoside antibiotics such as neomycin and paromycin [] streptomycin and spectinomycin []. This inhibition is not due to competition for binding sites on the 30S or 70S ribosome []. ; GO: 0003924 GTPase activity, 0005525 GTP binding; PDB: 2YKR_W 2YV5_A 1T9H_A 2RCN_A 4A2I_V 1U0L_B.
Probab=95.08  E-value=0.019  Score=59.05  Aligned_cols=27  Identities=30%  Similarity=0.418  Sum_probs=22.5

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      ..+|++|..|||||||+|+|+|...++
T Consensus        36 k~~vl~G~SGvGKSSLiN~L~~~~~~~   62 (161)
T PF03193_consen   36 KTSVLLGQSGVGKSSLINALLPEAKQK   62 (161)
T ss_dssp             SEEEEECSTTSSHHHHHHHHHTSS---
T ss_pred             CEEEEECCCCCCHHHHHHHHHhhcchh
Confidence            689999999999999999999975555


No 365
>cd01849 YlqF_related_GTPase YlqF-related GTPases.  These proteins are found in bacteria, eukaryotes, and archaea.  They all exhibit a circular permutation of the GTPase signature motifs so that the order of the conserved G box motifs is G4-G5-G1-G2-G3, with G4 and G5 being permuted from the C-terminal region of proteins in the Ras superfamily to the N-terminus of YlqF-related GTPases.
Probab=95.08  E-value=0.022  Score=57.85  Aligned_cols=44  Identities=32%  Similarity=0.285  Sum_probs=35.4

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCCcCccccc-ccccCceEEEE
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIG-IVTRRPLILQL  125 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G-~cTR~Pl~l~l  125 (1036)
                      ..++++++|.+++||||++++|.|..-.+.+.+ -+||++..+.+
T Consensus        99 ~~~~~~~~G~~~~GKstlin~l~~~~~~~~~~~~~~t~~~~~~~~  143 (155)
T cd01849          99 KSITVGVIGYPNVGKSSVINALLNKLKLKVGNVPGTTTSQQEVKL  143 (155)
T ss_pred             cCcEEEEEccCCCCHHHHHHHHHccccccccCCCCcccceEEEEe
Confidence            457899999999999999999999765555554 67888876554


No 366
>cd04157 Arl6 Arl6 subfamily.  Arl6 (Arf-like 6) forms a subfamily of the Arf family of small GTPases.  Arl6 expression is limited to the brain and kidney in adult mice, but it is expressed in the neural plate and somites during embryogenesis, suggesting a possible role for Arl6 in early development.  Arl6 is also believed to have a role in cilia or flagella function.  Several proteins have been identified that bind Arl6, including Arl6 interacting protein (Arl6ip), and SEC61beta, a subunit of the heterotrimeric conducting channel SEC61p.  Based on Arl6 binding to these effectors, Arl6 is also proposed to play a role in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation.  At least three specific homozygous Arl6 mutations in humans have been found to cause Bardet-Biedl syndrome, a disorder characterized by obesity, retinopathy, polydactyly, renal and cardiac malformations, learning disabilities, and hypogenitalism.  Older literature suggests that A
Probab=95.07  E-value=0.015  Score=58.28  Aligned_cols=23  Identities=39%  Similarity=0.673  Sum_probs=21.2

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      +|++||.+||||||++++|.+..
T Consensus         1 ~i~~vG~~~~GKTsl~~~l~~~~   23 (162)
T cd04157           1 NILVVGLDNSGKTTIINQLKPEN   23 (162)
T ss_pred             CEEEECCCCCCHHHHHHHHcccC
Confidence            58999999999999999999865


No 367
>cd04140 ARHI_like ARHI subfamily.  ARHI (A Ras homolog member I) is a member of the Ras family with several unique structural and functional properties.  ARHI is expressed in normal human ovarian and breast tissue, but its expression is decreased or eliminated in breast and ovarian cancer.  ARHI contains an N-terminal extension of 34 residues (human) that is required to retain its tumor suppressive activity.   Unlike most other Ras family members, ARHI is maintained in the constitutively active (GTP-bound) state in resting cells and has modest GTPase activity.  ARHI inhibits STAT3 (signal transducers and activators of transcription 3), a latent transcription factor whose abnormal activation plays a critical role in oncogenesis.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Due to
Probab=95.06  E-value=0.016  Score=58.84  Aligned_cols=24  Identities=38%  Similarity=0.624  Sum_probs=22.3

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||.+||||||+++++++..|
T Consensus         3 kv~~vG~~~vGKTsli~~~~~~~f   26 (165)
T cd04140           3 RVVVFGAGGVGKSSLVLRFVKGTF   26 (165)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            589999999999999999998776


No 368
>cd01853 Toc34_like Toc34-like (Translocon at the Outer-envelope membrane of Chloroplasts).  This family contains several Toc proteins, including Toc34, Toc33, Toc120, Toc159, Toc86, Toc125, and Toc90.  The Toc complex at the outer envelope membrane of chloroplasts is a molecular machine of ~500 kDa that contains a single Toc159 protein, four Toc75 molecules, and four or five copies of Toc34. Toc64 and Toc12 are associated with the translocon, but do not appear to be part of the core complex.  The Toc translocon initiates the import of nuclear-encoded preproteins from the cytosol into the organelle.  Toc34 and Toc159 are both GTPases, while Toc75 is a beta-barrel integral membrane protein.  Toc159 is equally distributed between a soluble cytoplasmic form and a membrane-inserted form, suggesting that assembly of the Toc complex is dynamic.  Toc34 and Toc75 act sequentially to mediate docking and insertion of Toc159 resulting in assembly of the functional translocon.
Probab=95.04  E-value=0.018  Score=63.46  Aligned_cols=29  Identities=34%  Similarity=0.462  Sum_probs=24.7

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCcccc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSFLPR   35 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~~pr   35 (1036)
                      -..|+|||..||||||++|+|.|.+..+.
T Consensus        31 ~~~IllvG~tGvGKSSliNaLlg~~~~~v   59 (249)
T cd01853          31 SLTILVLGKTGVGKSSTINSIFGERKAAT   59 (249)
T ss_pred             CeEEEEECCCCCcHHHHHHHHhCCCCccc
Confidence            35899999999999999999999764433


No 369
>PRK12297 obgE GTPase CgtA; Reviewed
Probab=95.02  E-value=0.02  Score=67.82  Aligned_cols=25  Identities=24%  Similarity=0.434  Sum_probs=22.6

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCC
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      ++.|++||.|||||||||++|.+..
T Consensus       158 ~adVglVG~pNaGKSTLLn~Lt~ak  182 (424)
T PRK12297        158 LADVGLVGFPNVGKSTLLSVVSNAK  182 (424)
T ss_pred             cCcEEEEcCCCCCHHHHHHHHHcCC
Confidence            4599999999999999999999854


No 370
>cd04136 Rap_like Rap-like subfamily.  The Rap subfamily consists of the Rap1, Rap2, and RSR1.  Rap subfamily proteins perform different cellular functions, depending on the isoform and its subcellular localization. For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and microsomal membrane of the pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.   Rap1 localizes in the nucleus of human oropharyngeal squamous cell carcinomas (SCCs) and cell lines.  Rap1 plays a role in phagocytosis by controlling the binding of adhesion receptors (typically integrins) to their ligands.  In yeast, Rap1 has been implicated in multiple functions, including activation and silencing of transcription and maintenance of telomeres. 
Probab=95.02  E-value=0.016  Score=58.11  Aligned_cols=25  Identities=32%  Similarity=0.503  Sum_probs=22.4

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      ..|++||.+|||||||++++++..|
T Consensus         2 ~ki~i~G~~~vGKTsl~~~~~~~~~   26 (163)
T cd04136           2 YKVVVLGSGGVGKSALTVQFVQGIF   26 (163)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhCCC
Confidence            4799999999999999999997655


No 371
>cd04156 ARLTS1 ARLTS1 subfamily.  ARLTS1 (Arf-like tumor suppressor gene 1), also known as Arl11, is a member of the Arf family of small GTPases that is believed to play a major role in apoptotic signaling.  ARLTS1 is widely expressed and functions as a tumor suppressor gene in several human cancers.  ARLTS1 is a low-penetrance suppressor that accounts for a small percentage of familial melanoma or familial chronic lymphocytic leukemia (CLL).  ARLTS1 inactivation seems to occur most frequently through biallelic down-regulation by hypermethylation of the promoter.  In breast cancer, ARLTS1 alterations were typically a combination of a hypomorphic polymorphism plus loss of heterozygosity.  In a case of thyroid adenoma, ARLTS1 alterations were polymorphism plus promoter hypermethylation.  The nonsense polymorphism Trp149Stop occurs with significantly greater frequency in familial cancer cases than in sporadic cancer cases, and the Cys148Arg polymorphism is associated with an increase in h
Probab=95.00  E-value=0.016  Score=58.12  Aligned_cols=24  Identities=29%  Similarity=0.541  Sum_probs=22.0

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|+++|.+||||||+++++++..|
T Consensus         1 ~i~i~G~~~~GKTsl~~~~~~~~~   24 (160)
T cd04156           1 QVLLLGLDSAGKSTLLYKLKHAEL   24 (160)
T ss_pred             CEEEEcCCCCCHHHHHHHHhcCCc
Confidence            489999999999999999998765


No 372
>cd04154 Arl2 Arl2 subfamily.  Arl2 (Arf-like 2) GTPases are members of the Arf family that bind GDP and GTP with very low affinity.  Unlike most Arf family proteins, Arl2 is not myristoylated at its N-terminal helix.  The protein PDE-delta, first identified in photoreceptor rod cells, binds specifically to Arl2 and is structurally very similar to RhoGDI.  Despite the high structural similarity between Arl2 and Rho proteins and between PDE-delta and RhoGDI, the interactions between the GTPases and their effectors are very different.  In its GTP bound form, Arl2 interacts with the protein Binder of Arl2 (BART), and the complex is believed to play a role in mitochondrial adenine nucleotide transport.  In its GDP bound form, Arl2 interacts with tubulin- folding Cofactor D; this interaction is believed to play a role in regulation of microtubule dynamics that impact the cytoskeleton, cell division, and cytokinesis.
Probab=94.98  E-value=0.017  Score=59.18  Aligned_cols=25  Identities=24%  Similarity=0.658  Sum_probs=22.6

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCC
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      -+.|++||.+|||||||+++|+|.+
T Consensus        14 ~~kv~ivG~~~~GKTsL~~~l~~~~   38 (173)
T cd04154          14 EMRILILGLDNAGKTTILKKLLGED   38 (173)
T ss_pred             ccEEEEECCCCCCHHHHHHHHccCC
Confidence            4689999999999999999999863


No 373
>cd04142 RRP22 RRP22 subfamily.  RRP22 (Ras-related protein on chromosome 22) subfamily consists of proteins that inhibit cell growth and promote caspase-independent cell death.  Unlike most Ras proteins, RRP22 is down-regulated in many human tumor cells due to promoter methylation.  RRP22 localizes to the nucleolus in a GTP-dependent manner, suggesting a novel function in modulating transport of nucleolar components.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.  Like most Ras family proteins, RRP22 is farnesylated.
Probab=94.96  E-value=0.017  Score=61.28  Aligned_cols=24  Identities=21%  Similarity=0.674  Sum_probs=22.2

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|+|||.+||||||+++++++.+|
T Consensus         2 kI~ivG~~~vGKTsLi~~~~~~~f   25 (198)
T cd04142           2 RVAVLGAPGVGKTAIVRQFLAQEF   25 (198)
T ss_pred             EEEEECCCCCcHHHHHHHHHcCCC
Confidence            589999999999999999998776


No 374
>TIGR00231 small_GTP small GTP-binding protein domain. This model recognizes a large number of small GTP-binding proteins and related domains in larger proteins. Note that the alpha chains of heterotrimeric G proteins are larger proteins in which the NKXD motif is separated from the GxxxxGK[ST] motif (P-loop) by a long insert and are not easily detected by this model.
Probab=94.95  E-value=0.03  Score=54.64  Aligned_cols=25  Identities=40%  Similarity=0.776  Sum_probs=22.9

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      +.|+++|.+||||||+++++++..+
T Consensus         2 ~ki~~~G~~~~GKstl~~~l~~~~~   26 (161)
T TIGR00231         2 IKIVIVGDPNVGKSTLLNRLLGNKF   26 (161)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCCCC
Confidence            4799999999999999999999773


No 375
>cd01896 DRG The developmentally regulated GTP-binding protein (DRG) subfamily is an uncharacterized member of the Obg family, an evolutionary branch of GTPase superfamily proteins.  GTPases act as molecular switches regulating diverse cellular processes.  DRG2 and DRG1 comprise the DRG subfamily in eukaryotes.  In view of their widespread expression in various tissues and high conservation among distantly related species in eukaryotes and archaea, DRG proteins may regulate fundamental cellular processes.  It is proposed that the DRG subfamily proteins play their physiological roles through RNA binding.
Probab=94.94  E-value=0.023  Score=62.00  Aligned_cols=23  Identities=30%  Similarity=0.556  Sum_probs=21.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      +|++||.+||||||||++|.|..
T Consensus         2 ~v~lvG~~~~GKStLl~~Ltg~~   24 (233)
T cd01896           2 RVALVGFPSVGKSTLLSKLTNTK   24 (233)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCC
Confidence            68999999999999999999965


No 376
>cd01884 EF_Tu EF-Tu subfamily.  This subfamily includes orthologs of translation elongation factor EF-Tu in bacteria, mitochondria, and chloroplasts.  It is one of several GTP-binding translation factors found in the larger family of GTP-binding elongation factors.  The eukaryotic counterpart, eukaryotic translation elongation factor 1 (eEF-1 alpha), is excluded from this family.  EF-Tu is one of the most abundant proteins in bacteria, as well as, one of the most highly conserved, and in a number of species the gene is duplicated with identical function.  When bound to GTP, EF-Tu can form a complex with any (correctly) aminoacylated tRNA except those for initiation and for selenocysteine, in which case EF-Tu is replaced by other factors.  Transfer RNA is carried to the ribosome in these complexes for protein translation.
Probab=94.92  E-value=0.098  Score=55.58  Aligned_cols=22  Identities=14%  Similarity=0.360  Sum_probs=20.0

Q ss_pred             CeEEEeccCCCchHHHHHhhhc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVG   29 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g   29 (1036)
                      -.|++||..++|||||+++|.+
T Consensus         3 ~ni~iiGh~~~GKTTL~~~Ll~   24 (195)
T cd01884           3 VNVGTIGHVDHGKTTLTAAITK   24 (195)
T ss_pred             EEEEEECCCCCCHHHHHHHHHH
Confidence            3689999999999999999975


No 377
>cd04123 Rab21 Rab21 subfamily.  The localization and function of Rab21 are not clearly defined, with conflicting data reported.  Rab21 has been reported to localize in the ER in human intestinal epithelial cells, with partial colocalization with alpha-glucosidase, a late endosomal/lysosomal marker.  More recently, Rab21 was shown to colocalize with and affect the morphology of early endosomes. In Dictyostelium, GTP-bound Rab21, together with two novel LIM domain proteins, LimF and ChLim, has been shown to regulate phagocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site
Probab=94.92  E-value=0.022  Score=56.77  Aligned_cols=26  Identities=27%  Similarity=0.492  Sum_probs=23.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      .|++||.++|||||+++++++..+.|
T Consensus         2 ki~i~G~~~~GKStli~~l~~~~~~~   27 (162)
T cd04123           2 KVVLLGEGRVGKTSLVLRYVENKFNE   27 (162)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCCCC
Confidence            48999999999999999999987654


No 378
>KOG0080|consensus
Probab=94.91  E-value=0.097  Score=53.20  Aligned_cols=26  Identities=31%  Similarity=0.566  Sum_probs=22.4

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .-+|.++|+.++||||||-+.+.-.|
T Consensus        11 t~KiLlIGeSGVGKSSLllrFv~~~f   36 (209)
T KOG0080|consen   11 TFKILLIGESGVGKSSLLLRFVSNTF   36 (209)
T ss_pred             eEEEEEEccCCccHHHHHHHHHhccc
Confidence            46899999999999999998876655


No 379
>cd01869 Rab1_Ypt1 Rab1/Ypt1 subfamily.  Rab1 is found in every eukaryote and is a key regulatory component for the transport of vesicles from the ER to the Golgi apparatus. Studies on mutations of Ypt1, the yeast homolog of Rab1, showed that this protein is necessary for the budding of vesicles of the ER as well as for their transport to, and fusion with, the Golgi apparatus. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to t
Probab=94.90  E-value=0.02  Score=58.07  Aligned_cols=25  Identities=16%  Similarity=0.486  Sum_probs=22.6

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      ..|+|||.+||||||+++++++..|
T Consensus         3 ~ki~i~G~~~vGKSsli~~~~~~~~   27 (166)
T cd01869           3 FKLLLIGDSGVGKSCLLLRFADDTY   27 (166)
T ss_pred             EEEEEECCCCCCHHHHHHHHhcCCC
Confidence            4799999999999999999997665


No 380
>COG2262 HflX GTPases [General function prediction only]
Probab=94.85  E-value=0.016  Score=66.89  Aligned_cols=27  Identities=30%  Similarity=0.619  Sum_probs=24.3

Q ss_pred             CCCCeEEEeccCCCchHHHHHhhhcCC
Q psy5059           5 IQLPQIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         5 ~~lp~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      -+.|+|++||..|+|||||||+|+|-+
T Consensus       190 ~~~p~vaLvGYTNAGKSTL~N~LT~~~  216 (411)
T COG2262         190 SGIPLVALVGYTNAGKSTLFNALTGAD  216 (411)
T ss_pred             cCCCeEEEEeeccccHHHHHHHHhccC
Confidence            478999999999999999999999544


No 381
>cd04106 Rab23_lke Rab23-like subfamily.  Rab23 is a member of the Rab family of small GTPases. In mouse, Rab23 has been shown to function as a negative regulator in the sonic hedgehog (Shh) signalling pathway. Rab23 mediates the activity of Gli2 and Gli3, transcription factors that regulate Shh signaling in the spinal cord, primarily by preventing Gli2 activation in the absence of Shh ligand. Rab23 also regulates a step in the cytoplasmic signal transduction pathway that mediates the effect of Smoothened (one of two integral membrane proteins that are essential components of the Shh signaling pathway in vertebrates). In humans, Rab23 is expressed in the retina.  Mice contain an isoform that shares 93% sequence identity with the human Rab23 and an alternative splicing isoform that is specific to the brain. This isoform causes the murine open brain phenotype, indicating it may have a role in the development of the central nervous system.  GTPase activating proteins (GAPs) interact with G
Probab=94.84  E-value=0.021  Score=57.37  Aligned_cols=25  Identities=40%  Similarity=0.652  Sum_probs=22.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|++||.+||||||+++++.+..|.
T Consensus         2 kv~~vG~~~~GKTsl~~~~~~~~~~   26 (162)
T cd04106           2 KVIVVGNGNVGKSSMIQRFVKGIFT   26 (162)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCC
Confidence            4899999999999999999987663


No 382
>cd00879 Sar1 Sar1 subfamily.  Sar1 is an essential component of COPII vesicle coats involved in export of cargo from the ER.  The GTPase activity of Sar1 functions as a molecular switch to control protein-protein and protein-lipid interactions that direct vesicle budding from the ER.  Activation of the GDP to the GTP-bound form of Sar1 involves the membrane-associated guanine nucleotide exchange factor (GEF) Sec12.  Sar1 is unlike all Ras superfamily GTPases that use either myristoyl or prenyl groups to direct membrane association and function, in that Sar1 lacks such modification.  Instead, Sar1 contains a unique nine-amino-acid N-terminal extension.  This extension contains an evolutionarily conserved cluster of bulky hydrophobic amino acids, referred to as the Sar1-N-terminal activation recruitment (STAR) motif.  The STAR motif mediates the recruitment of Sar1 to ER membranes and facilitates its interaction with mammalian Sec12 GEF leading to activation.
Probab=94.82  E-value=0.031  Score=58.08  Aligned_cols=27  Identities=19%  Similarity=0.464  Sum_probs=24.0

Q ss_pred             CCCeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .-+.|+++|.+||||||+++++.|..+
T Consensus        18 ~~~ki~ilG~~~~GKStLi~~l~~~~~   44 (190)
T cd00879          18 KEAKILFLGLDNAGKTTLLHMLKDDRL   44 (190)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhcCCC
Confidence            346899999999999999999999765


No 383
>COG3276 SelB Selenocysteine-specific translation elongation factor [Translation, ribosomal structure and biogenesis]
Probab=94.81  E-value=0.16  Score=59.28  Aligned_cols=57  Identities=23%  Similarity=0.201  Sum_probs=38.4

Q ss_pred             ccccCCce-EEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHH
Q psy5059         375 TDVDGRRT-LAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSE  453 (1036)
Q Consensus       375 ~d~~g~rt-i~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qe  453 (1036)
                      +|--|... |+|+||.|+.|...                        ...+.+.+..... +.-+++..+|+.+++...+
T Consensus        98 Ldllgi~~giivltk~D~~d~~r------------------------~e~~i~~Il~~l~-l~~~~i~~~s~~~g~GI~~  152 (447)
T COG3276          98 LDLLGIKNGIIVLTKADRVDEAR------------------------IEQKIKQILADLS-LANAKIFKTSAKTGRGIEE  152 (447)
T ss_pred             HHhcCCCceEEEEeccccccHHH------------------------HHHHHHHHHhhcc-cccccccccccccCCCHHH
Confidence            34445555 99999999998631                        1334445555555 6677778899999997666


Q ss_pred             HHH
Q psy5059         454 SLK  456 (1036)
Q Consensus       454 il~  456 (1036)
                      +-.
T Consensus       153 Lk~  155 (447)
T COG3276         153 LKN  155 (447)
T ss_pred             HHH
Confidence            543


No 384
>KOG1145|consensus
Probab=94.81  E-value=0.22  Score=59.35  Aligned_cols=64  Identities=19%  Similarity=0.196  Sum_probs=38.3

Q ss_pred             hHHHHHhhhccccCCceEEEEecccccCCCchhh----hhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceee
Q psy5059         366 SESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAI----DILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILA  441 (1036)
Q Consensus       366 ~~~~~la~~~d~~g~rti~VitK~Dl~~~g~~~~----~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla  441 (1036)
                      -+|.+.|+.   .+.+.|..|||+|.-  |.+-.    +.|...+.+=.+|=                       -...+
T Consensus       243 ~EaIkhAk~---A~VpiVvAinKiDkp--~a~pekv~~eL~~~gi~~E~~GG-----------------------dVQvi  294 (683)
T KOG1145|consen  243 LEAIKHAKS---ANVPIVVAINKIDKP--GANPEKVKRELLSQGIVVEDLGG-----------------------DVQVI  294 (683)
T ss_pred             HHHHHHHHh---cCCCEEEEEeccCCC--CCCHHHHHHHHHHcCccHHHcCC-----------------------ceeEE
Confidence            344555554   478999999999954  44432    22222222222221                       23457


Q ss_pred             eecccchhhhHHHHHH
Q psy5059         442 VVTANTDMATSESLKL  457 (1036)
Q Consensus       442 ~ISA~td~~~qeil~l  457 (1036)
                      -|||++|.+...+.+.
T Consensus       295 piSAl~g~nl~~L~ea  310 (683)
T KOG1145|consen  295 PISALTGENLDLLEEA  310 (683)
T ss_pred             EeecccCCChHHHHHH
Confidence            7999999998877654


No 385
>cd04122 Rab14 Rab14 subfamily.  Rab14 GTPases are localized to biosynthetic compartments, including the rough ER, the Golgi complex, and the trans-Golgi network, and to endosomal compartments, including early endosomal vacuoles and associated vesicles.  Rab14 is believed to function in both the biosynthetic and recycling pathways between the Golgi and endosomal compartments.  Rab14 has also been identified on GLUT4 vesicles, and has been suggested to help regulate GLUT4 translocation.  In addition, Rab14 is believed to play a role in the regulation of phagocytosis.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GT
Probab=94.79  E-value=0.022  Score=57.89  Aligned_cols=26  Identities=23%  Similarity=0.603  Sum_probs=23.3

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      .|++||.+||||||+++++++..|.+
T Consensus         4 ki~iiG~~~vGKTsli~~~~~~~~~~   29 (166)
T cd04122           4 KYIIIGDMGVGKSCLLHQFTEKKFMA   29 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCCC
Confidence            58999999999999999999877644


No 386
>cd04118 Rab24 Rab24 subfamily.  Rab24 is distinct from other Rabs in several ways.  It exists primarily in the GTP-bound state, having a low intrinsic GTPase activity; it is not efficiently geranyl-geranylated at the C-terminus; it does not form a detectable complex with Rab GDP-dissociation inhibitors (GDIs); and it has recently been shown to undergo tyrosine phosphorylation when overexpressed in vitro. The specific function of Rab24 still remains unknown. It is found in a transport route between ER-cis-Golgi and late endocytic compartments.  It is putatively involved in an autophagic pathway, possibly directing misfolded proteins in the ER to degradative pathways.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilita
Probab=94.79  E-value=0.02  Score=59.79  Aligned_cols=25  Identities=40%  Similarity=0.749  Sum_probs=22.6

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|+|||.+|||||||++++++..|.
T Consensus         2 ki~vvG~~~vGKSsLi~~~~~~~~~   26 (193)
T cd04118           2 KVVMLGKESVGKTSLVERYVHHRFL   26 (193)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCcC
Confidence            5899999999999999999987764


No 387
>cd04116 Rab9 Rab9 subfamily.  Rab9 is found in late endosomes, together with mannose 6-phosphate receptors (MPRs) and the tail-interacting protein of 47 kD (TIP47).  Rab9 is a key mediator of vesicular transport from late endosomes to the trans-Golgi network (TGN) by redirecting the MPRs.  Rab9 has been identified as a key component for the replication of several viruses, including HIV1, Ebola, Marburg, and measles, making it a potential target for inhibiting a variety of viruses.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CX
Probab=94.79  E-value=0.022  Score=57.97  Aligned_cols=28  Identities=29%  Similarity=0.519  Sum_probs=24.1

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      +-.|+|||.+||||||+++++++..|.|
T Consensus         5 ~~ki~vvG~~~~GKTsli~~~~~~~~~~   32 (170)
T cd04116           5 LLKVILLGDGGVGKSSLMNRYVTNKFDT   32 (170)
T ss_pred             EEEEEEECCCCCCHHHHHHHHHcCCCCc
Confidence            3579999999999999999999876643


No 388
>PRK12288 GTPase RsgA; Reviewed
Probab=94.78  E-value=0.021  Score=65.96  Aligned_cols=25  Identities=32%  Similarity=0.488  Sum_probs=22.3

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .+|+||.+|||||||+|+|+|..-+
T Consensus       207 i~~~vG~sgVGKSTLiN~Ll~~~~~  231 (347)
T PRK12288        207 ISIFVGQSGVGKSSLINALLPEAEI  231 (347)
T ss_pred             CEEEECCCCCCHHHHHHHhccccce
Confidence            5899999999999999999996544


No 389
>cd04113 Rab4 Rab4 subfamily.  Rab4 has been implicated in numerous functions within the cell.  It helps regulate endocytosis through the sorting, recycling, and degradation of early endosomes. Mammalian Rab4 is involved in the regulation of many surface proteins including G-protein-coupled receptors, transferrin receptor, integrins, and surfactant protein A.  Experimental data implicate Rab4 in regulation of the recycling of internalized receptors back to the plasma membrane.  It is also believed to influence receptor-mediated antigen processing in B-lymphocytes, in calcium-dependent exocytosis in platelets, in alpha-amylase secretion in pancreatic cells, and in insulin-induced translocation of Glut4 from internal vesicles to the cell surface. Rab4 is known to share effector proteins with Rab5 and Rab11.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to p
Probab=94.78  E-value=0.025  Score=56.95  Aligned_cols=28  Identities=21%  Similarity=0.583  Sum_probs=24.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPRG   36 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr~   36 (1036)
                      .|+|+|.++|||||+++++++..|.+..
T Consensus         2 ki~v~G~~~vGKTsli~~l~~~~~~~~~   29 (161)
T cd04113           2 KFIIIGSSGTGKSCLLHRFVENKFKEDS   29 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCCCCCC
Confidence            4899999999999999999998775543


No 390
>KOG1424|consensus
Probab=94.76  E-value=0.018  Score=67.93  Aligned_cols=22  Identities=45%  Similarity=0.608  Sum_probs=20.2

Q ss_pred             CeEEEeccCCCchHHHHHhhhc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVG   29 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g   29 (1036)
                      =.|-.||.|||||||++|+|+|
T Consensus       315 vtVG~VGYPNVGKSSTINaLvG  336 (562)
T KOG1424|consen  315 VTVGFVGYPNVGKSSTINALVG  336 (562)
T ss_pred             eEEEeecCCCCchhHHHHHHhc
Confidence            3577899999999999999999


No 391
>PRK10463 hydrogenase nickel incorporation protein HypB; Provisional
Probab=94.76  E-value=0.38  Score=54.22  Aligned_cols=189  Identities=13%  Similarity=0.141  Sum_probs=0.0

Q ss_pred             HHHHHHHHhhhhcCCCCCCCCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhccCCC
Q psy5059          64 AVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTM  143 (1036)
Q Consensus        64 ~l~~kL~~~~~~~g~~~i~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~~~~  143 (1036)
                      .+-...+..|..-|     ..-|.++|.++|||||||+.+.+.-                                    
T Consensus        90 ~~a~~~r~~~~~~~-----~~~v~l~G~pGsGKTTLl~~l~~~l------------------------------------  128 (290)
T PRK10463         90 RLAERNRARFAARK-----QLVLNLVSSPGSGKTTLLTETLMRL------------------------------------  128 (290)
T ss_pred             HHHHHHHHHHHhcC-----CeEEEEECCCCCCHHHHHHHHHHHh------------------------------------


Q ss_pred             CccccccccccccccccchhhhhhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHHHHHHhcCCC
Q psy5059         144 DLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKN  223 (1036)
Q Consensus       144 ~~~~w~~~~~~~~~~~~df~~~r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~~~~~~g~~  223 (1036)
                                                                                                      
T Consensus       129 --------------------------------------------------------------------------------  128 (290)
T PRK10463        129 --------------------------------------------------------------------------------  128 (290)
T ss_pred             --------------------------------------------------------------------------------


Q ss_pred             CCcCCCcEEEEEeec-----CcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccc-cccccchh
Q psy5059         224 KGICSEPIILKIYST-----SVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTAN-TDMATSES  297 (1036)
Q Consensus       224 ~~~S~d~I~L~I~~P-----~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An-~D~~~s~a  297 (1036)
                         ....-..-|.+.     +.--+...+.| .+...++.----...++..-+..+-..+..+++.=...| .+.+.-+ 
T Consensus       129 ---~~~~~~~VI~gD~~t~~Da~rI~~~g~p-vvqi~tG~~Chl~a~mv~~Al~~L~~~~~d~liIEnvGnLvcPa~fd-  203 (290)
T PRK10463        129 ---KDSVPCAVIEGDQQTVNDAARIRATGTP-AIQVNTGKGCHLDAQMIADAAPRLPLDDNGILFIENVGNLVCPASFD-  203 (290)
T ss_pred             ---ccCCCEEEECCCcCcHHHHHHHHhcCCc-EEEecCCCCCcCcHHHHHHHHHHHhhcCCcEEEEECCCCccCCCccc-


Q ss_pred             hhhhhhcCCCCCcccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccc
Q psy5059         298 LKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDV  377 (1036)
Q Consensus       298 l~l~r~~Dp~g~RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~  377 (1036)
                                                                      +.....+.+..|+...|....--..+...-  
T Consensus       204 ------------------------------------------------lge~~~v~vlsV~eg~dkplKyp~~f~~AD--  233 (290)
T PRK10463        204 ------------------------------------------------LGEKHKVAVLSVTEGEDKPLKYPHMFAAAS--  233 (290)
T ss_pred             ------------------------------------------------hhhceeEEEEECccccccchhccchhhcCc--


Q ss_pred             cCCceEEEEecccccC--CCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHH
Q psy5059         378 DGRRTLAVVTKIDLMD--AGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESL  455 (1036)
Q Consensus       378 ~g~rti~VitK~Dl~~--~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil  455 (1036)
                           ++|+||+||.+  .                           ..+...+...-.....+++..+||+++....+++
T Consensus       234 -----IVVLNKiDLl~~~~---------------------------~dle~~~~~lr~lnp~a~I~~vSA~tGeGld~L~  281 (290)
T PRK10463        234 -----LMLLNKVDLLPYLN---------------------------FDVEKCIACAREVNPEIEIILISATSGEGMDQWL  281 (290)
T ss_pred             -----EEEEEhHHcCcccH---------------------------HHHHHHHHHHHhhCCCCcEEEEECCCCCCHHHHH


Q ss_pred             HHhhh
Q psy5059         456 KLAKE  460 (1036)
Q Consensus       456 ~la~~  460 (1036)
                      ++..+
T Consensus       282 ~~L~~  286 (290)
T PRK10463        282 NWLET  286 (290)
T ss_pred             HHHHH


No 392
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily.  Arl9 (Arf-like 9) was first identified as part of the Human Cancer Genome Project.  It maps to chromosome 4q12 and is sometimes referred to as Arfrp2 (Arf-related protein 2).  This is a novel subfamily identified in human cancers that is uncharacterized to date.
Probab=94.74  E-value=0.022  Score=58.29  Aligned_cols=24  Identities=38%  Similarity=0.607  Sum_probs=22.1

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      ||++||.+||||||+++++++..|
T Consensus         1 ~i~ivG~~~vGKTsli~~~~~~~~   24 (164)
T cd04162           1 QILVLGLDGAGKTSLLHSLSSERS   24 (164)
T ss_pred             CEEEECCCCCCHHHHHHHHhcCCC
Confidence            799999999999999999998654


No 393
>cd00881 GTP_translation_factor GTP translation factor family.  This family consists primarily of translation initiation, elongation, and release factors, which play specific roles in protein translation.  In addition, the family includes Snu114p, a component of the U5 small nuclear riboprotein particle which is a component of the spliceosome and is involved in excision of introns, TetM, a tetracycline resistance gene that protects the ribosome from tetracycline binding, and the unusual subfamily CysN/ATPS, which has an unrelated function (ATP sulfurylase) acquired through lateral transfer of the EF1-alpha gene and development of a new function.
Probab=94.73  E-value=0.02  Score=58.75  Aligned_cols=27  Identities=19%  Similarity=0.204  Sum_probs=23.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPR   35 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr   35 (1036)
                      .|+|+|.+||||||++|+|.|..+.+.
T Consensus         1 ~v~v~G~~~~GKStlln~l~~~~~~~~   27 (189)
T cd00881           1 NVGIAGHVDHGKTTLTERLLYVTGDIE   27 (189)
T ss_pred             CEEEEeCCCCCHHHHHHHHHHhcCCCC
Confidence            389999999999999999999875443


No 394
>cd01856 YlqF YlqF.  Proteins of the YlqF family contain all sequence motifs typical of the vast class of P-loop-containing GTPases, but show a circular permutation, with a G4-G1-G3 pattern of motifs as opposed to the regular G1-G3-G4 pattern seen in most GTPases. The YlqF subfamily is represented in a phylogenetically diverse array of bacteria (including gram-positive bacteria, proteobacteria, Synechocystis, Borrelia, and Thermotoga) and in all eukaryotes.
Probab=94.73  E-value=0.032  Score=57.65  Aligned_cols=27  Identities=37%  Similarity=0.524  Sum_probs=24.3

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      +.|++||.+||||||++|+|.|..+..
T Consensus       116 ~~~~~~G~~~vGKstlin~l~~~~~~~  142 (171)
T cd01856         116 IRAMVVGIPNVGKSTLINRLRGKKVAK  142 (171)
T ss_pred             eEEEEECCCCCCHHHHHHHHhCCCcee
Confidence            579999999999999999999977654


No 395
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases.  Arf proteins are activators of phospholipase D isoforms.  Unlike Ras proteins they lack cysteine residues at their C-termini and therefore are unlikely to be prenylated.  Arfs are N-terminally myristoylated.  Members of the Arf family are regulators of vesicle formation in intracellular traffic that interact reversibly with membranes of the secretory and endocytic compartments in a GTP-dependent manner.  They depart from other small GTP-binding proteins by a unique structural device, interswitch toggle, that implements front-back communication from N-terminus to the nucleotide binding site.  Arf-like (Arl) proteins are close relatives of the Arf, but only Arl1 has been shown to function in membrane traffic like the Arf proteins.  Arl2 has an unrelated function in the folding of native tubulin, and Arl4 may function in the nucleus.  Most other Arf family proteins are so far relatively poorly characterized.  Thu
Probab=94.73  E-value=0.021  Score=57.30  Aligned_cols=23  Identities=22%  Similarity=0.479  Sum_probs=21.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .|+++|.+||||||++++++|..
T Consensus         1 ki~iiG~~~~GKssli~~~~~~~   23 (158)
T cd00878           1 RILILGLDGAGKTTILYKLKLGE   23 (158)
T ss_pred             CEEEEcCCCCCHHHHHHHHhcCC
Confidence            48999999999999999999876


No 396
>PRK13768 GTPase; Provisional
Probab=94.70  E-value=0.091  Score=58.13  Aligned_cols=137  Identities=16%  Similarity=0.150  Sum_probs=78.6

Q ss_pred             ceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhc-----cccCCceEEEEe
Q psy5059         313 DLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKET-----DVDGRRTLAVVT  387 (1036)
Q Consensus       313 gvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~-----d~~g~rti~Vit  387 (1036)
                      -++.+|+||........      ..++.+.+.+-...+..+++++|+.......+ ...+..+     ...+.+.|.|+|
T Consensus        98 ~~~~~d~~g~~~~~~~~------~~~~~~~~~l~~~~~~~ii~liD~~~~~~~~d-~~~~~~l~~~~~~~~~~~~i~v~n  170 (253)
T PRK13768         98 DYVLVDTPGQMELFAFR------ESGRKLVERLSGSSKSVVVFLIDAVLAKTPSD-FVSLLLLALSVQLRLGLPQIPVLN  170 (253)
T ss_pred             CEEEEeCCcHHHHHhhh------HHHHHHHHHHHhcCCeEEEEEechHHhCCHHH-HHHHHHHHHHHHHHcCCCEEEEEE
Confidence            36788999977655431      22334443333333778999999976332222 2222211     145899999999


Q ss_pred             cccccCCCchh--hhhhcCc-----ccccccccccccchHHHHHHHHHHhhccCCC-cceeeeecccchhhhHHHHHHhh
Q psy5059         388 KIDLMDAGTDA--IDILCGR-----VIPVKLDVDGRRTYIEAQIKQLVLHYISNPN-SIILAVVTANTDMATSESLKLAK  459 (1036)
Q Consensus       388 K~Dl~~~g~~~--~~~l~~~-----~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~-~ipla~ISA~td~~~qeil~la~  459 (1036)
                      |.|+.+.....  ...+...     -.-..+   |..    +.++..+.+.+.... ..++..+||+++....++.....
T Consensus       171 K~D~~~~~~~~~~~~~l~~~~~~~~~l~~~~---~~~----~~~~~~~~~~i~~~~~~~~vi~iSa~~~~gl~~L~~~I~  243 (253)
T PRK13768        171 KADLLSEEELERILKWLEDPEYLLEELKLEK---GLQ----GLLSLELLRALEETGLPVRVIPVSAKTGEGFDELYAAIQ  243 (253)
T ss_pred             hHhhcCchhHHHHHHHHhCHHHHHHHHhccc---chH----HHHHHHHHHHHHHHCCCCcEEEEECCCCcCHHHHHHHHH
Confidence            99998765331  1222210     000111   111    445555545444433 34678899999999999998887


Q ss_pred             hcCc
Q psy5059         460 ETDV  463 (1036)
Q Consensus       460 ~vd~  463 (1036)
                      +.-+
T Consensus       244 ~~l~  247 (253)
T PRK13768        244 EVFC  247 (253)
T ss_pred             HHcC
Confidence            6643


No 397
>cd01851 GBP Guanylate-binding protein (GBP), N-terminal domain. Guanylate-binding proteins (GBPs) define a group of proteins that are synthesized after activation of the cell by interferons.  The biochemical properties of GBPs are clearly different from those of Ras-like and heterotrimeric GTP-binding proteins.  They bind guanine nucleotides with low affinity (micromolar range), are stable in their absence and have a high turnover GTPase.  In addition to binding GDP/GTP, they have the unique ability to bind GMP with equal affinity and hydrolyze GTP not only to GDP, but also to GMP. Furthermore, two unique regions around the base and the phosphate-binding areas, the guanine and the phosphate caps, respectively, give the nucleotide-binding site a unique appearance not found in the canonical GTP-binding proteins.  The phosphate cap, which constitutes the region analogous to switch I, completely shields the phosphate-binding site from solvent such that a potential GTPase-activating protein
Probab=94.64  E-value=0.022  Score=61.87  Aligned_cols=35  Identities=34%  Similarity=0.429  Sum_probs=27.5

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCC--CcCccccc--cccc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGK--SFLPRGIG--IVTR  118 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~--~flPrg~G--~cTR  118 (1036)
                      .--|+|+|.|++|||+||+.|.|.  .| +.+.+  -|||
T Consensus         7 v~vvsv~G~~~sGKS~llN~l~~~~~~f-~~~~~~~~~T~   45 (224)
T cd01851           7 VAVVSVFGPQSSGKSFLLNHLFGTLSGF-DVMDTSQQTTK   45 (224)
T ss_pred             EEEEEEECCCCCCHHHHHHHHhCCCCCe-EecCCCCCCcc
Confidence            346899999999999999999998  64 55554  4443


No 398
>cd04117 Rab15 Rab15 subfamily.  Rab15 colocalizes with the transferrin receptor in early endosome compartments, but not with late endosomal markers. It codistributes with Rab4 and Rab5 on early/sorting endosomes, and with Rab11 on pericentriolar recycling endosomes. It is believed to function as an inhibitory GTPase that regulates distinct steps in early endocytic trafficking.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to
Probab=94.62  E-value=0.025  Score=57.40  Aligned_cols=26  Identities=15%  Similarity=0.496  Sum_probs=23.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      .|++||.+||||||+++++++..|.|
T Consensus         2 ki~vvG~~~~GKTsli~~~~~~~~~~   27 (161)
T cd04117           2 RLLLIGDSGVGKTCLLCRFTDNEFHS   27 (161)
T ss_pred             EEEEECcCCCCHHHHHHHHhcCCCCC
Confidence            58999999999999999999887743


No 399
>cd00876 Ras Ras family.  The Ras family of the Ras superfamily includes classical N-Ras, H-Ras, and K-Ras, as well as R-Ras, Rap, Ral, Rheb, Rhes, ARHI, RERG, Rin/Rit, RSR1, RRP22, Ras2, Ras-dva, and RGK proteins.  Ras proteins regulate cell growth, proliferation and differentiation.  Ras is activated by guanine nucleotide exchange factors (GEFs) that release GDP and allow GTP binding.  Many RasGEFs have been identified.  These are sequestered in the cytosol until activation by growth factors triggers recruitment to the plasma membrane or Golgi, where the GEF colocalizes with Ras.  Active GTP-bound Ras interacts with several effector proteins: among the best characterized are the Raf kinases, phosphatidylinositol 3-kinase (PI3K), RalGEFs and NORE/MST1.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of m
Probab=94.62  E-value=0.023  Score=56.51  Aligned_cols=24  Identities=33%  Similarity=0.606  Sum_probs=21.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|+|+|.+||||||+++++.+..|
T Consensus         1 ki~i~G~~~~GKTsli~~l~~~~~   24 (160)
T cd00876           1 KVVVLGAGGVGKSAITIQFVKGTF   24 (160)
T ss_pred             CEEEECCCCCCHHHHHHHHHhCCC
Confidence            489999999999999999998663


No 400
>cd04139 RalA_RalB RalA/RalB subfamily.  The Ral (Ras-like) subfamily consists of the highly homologous RalA and RalB.  Ral proteins are believed to play a crucial role in tumorigenesis, metastasis, endocytosis, and actin cytoskeleton dynamics.  Despite their high sequence similarity (80% sequence identity), nonoverlapping and opposing functions have been assigned to RalA and RalBs in tumor migration.  In human bladder and prostate cancer cells, RalB promotes migration while RalA inhibits it.  A Ral-specific set of GEFs has been identified that are activated by Ras binding.  This RalGEF activity is enhanced by Ras binding to another of its target proteins, phosphatidylinositol 3-kinase (PI3K).   Ral effectors include RLIP76/RalBP1, a Rac/cdc42 GAP, and the exocyst (Sec6/8) complex, a heterooctomeric protein complex that is involved in tethering vesicles to specific sites on the plasma membrane prior to exocytosis.  In rat kidney cells, RalB is required for functional assembly of the exo
Probab=94.62  E-value=0.025  Score=56.65  Aligned_cols=25  Identities=28%  Similarity=0.546  Sum_probs=22.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|+++|.+||||||+++++++..|.
T Consensus         2 ki~~~G~~~~GKTsl~~~l~~~~~~   26 (164)
T cd04139           2 KVIVVGAGGVGKSALTLQFMYDEFV   26 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCCc
Confidence            5899999999999999999987654


No 401
>cd04145 M_R_Ras_like M-Ras/R-Ras-like subfamily.  This subfamily contains R-Ras2/TC21, M-Ras/R-Ras3, and related members of the Ras family. M-Ras is expressed in lympho-hematopoetic cells.  It interacts with some of the known Ras effectors, but appears to also have its own effectors.  Expression of mutated M-Ras leads to transformation of several types of cell lines, including hematopoietic cells, mammary epithelial cells, and fibroblasts.  Overexpression of M-Ras is observed in carcinomas from breast, uterus, thyroid, stomach, colon, kidney, lung, and rectum.  In addition, expression of a constitutively active M-Ras mutant in murine bone marrow induces a malignant mast cell leukemia that is distinct from the monocytic leukemia induced by H-Ras.  TC21, along with H-Ras, has been shown to regulate the branching morphogenesis of ureteric bud cell branching in mice.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an ali
Probab=94.61  E-value=0.024  Score=56.99  Aligned_cols=24  Identities=33%  Similarity=0.549  Sum_probs=21.9

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||.+||||||+++++++..|
T Consensus         4 ki~i~G~~~~GKtsl~~~~~~~~~   27 (164)
T cd04145           4 KLVVVGGGGVGKSALTIQFIQSYF   27 (164)
T ss_pred             EEEEECCCCCcHHHHHHHHHhCCC
Confidence            689999999999999999998664


No 402
>cd01864 Rab19 Rab19 subfamily.  Rab19 proteins are associated with Golgi stacks. Similarity analysis indicated that Rab41 is closely related to Rab19. However, the function of these Rabs is not yet chracterized. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization. Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.  Due to the presence of truncated sequences in this CD, the lipid modification site is not available for annotation.
Probab=94.60  E-value=0.025  Score=57.26  Aligned_cols=26  Identities=27%  Similarity=0.614  Sum_probs=22.9

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      ...|+|||.+||||||+++++++..|
T Consensus         3 ~~kv~vvG~~~~GKTsli~~l~~~~~   28 (165)
T cd01864           3 LFKIILIGDSNVGKTCVVQRFKSGTF   28 (165)
T ss_pred             eeEEEEECCCCCCHHHHHHHHhhCCC
Confidence            45799999999999999999987654


No 403
>cd04155 Arl3 Arl3 subfamily.  Arl3 (Arf-like 3) is an Arf family protein that differs from most Arf family members in the N-terminal extension.  In is inactive, GDP-bound form, the N-terminal extension forms an elongated loop that is hydrophobically anchored into the membrane surface; however, it has been proposed that this region might form a helix in the GTP-bound form.  The delta subunit of the rod-specific cyclic GMP phosphodiesterase type 6 (PDEdelta) is an Arl3 effector.  Arl3 binds microtubules in a regulated manner to alter specific aspects of cytokinesis via interactions with retinitis pigmentosa 2 (RP2).  It has been proposed that RP2 functions in concert with Arl3 to link the cell membrane and the cytoskeleton in photoreceptors as part of the cell signaling or vesicular transport machinery.  In mice, the absence of Arl3 is associated with abnormal epithelial cell proliferation and cyst formation.
Probab=94.60  E-value=0.025  Score=57.59  Aligned_cols=26  Identities=23%  Similarity=0.673  Sum_probs=22.9

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      -..|+++|.+||||||++++|.|..+
T Consensus        14 ~~~v~i~G~~g~GKStLl~~l~~~~~   39 (173)
T cd04155          14 EPRILILGLDNAGKTTILKQLASEDI   39 (173)
T ss_pred             ccEEEEEccCCCCHHHHHHHHhcCCC
Confidence            35799999999999999999998743


No 404
>cd04124 RabL2 RabL2 subfamily.  RabL2 (Rab-like2) subfamily.  RabL2s are novel Rab proteins identified recently which display features that are distinct from other Rabs, and have been termed Rab-like. RabL2 contains RabL2a and RabL2b, two very similar Rab proteins that share  98% sequence identity in humans. RabL2b maps to the subtelomeric region of chromosome 22q13.3 and RabL2a maps to 2q13, a region that suggests it is also a subtelomeric gene. Both genes are believed to be expressed ubiquitously, suggesting that RabL2s are the first example of duplicated genes in human proximal subtelomeric regions that are both expressed actively. Like other Rab-like proteins, RabL2s lack a prenylation site at the C-terminus. The specific functions of RabL2a and RabL2b remain unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-b
Probab=94.57  E-value=0.026  Score=57.25  Aligned_cols=26  Identities=27%  Similarity=0.649  Sum_probs=23.0

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      .|++||.+|||||||++++++..|-|
T Consensus         2 ki~vvG~~~vGKTsli~~~~~~~~~~   27 (161)
T cd04124           2 KIILLGDSAVGKSKLVERFLMDGYEP   27 (161)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCCCC
Confidence            58999999999999999999876643


No 405
>PRK15494 era GTPase Era; Provisional
Probab=94.57  E-value=0.022  Score=65.73  Aligned_cols=24  Identities=25%  Similarity=0.742  Sum_probs=22.2

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||++|||||||+|+|+|..+
T Consensus        54 kV~ivG~~nvGKSTLin~l~~~k~   77 (339)
T PRK15494         54 SVCIIGRPNSGKSTLLNRIIGEKL   77 (339)
T ss_pred             EEEEEcCCCCCHHHHHHHHhCCce
Confidence            799999999999999999999664


No 406
>cd04160 Arfrp1 Arfrp1 subfamily.  Arfrp1 (Arf-related protein 1), formerly known as ARP, is a membrane-associated Arf family member that lacks the N-terminal myristoylation motif.  Arfrp1 is mainly associated with the trans-Golgi compartment and the trans-Golgi network, where it regulates the targeting of Arl1 and the GRIP domain-containing proteins, golgin-97 and golgin-245, onto Golgi membranes.  It is also involved in the anterograde transport of the vesicular stomatitis virus G protein from the Golgi to the plasma membrane, and in the retrograde transport of TGN38 and Shiga toxin from endosomes to the trans-Golgi network.  Arfrp1 also inhibits Arf/Sec7-dependent activation of phospholipase D.  Deletion of Arfrp1 in mice causes embryonic lethality at the gastrulation stage and apoptosis of mesodermal cells, indicating its importance in development.
Probab=94.57  E-value=0.021  Score=57.73  Aligned_cols=21  Identities=24%  Similarity=0.582  Sum_probs=19.8

Q ss_pred             EEEeccCCCchHHHHHhhhcC
Q psy5059          10 IVVVGTQSSGKSSVIESLVGK   30 (1036)
Q Consensus        10 i~vvg~~~~gkss~~~~~~g~   30 (1036)
                      |++||.+|||||||+++|.+.
T Consensus         2 i~~vG~~~~GKstLi~~l~~~   22 (167)
T cd04160           2 VLILGLDNAGKTTFLEQLKTL   22 (167)
T ss_pred             EEEEecCCCCHHHHHHHHhhh
Confidence            899999999999999999884


No 407
>cd01881 Obg_like The Obg-like subfamily consists of five well-delimited, ancient subfamilies, namely Obg, DRG, YyaF/YchF, Ygr210, and NOG1.  Four of these groups (Obg, DRG, YyaF/YchF, and Ygr210) are characterized by a distinct glycine-rich motif immediately following the Walker B motif (G3 box).  Obg/CgtA is an essential gene that is involved in the initiation of sporulation and DNA replication in the bacteria Caulobacter and Bacillus, but its exact molecular role is unknown.  Furthermore, several OBG family members possess a C-terminal RNA-binding domain, the TGS domain, which is also present in threonyl-tRNA synthetase and in bacterial guanosine polyphosphatase SpoT.  Nog1 is a nucleolar protein that might function in ribosome assembly.  The DRG and Nog1 subfamilies are ubiquitous in archaea and eukaryotes, the Ygr210 subfamily is present in archaea and fungi, and the Obg and YyaF/YchF subfamilies are ubiquitous in bacteria and eukaryotes. The Obg/Nog1 and DRG subfamilies appear to 
Probab=94.51  E-value=0.021  Score=58.07  Aligned_cols=21  Identities=29%  Similarity=0.487  Sum_probs=19.3

Q ss_pred             EeccCCCchHHHHHhhhcCCc
Q psy5059          12 VVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus        12 vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      ++|.+||||||++++|+|..+
T Consensus         1 iiG~~~~GKStll~~l~~~~~   21 (176)
T cd01881           1 LVGLPNVGKSTLLNALTNAKP   21 (176)
T ss_pred             CCCCCCCcHHHHHHHHhcCCc
Confidence            589999999999999999865


No 408
>PRK12289 GTPase RsgA; Reviewed
Probab=94.49  E-value=0.034  Score=64.33  Aligned_cols=26  Identities=38%  Similarity=0.457  Sum_probs=22.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      .+||||.+|||||||+|+|+|..-+.
T Consensus       174 i~v~iG~SgVGKSSLIN~L~~~~~~~  199 (352)
T PRK12289        174 ITVVAGPSGVGKSSLINRLIPDVELR  199 (352)
T ss_pred             eEEEEeCCCCCHHHHHHHHcCccccc
Confidence            58999999999999999999955443


No 409
>TIGR00157 ribosome small subunit-dependent GTPase A. The Aquifex aeolicus ortholog is split into consecutive open reading frames. Consequently, this model was build in fragment mode (-f option).
Probab=94.48  E-value=0.036  Score=61.05  Aligned_cols=25  Identities=32%  Similarity=0.302  Sum_probs=22.2

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      ..++++|.+|||||||+|+|.|...
T Consensus       121 ~~~~~~G~sgvGKStLiN~L~~~~~  145 (245)
T TIGR00157       121 RISVFAGQSGVGKSSLINALDPSVK  145 (245)
T ss_pred             CEEEEECCCCCCHHHHHHHHhhhhh
Confidence            4789999999999999999999543


No 410
>COG0370 FeoB Fe2+ transport system protein B [Inorganic ion transport and metabolism]
Probab=94.45  E-value=0.068  Score=65.46  Aligned_cols=34  Identities=21%  Similarity=0.280  Sum_probs=25.9

Q ss_pred             CCCCCChhHHHHHHHHHHHHhhccHHHHHHHHHHHHH
Q psy5059         900 PALFVPEVSFELLVKRQIRRLEEPSQRCVELVHEEMQ  936 (1036)
Q Consensus       900 ~~lfvp~~aFe~Lvk~qI~~l~~Psl~cvdlV~~EL~  936 (1036)
                      ...|+|.+||-.++=   -.|-.||+.-+-.++.|.-
T Consensus       589 ~~~~tp~sa~~flvf---~llY~PCiati~~i~~E~g  622 (653)
T COG0370         589 QATLTPASAYAFLVF---VLLYVPCIATLAAIKRETG  622 (653)
T ss_pred             HccCCHHHHHHHHHH---HHHHHHHHHHHHHHHHHhh
Confidence            346889998888874   4567788888888888875


No 411
>KOG0410|consensus
Probab=94.45  E-value=0.027  Score=63.03  Aligned_cols=35  Identities=31%  Similarity=0.546  Sum_probs=31.0

Q ss_pred             CCCCCCCeEEEeccCCCchHHHHHhhhcCCccccc
Q psy5059           2 TDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRG   36 (1036)
Q Consensus         2 ~~~~~lp~i~vvg~~~~gkss~~~~~~g~~~~pr~   36 (1036)
                      ....+.|.|+|||..|+|||||++.|.|-..+|+.
T Consensus       173 r~~~s~pviavVGYTNaGKsTLikaLT~Aal~p~d  207 (410)
T KOG0410|consen  173 REGESSPVIAVVGYTNAGKSTLIKALTKAALYPND  207 (410)
T ss_pred             cccCCCceEEEEeecCccHHHHHHHHHhhhcCccc
Confidence            34567899999999999999999999998888865


No 412
>cd04177 RSR1 RSR1 subgroup.  RSR1/Bud1p is a member of the Rap subfamily of the Ras family that is found in fungi.  In budding yeasts, RSR1 is involved in selecting a site for bud growth on the cell cortex, which directs the establishment of cell polarization.  The Rho family GTPase cdc42 and its GEF, cdc24, then establish an axis of polarized growth by organizing the actin cytoskeleton and secretory apparatus at the bud site.  It is believed that cdc42 interacts directly with RSR1 in vivo.  In filamentous fungi, polar growth occurs at the tips of hypha and at novel growth sites along the extending hypha.  In Ashbya gossypii, RSR1 is a key regulator of hyphal growth, localizing at the tip region and regulating in apical polarization of the actin cytoskeleton.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key featu
Probab=94.45  E-value=0.027  Score=57.39  Aligned_cols=25  Identities=36%  Similarity=0.618  Sum_probs=22.3

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|++||.+||||||+++++++..|.
T Consensus         3 ki~liG~~~~GKTsli~~~~~~~~~   27 (168)
T cd04177           3 KIVVLGAGGVGKSALTVQFVQNVFI   27 (168)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCCC
Confidence            4899999999999999999876664


No 413
>smart00178 SAR Sar1p-like members of the Ras-family  of small GTPases. Yeast SAR1 is an essential gene required for transport of secretory proteins from the endoplasmic reticulum to the Golgi apparatus.
Probab=94.43  E-value=0.029  Score=58.48  Aligned_cols=25  Identities=20%  Similarity=0.522  Sum_probs=22.9

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      +.|++||.+||||||++++++|..|
T Consensus        18 ~~i~ivG~~~~GKTsli~~l~~~~~   42 (184)
T smart00178       18 AKILFLGLDNAGKTTLLHMLKNDRL   42 (184)
T ss_pred             CEEEEECCCCCCHHHHHHHHhcCCC
Confidence            7899999999999999999998654


No 414
>TIGR00991 3a0901s02IAP34 GTP-binding protein (Chloroplast Envelope Protein Translocase).
Probab=94.41  E-value=0.029  Score=63.48  Aligned_cols=27  Identities=33%  Similarity=0.602  Sum_probs=24.2

Q ss_pred             CCCCeEEEeccCCCchHHHHHhhhcCC
Q psy5059           5 IQLPQIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         5 ~~lp~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .....|++||.+||||||++|+|+|..
T Consensus        36 ~~~~rIllvGktGVGKSSliNsIlG~~   62 (313)
T TIGR00991        36 VSSLTILVMGKGGVGKSSTVNSIIGER   62 (313)
T ss_pred             ccceEEEEECCCCCCHHHHHHHHhCCC
Confidence            355689999999999999999999975


No 415
>PRK14845 translation initiation factor IF-2; Provisional
Probab=94.40  E-value=0.17  Score=66.01  Aligned_cols=24  Identities=21%  Similarity=0.297  Sum_probs=20.2

Q ss_pred             CCcceeeeecccchhhhHHHHHHh
Q psy5059         435 PNSIILAVVTANTDMATSESLKLA  458 (1036)
Q Consensus       435 ~~~ipla~ISA~td~~~qeil~la  458 (1036)
                      -..++++-|||++|.+...++.+.
T Consensus       645 ~~~v~iVpVSA~tGeGId~Ll~~l  668 (1049)
T PRK14845        645 TRTVAIVPVSAKTGEGIPELLMMV  668 (1049)
T ss_pred             CCCceEEEEEcCCCCCHHHHHHHH
Confidence            456888999999999999988664


No 416
>KOG2203|consensus
Probab=94.37  E-value=0.025  Score=66.79  Aligned_cols=30  Identities=37%  Similarity=0.651  Sum_probs=26.2

Q ss_pred             CCCCeEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           5 IQLPQIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         5 ~~lp~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      ++--.|+|.|+||||||||||.|.|..|.-
T Consensus        35 l~YhVVavmG~QSSGKSTLLN~LFgTnF~~   64 (772)
T KOG2203|consen   35 LSYHVVAVMGSQSSGKSTLLNHLFGTNFRE   64 (772)
T ss_pred             cceeEEEEecCcccchHHHHHHHhccChHH
Confidence            445689999999999999999999987755


No 417
>cd01892 Miro2 Miro2 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the putative GTPase domain in the C terminus of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=94.36  E-value=0.03  Score=57.49  Aligned_cols=26  Identities=35%  Similarity=0.635  Sum_probs=23.5

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      -.|++||.+||||||+++++++..|.
T Consensus         5 ~kv~~vG~~~vGKTsli~~~~~~~f~   30 (169)
T cd01892           5 FLCFVLGAKGSGKSALLRAFLGRSFS   30 (169)
T ss_pred             EEEEEECCCCCcHHHHHHHHhCCCCC
Confidence            46999999999999999999998764


No 418
>PF04548 AIG1:  AIG1 family;  InterPro: IPR006703 This entry represents a domain found in Arabidopsis protein AIG1 which appears to be involved in plant resistance to bacteria. The Arabidopsis disease resistance gene RPS2 is involved in recognition of bacterial pathogens carrying the avirulence gene avrRpt2. AIG1 (avrRpt2-induced gene) exhibits RPS2- and avrRpt2-dependent induction early after infection with Pseudomonas syringae carrying avrRpt2 [].  The domain is also apparently found in a number of mammalian proteins, for example the rat immune-associated nucleotide 4 protein. ; GO: 0005525 GTP binding; PDB: 3LXX_A 3BB4_A 3DEF_A 3BB3_A 2J3E_A 3V70_B 3BB1_A 1H65_B 2XTP_A 3P1J_C ....
Probab=94.34  E-value=0.038  Score=59.36  Aligned_cols=29  Identities=38%  Similarity=0.638  Sum_probs=23.7

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcccccC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPRGI   37 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr~~   37 (1036)
                      .|+++|..||||||+.|+|+|.+..+.+.
T Consensus         2 ~IlllG~tGsGKSs~~N~ilg~~~f~~~~   30 (212)
T PF04548_consen    2 RILLLGKTGSGKSSLGNSILGKEVFKSGS   30 (212)
T ss_dssp             EEEEECSTTSSHHHHHHHHHTSS-SS--T
T ss_pred             EEEEECCCCCCHHHHHHHHhcccceeecc
Confidence            48999999999999999999988776653


No 419
>PRK05291 trmE tRNA modification GTPase TrmE; Reviewed
Probab=94.33  E-value=0.046  Score=65.45  Aligned_cols=25  Identities=32%  Similarity=0.619  Sum_probs=23.0

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      +.|++||.+|||||||+|+|+|.+.
T Consensus       216 ~kV~ivG~~nvGKSSLln~L~~~~~  240 (449)
T PRK05291        216 LKVVIAGRPNVGKSSLLNALLGEER  240 (449)
T ss_pred             CEEEEECCCCCCHHHHHHHHhCCCC
Confidence            6899999999999999999999664


No 420
>cd00157 Rho Rho (Ras homology) family.  Members of the Rho family include RhoA, Cdc42, Rac, Rnd, Wrch1, RhoBTB, and Rop.  There are 22 human Rho family members identified currently.  These proteins are all involved in the reorganization of the actin cytoskeleton in response to external stimuli.  They also have roles in cell transformation by Ras in cytokinesis, in focal adhesion formation and in the stimulation of stress-activated kinase.  These various functions are controlled through distinct effector proteins and mediated through a GTP-binding/GTPase cycle involving three classes of regulating proteins: GAPs (GTPase-activating proteins), GEFs (guanine nucleotide exchange factors), and GDIs (guanine nucleotide dissociation inhibitors).  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho protein
Probab=94.31  E-value=0.03  Score=56.68  Aligned_cols=24  Identities=38%  Similarity=0.581  Sum_probs=22.3

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|+++|.+||||||++++|++..+
T Consensus         2 ki~i~G~~~~GKSsli~~l~~~~~   25 (171)
T cd00157           2 KIVVVGDGAVGKTCLLISYTTGKF   25 (171)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            489999999999999999999876


No 421
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily.  Rab34, found primarily in the Golgi, interacts with its effector, Rab-interacting lysosomal protein (RILP). This enables its participation in microtubular dynenin-dynactin-mediated repositioning of lysosomes from the cell periphery to the Golgi. A Rab34 (Rah) isoform that lacks the consensus GTP-binding region has been identified in mice.  This isoform is associated with membrane ruffles and promotes macropinosome formation.  Rab36 has been mapped to human chromosome 22q11.2, a region that is homozygously deleted in malignant rhabdoid tumors (MRTs). However, experimental assessments do not implicate Rab36 as a tumor suppressor that would enable tumor formation through a loss-of-function mechanism.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further re
Probab=94.30  E-value=0.033  Score=57.34  Aligned_cols=25  Identities=32%  Similarity=0.561  Sum_probs=23.0

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|++||.+||||||+++++++..|.
T Consensus         2 ki~ivG~~~vGKTsli~~~~~~~f~   26 (170)
T cd04108           2 KVIVVGDLSVGKTCLINRFCKDVFD   26 (170)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCC
Confidence            5899999999999999999998873


No 422
>smart00174 RHO Rho (Ras homology) subfamily of Ras-like small GTPases. Members of this subfamily of Ras-like small GTPases include Cdc42 and Rac, as well as Rho isoforms.
Probab=94.29  E-value=0.027  Score=57.50  Aligned_cols=23  Identities=35%  Similarity=0.609  Sum_probs=21.3

Q ss_pred             EEEeccCCCchHHHHHhhhcCCc
Q psy5059          10 IVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus        10 i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      |+|||.+||||||+++++.+..|
T Consensus         1 i~i~G~~~vGKTsli~~~~~~~~   23 (174)
T smart00174        1 LVVVGDGAVGKTCLLISYTTNAF   23 (174)
T ss_pred             CEEECCCCCCHHHHHHHHHhCCC
Confidence            68999999999999999998765


No 423
>cd04115 Rab33B_Rab33A Rab33B/Rab33A subfamily.  Rab33B is ubiquitously expressed in mouse tissues and cells, where it is localized to the medial Golgi cisternae. It colocalizes with alpha-mannose II.  Together with the other cisternal Rabs, Rab6A and Rab6A', it is believed to regulate the Golgi response to stress and is likely a molecular target in stress-activated signaling pathways. Rab33A (previously known as S10) is expressed primarily in the brain and immune system cells.  In humans, it is located on the X chromosome at Xq26 and its expression is down-regulated in tuberculosis patients. Experimental evidence suggests that Rab33A is a novel CD8+ T cell factor that likely plays a role in tuberculosis disease processes.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine 
Probab=94.28  E-value=0.033  Score=56.97  Aligned_cols=25  Identities=24%  Similarity=0.480  Sum_probs=22.4

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      ..|++||.+||||||+++++++..|
T Consensus         3 ~ki~vvG~~~vGKTsli~~~~~~~~   27 (170)
T cd04115           3 FKIIVIGDSNVGKTCLTYRFCAGRF   27 (170)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhCCC
Confidence            5799999999999999999987654


No 424
>cd04112 Rab26 Rab26 subfamily.  First identified in rat pancreatic acinar cells, Rab26 is believed to play a role in recruiting mature granules to the plasma membrane upon beta-adrenergic stimulation.  Rab26 belongs to the Rab functional group III, which are considered key regulators of intracellular vesicle transport during exocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=94.28  E-value=0.033  Score=58.39  Aligned_cols=25  Identities=20%  Similarity=0.551  Sum_probs=22.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|+|||.+||||||+++++++..|.
T Consensus         2 Ki~vvG~~~vGKTSli~~~~~~~~~   26 (191)
T cd04112           2 KVMLLGDSGVGKTCLLVRFKDGAFL   26 (191)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCC
Confidence            4899999999999999999987764


No 425
>TIGR00450 mnmE_trmE_thdF tRNA modification GTPase TrmE. TrmE, also called MnmE and previously designated ThdF (thiophene and furan oxidation protein), is a GTPase involved in tRNA modification to create 5-methylaminomethyl-2-thiouridine in the wobble position of some tRNAs. This protein and GidA form an alpha2/beta2 heterotetramer.
Probab=94.26  E-value=0.043  Score=65.53  Aligned_cols=26  Identities=27%  Similarity=0.447  Sum_probs=23.3

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      -+.||+||.+|||||||+|+|+|.++
T Consensus       203 g~kVvIvG~~nvGKSSLiN~L~~~~~  228 (442)
T TIGR00450       203 GFKLAIVGSPNVGKSSLLNALLKQDR  228 (442)
T ss_pred             CCEEEEECCCCCcHHHHHHHHhCCCC
Confidence            36899999999999999999999653


No 426
>cd04152 Arl4_Arl7 Arl4/Arl7 subfamily.  Arl4 (Arf-like 4) is highly expressed in testicular germ cells, and is found in the nucleus and nucleolus.  In mice, Arl4 is developmentally expressed during embryogenesis, and a role in somite formation and central nervous system differentiation has been proposed.  Arl7 has been identified as the only Arf/Arl protein to be induced by agonists of liver X-receptor and retinoid X-receptor and by cholesterol loading in human macrophages.  Arl7 is proposed to play a role in transport between a perinuclear compartment and the plasma membrane, apparently linked to the ABCA1-mediated cholesterol secretion pathway.  Older literature suggests that Arl6 is a part of the Arl4/Arl7 subfamily, but analyses based on more recent sequence data place Arl6 in its own subfamily.
Probab=94.26  E-value=0.033  Score=57.98  Aligned_cols=25  Identities=36%  Similarity=0.594  Sum_probs=22.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|++||.+||||||+++++.+..|.
T Consensus         5 kv~~vG~~~~GKTsli~~~~~~~~~   29 (183)
T cd04152           5 HIVMLGLDSAGKTTVLYRLKFNEFV   29 (183)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCcC
Confidence            5899999999999999999987653


No 427
>cd04176 Rap2 Rap2 subgroup.  The Rap2 subgroup is part of the Rap subfamily of the Ras family.  It consists of Rap2a, Rap2b, and Rap2c.  Both isoform 3 of the human mitogen-activated protein kinase kinase kinase kinase 4 (MAP4K4) and Traf2- and Nck-interacting kinase (TNIK) are putative effectors of Rap2 in mediating the activation of c-Jun N-terminal kinase (JNK) to regulate the actin cytoskeleton.  In human platelets, Rap2 was shown to interact with the cytoskeleton by binding the actin filaments.  In embryonic Xenopus development, Rap2 is necessary for the Wnt/beta-catenin signaling pathway.  The Rap2 interacting protein 9 (RPIP9) is highly expressed in human breast carcinomas and correlates with a poor prognosis, suggesting a role for Rap2 in breast cancer oncogenesis.  Rap2b, but not Rap2a, Rap2c, Rap1a, or Rap1b, is expressed in human red blood cells, where it is believed to be involved in vesiculation.  A number of additional effector proteins for Rap2 have been identified, incl
Probab=94.25  E-value=0.034  Score=56.02  Aligned_cols=25  Identities=32%  Similarity=0.644  Sum_probs=22.6

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|+++|.+||||||+++++++..|.
T Consensus         3 ki~i~G~~~vGKTsl~~~~~~~~~~   27 (163)
T cd04176           3 KVVVLGSGGVGKSALTVQFVSGTFI   27 (163)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCCC
Confidence            6999999999999999999987664


No 428
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily.  Rab32 and Rab38 are members of the Rab family of small GTPases.  Human Rab32 was first identified in platelets but it is expressed in a variety of cell types, where it functions as an A-kinase anchoring protein (AKAP). Rab38 has been shown to be melanocyte-specific.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=94.23  E-value=0.034  Score=58.74  Aligned_cols=25  Identities=32%  Similarity=0.573  Sum_probs=22.6

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|+|||.+||||||+++++++..|.
T Consensus         2 KivivG~~~vGKTsli~~l~~~~~~   26 (201)
T cd04107           2 KVLVIGDLGVGKTSIIKRYVHGIFS   26 (201)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCCC
Confidence            5899999999999999999987663


No 429
>cd04127 Rab27A Rab27a subfamily.  The Rab27a subfamily consists of Rab27a and its highly homologous isoform, Rab27b.  Unlike most Rab proteins whose functions remain poorly defined, Rab27a has many known functions.  Rab27a has multiple effector proteins, and depending on which effector it binds, Rab27a has different functions as well as tissue distribution and/or cellular localization. Putative functions have been assigned to Rab27a when associated with the effector proteins Slp1, Slp2, Slp3, Slp4, Slp5, DmSlp, rabphilin, Dm/Ce-rabphilin, Slac2-a, Slac2-b, Slac2-c, Noc2, JFC1, and Munc13-4. Rab27a has been associated with several human diseases, including hemophagocytic syndrome (Griscelli syndrome or GS), Hermansky-Pudlak syndrome, and choroidermia. In the case of GS, a rare, autosomal recessive disease, a Rab27a mutation is directly responsible for the disorder.  When Rab27a is localized to the secretory granules of pancreatic beta cells, it is believed to mediate glucose-stimulated 
Probab=94.20  E-value=0.035  Score=57.00  Aligned_cols=27  Identities=22%  Similarity=0.449  Sum_probs=24.1

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      ..|++||.+|||||||++++++..|.+
T Consensus         5 ~ki~ivG~~~vGKTsli~~~~~~~~~~   31 (180)
T cd04127           5 IKFLALGDSGVGKTSFLYQYTDNKFNP   31 (180)
T ss_pred             EEEEEECCCCCCHHHHHHHHhcCCCCc
Confidence            579999999999999999999877743


No 430
>cd04175 Rap1 Rap1 subgroup.  The Rap1 subgroup is part of the Rap subfamily of the Ras family.  It can be further divided into the Rap1a and Rap1b isoforms.  In humans, Rap1a and Rap1b share 95% sequence homology, but are products of two different genes located on chromosomes 1 and 12, respectively.  Rap1a is sometimes called smg p21 or Krev1 in the older literature.  Rap1 proteins are believed to perform different cellular functions, depending on the isoform, its subcellular localization, and the effector proteins it binds.  For example, in rat salivary gland, neutrophils, and platelets, Rap1 localizes to secretory granules and is believed to regulate exocytosis or the formation of secretory granules.  Rap1 has also been shown to localize in the Golgi of rat fibroblasts, zymogen granules, plasma membrane, and the microsomal membrane of pancreatic acini, as well as in the endocytic compartment of skeletal muscle cells and fibroblasts.  High expression of Rap1 has been observed in the n
Probab=94.18  E-value=0.035  Score=56.10  Aligned_cols=24  Identities=33%  Similarity=0.563  Sum_probs=21.2

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||.+||||||++++++...|
T Consensus         3 ki~~~G~~~~GKTsli~~~~~~~~   26 (164)
T cd04175           3 KLVVLGSGGVGKSALTVQFVQGIF   26 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            689999999999999999986544


No 431
>PRK12317 elongation factor 1-alpha; Reviewed
Probab=94.16  E-value=0.18  Score=59.86  Aligned_cols=20  Identities=30%  Similarity=0.640  Sum_probs=19.2

Q ss_pred             eEEEeccCCCchHHHHHhhh
Q psy5059           9 QIVVVGTQSSGKSSVIESLV   28 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~   28 (1036)
                      .|++||.+++|||||+++|+
T Consensus         8 ~v~iiGh~d~GKSTL~~~Ll   27 (425)
T PRK12317          8 NLAVIGHVDHGKSTLVGRLL   27 (425)
T ss_pred             EEEEECCCCCChHHHHHHHH
Confidence            58999999999999999998


No 432
>KOG0395|consensus
Probab=94.14  E-value=0.12  Score=54.97  Aligned_cols=26  Identities=27%  Similarity=0.425  Sum_probs=21.4

Q ss_pred             CCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          83 LPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        83 lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      ..+++|+|..++|||++.-...+-.|
T Consensus         3 ~~kvvvlG~~gVGKSal~~qf~~~~f   28 (196)
T KOG0395|consen    3 EYKVVVLGAGGVGKSALTIQFLTGRF   28 (196)
T ss_pred             ceEEEEECCCCCCcchheeeeccccc
Confidence            35799999999999998777666665


No 433
>cd04146 RERG_RasL11_like RERG/RasL11-like subfamily.  RERG (Ras-related and Estrogen- Regulated Growth inhibitor) and Ras-like 11 are members of a novel subfamily of Ras that were identified based on their behavior in breast and prostate tumors, respectively.  RERG expression was decreased or lost in a significant fraction of primary human breast tumors that lack estrogen receptor and are correlated with poor clinical prognosis.  Elevated RERG expression correlated with favorable patient outcome in a breast tumor subtype that is positive for estrogen receptor expression.  In contrast to most Ras proteins, RERG overexpression inhibited the growth of breast tumor cells in vitro and in vivo.  RasL11 was found to be ubiquitously expressed in human tissue, but down-regulated in prostate tumors.  Both RERG and RasL11 lack the C-terminal CaaX prenylation motif, where a = an aliphatic amino acid and X = any amino acid, and are localized primarily in the cytoplasm.  Both are believed to have tu
Probab=94.09  E-value=0.036  Score=56.20  Aligned_cols=24  Identities=33%  Similarity=0.642  Sum_probs=21.6

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|+|||.+|||||||++++++..|
T Consensus         1 ki~vvG~~~~GKtsli~~~~~~~~   24 (165)
T cd04146           1 KIAVLGASGVGKSALVVRFLTKRF   24 (165)
T ss_pred             CEEEECCCCCcHHHHHHHHHhCcc
Confidence            389999999999999999997665


No 434
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH. This family describes YqeH, a member of a larger family of GTPases involved in ribosome biogenesis. Like YqlF, it shows a cyclical permutation relative to GTPases EngA (in which the GTPase domain is duplicated), Era, and others. Members of this protein family are found in a relatively small number of bacterial species, including Bacillus subtilis but not Escherichia coli.
Probab=94.07  E-value=0.035  Score=64.54  Aligned_cols=23  Identities=39%  Similarity=0.642  Sum_probs=21.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .|++||.+|||||||+|+|.+..
T Consensus       156 ~v~~vG~~nvGKStliN~l~~~~  178 (360)
T TIGR03597       156 DVYVVGVTNVGKSSLINKLLKQN  178 (360)
T ss_pred             eEEEECCCCCCHHHHHHHHHhhc
Confidence            69999999999999999999854


No 435
>PRK13796 GTPase YqeH; Provisional
Probab=94.07  E-value=0.032  Score=65.00  Aligned_cols=35  Identities=26%  Similarity=0.418  Sum_probs=0.0

Q ss_pred             EEEeccCCCchHHHHHhhhcCCcccccCCcccccc
Q psy5059          10 IVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRP   44 (1036)
Q Consensus        10 i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~trrp   44 (1036)
                      ++|||.+|||||||+|+|++..--....-.+++.|
T Consensus       163 v~vvG~~NvGKSTLiN~L~~~~~~~~~~~~~s~~p  197 (365)
T PRK13796        163 VYVVGVTNVGKSTLINRIIKEITGEKDVITTSRFP  197 (365)
T ss_pred             EEEEcCCCCcHHHHHHHHHhhccCccceEEecCCC


No 436
>cd04109 Rab28 Rab28 subfamily.  First identified in maize, Rab28 has been shown to be a late embryogenesis-abundant (Lea) protein that is regulated by the plant hormone abcisic acid (ABA).  In Arabidopsis, Rab28 is expressed during embryo development and is generally restricted to provascular tissues in mature embryos.  Unlike maize Rab28, it is not ABA-inducible. Characterization of the human Rab28 homolog revealed two isoforms, which differ by a 95-base pair insertion, producing an alternative sequence for the 30 amino acids at the C-terminus.  The two human isoforms are presumbly the result of alternative splicing.  Since they differ at the C-terminus but not in the GTP-binding region, they are predicted to be targeted to different cellular locations.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs 
Probab=94.03  E-value=0.037  Score=59.25  Aligned_cols=24  Identities=33%  Similarity=0.609  Sum_probs=21.9

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||.+||||||+++++++..|
T Consensus         2 Ki~ivG~~~vGKSsLi~~l~~~~~   25 (215)
T cd04109           2 KIVVLGDGAVGKTSLCRRFAKEGF   25 (215)
T ss_pred             EEEEECcCCCCHHHHHHHHhcCCC
Confidence            589999999999999999998765


No 437
>cd00877 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily of small GTPases. Ran GTPase is involved in diverse biological functions, such as nuclear transport, spindle formation during mitosis, DNA replication, and cell division.  Among the Ras superfamily, Ran is a unique small G protein.  It does not have a lipid modification motif at the C-terminus to bind to the membrane, which is often observed within the Ras superfamily.  Ran may therefore interact with a wide range of proteins in various intracellular locations.  Like other GTPases, Ran exists in GTP- and GDP-bound conformations that interact differently with effectors.  Conversion between these forms and the assembly or disassembly of effector complexes requires the interaction of regulator proteins.  The intrinsic GTPase activity of Ran is very low, but it is greatly stimulated by a GTPase-activating protein (RanGAP1) located in the cytoplasm. By contrast, RCC1, a guanine nucleotide exchange factor that generates RanGTP, is
Probab=94.02  E-value=0.038  Score=56.52  Aligned_cols=24  Identities=25%  Similarity=0.588  Sum_probs=21.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|+|||.+||||||++++++...|
T Consensus         2 ki~vvG~~~vGKTsli~~~~~~~~   25 (166)
T cd00877           2 KLVLVGDGGTGKTTFVKRHLTGEF   25 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            589999999999999999987654


No 438
>cd04125 RabA_like RabA-like subfamily.  RabA was first identified in D. discoideum, where its expression levels were compared to other Rabs in growing and developing cells.  The RabA mRNA levels were below the level of detection by Northern blot analysis, suggesting a very low level of expression.  The function of RabA remains unknown.  GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=94.02  E-value=0.042  Score=57.24  Aligned_cols=25  Identities=28%  Similarity=0.602  Sum_probs=22.8

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|+|+|.++|||||+++++++..|.
T Consensus         2 ki~v~G~~~vGKSsli~~~~~~~~~   26 (188)
T cd04125           2 KVVIIGDYGVGKSSLLKRFTEDEFS   26 (188)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCCC
Confidence            5899999999999999999987763


No 439
>PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=94.01  E-value=0.21  Score=62.87  Aligned_cols=28  Identities=25%  Similarity=0.375  Sum_probs=23.2

Q ss_pred             EEEecccccCCCchhhhhhcCccccccc
Q psy5059         384 AVVTKIDLMDAGTDAIDILCGRVIPVKL  411 (1036)
Q Consensus       384 ~VitK~Dl~~~g~~~~~~l~~~~~~~~~  411 (1036)
                      .|+||+|-..++...++++.---+|+++
T Consensus       328 lIlTKLDEt~~~G~iL~i~~~~~lPI~y  355 (767)
T PRK14723        328 CIITKLDEATHLGPALDTVIRHRLPVHY  355 (767)
T ss_pred             EEEeccCCCCCccHHHHHHHHHCCCeEE
Confidence            5799999999998888887777777775


No 440
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]
Probab=93.87  E-value=0.05  Score=56.77  Aligned_cols=25  Identities=24%  Similarity=0.578  Sum_probs=23.1

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      ++||+|..|+|||||||-|.|... |
T Consensus        27 ~vAi~GpSGaGKSTLLnLIAGF~~-P   51 (231)
T COG3840          27 IVAILGPSGAGKSTLLNLIAGFET-P   51 (231)
T ss_pred             EEEEECCCCccHHHHHHHHHhccC-C
Confidence            789999999999999999999874 6


No 441
>cd01893 Miro1 Miro1 subfamily.  Miro (mitochondrial Rho) proteins have tandem GTP-binding domains separated by a linker region containing putative calcium-binding EF hand motifs.  Genes encoding Miro-like proteins were found in several eukaryotic organisms.  This CD represents the N-terminal GTPase domain of Miro proteins.  These atypical Rho GTPases have roles in mitochondrial homeostasis and apoptosis.  Most Rho proteins contain a lipid modification site at the C-terminus; however, Miro is one of few Rho subfamilies that lack this feature.
Probab=93.85  E-value=0.042  Score=55.94  Aligned_cols=24  Identities=50%  Similarity=0.804  Sum_probs=22.1

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||..|||||||++++++..|
T Consensus         2 kv~ivG~~~vGKTsl~~~l~~~~~   25 (166)
T cd01893           2 RIVLIGDEGVGKSSLIMSLVSEEF   25 (166)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCcC
Confidence            589999999999999999998765


No 442
>cd04110 Rab35 Rab35 subfamily.  Rab35 is one of several Rab proteins to be found to participate in the regulation of osteoclast cells in rats. In addition, Rab35 has been identified as a protein that interacts with nucleophosmin-anaplastic lymphoma kinase (NPM-ALK) in human cells.  Overexpression of NPM-ALK is a key oncogenic event in some anaplastic large-cell lymphomas; since Rab35 interacts with N|PM-ALK, it may provide a target for cancer treatments. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is 
Probab=93.83  E-value=0.043  Score=58.00  Aligned_cols=26  Identities=27%  Similarity=0.590  Sum_probs=23.5

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      ...|+|||.+||||||+++++.+..|
T Consensus         6 ~~kivvvG~~~vGKTsli~~l~~~~~   31 (199)
T cd04110           6 LFKLLIIGDSGVGKSSLLLRFADNTF   31 (199)
T ss_pred             eeEEEEECCCCCCHHHHHHHHhcCCC
Confidence            46899999999999999999988765


No 443
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily.  Rheb was initially identified in rat brain, where its expression is elevated by seizures or by long-term potentiation.  It is expressed ubiquitously, with elevated levels in muscle and brain.  Rheb functions as an important mediator between the tuberous sclerosis complex proteins, TSC1 and TSC2, and the mammalian target of rapamycin (TOR) kinase to stimulate cell growth.  TOR kinase regulates cell growth by controlling nutrient availability, growth factors, and the energy status of the cell.  TSC1 and TSC2 form a dimeric complex that has tumor suppressor activity, and TSC2 is a GTPase activating protein (GAP) for Rheb.  The TSC1/TSC2 complex inhibits the activation of TOR kinase through Rheb.  Rheb has also been shown to induce the formation of large cytoplasmic vacuoles in a process that is dependent on the GTPase cycle of Rheb, but independent of the TOR kinase, suggesting Rheb plays a role in endocytic trafficking that le
Probab=93.83  E-value=0.042  Score=56.52  Aligned_cols=24  Identities=42%  Similarity=0.634  Sum_probs=21.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||.+||||||+++++.+..|
T Consensus         3 kv~l~G~~g~GKTtl~~~~~~~~~   26 (180)
T cd04137           3 KIAVLGSRSVGKSSLTVQFVEGHF   26 (180)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCC
Confidence            589999999999999999997554


No 444
>cd04158 ARD1 ARD1 subfamily.  ARD1 (ADP-ribosylation factor domain protein 1) is an unusual member of the Arf family.  In addition to the C-terminal Arf domain, ARD1 has an additional 46-kDa N-terminal domain that contains a RING finger domain, two predicted B-Boxes, and a coiled-coil protein interaction motif.  This domain belongs to the TRIM (tripartite motif) or RBCC (RING, B-Box, coiled-coil) family.  Like most Arfs, the ARD1 Arf domain lacks detectable GTPase activity.  However, unlike most Arfs, the full-length ARD1 protein has significant GTPase activity due to the GAP (GTPase-activating protein) activity exhibited by the 46-kDa N-terminal domain.  The GAP domain of ARD1 is specific for its own Arf domain and does not bind other Arfs.  The rate of GDP dissociation from the ARD1 Arf domain is slowed by the adjacent 15 amino acids, which act as a GDI (GDP-dissociation inhibitor) domain.  ARD1 is ubiquitously expressed in cells and localizes to the Golgi and to the lysosomal membra
Probab=93.79  E-value=0.045  Score=56.03  Aligned_cols=24  Identities=25%  Similarity=0.576  Sum_probs=21.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||.++|||||+++++++..|
T Consensus         1 ~vvlvG~~~~GKTsl~~~l~~~~~   24 (169)
T cd04158           1 RVVTLGLDGAGKTTILFKLKQDEF   24 (169)
T ss_pred             CEEEECCCCCCHHHHHHHHhcCCC
Confidence            389999999999999999998654


No 445
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional
Probab=93.71  E-value=0.32  Score=56.74  Aligned_cols=23  Identities=22%  Similarity=0.336  Sum_probs=19.9

Q ss_pred             CceEEeCcCCCChhhHHhhhcCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      .-|+++|.+++|||+++..|+..
T Consensus       207 ~ii~lvGptGvGKTTt~akLA~~  229 (407)
T PRK12726        207 RIISLIGQTGVGKTTTLVKLGWQ  229 (407)
T ss_pred             eEEEEECCCCCCHHHHHHHHHHH
Confidence            35679999999999999999853


No 446
>cd04149 Arf6 Arf6 subfamily.  Arf6 (ADP ribosylation factor 6) proteins localize to the plasma membrane, where they perform a wide variety of functions.  In its active, GTP-bound form, Arf6 is involved in cell spreading, Rac-induced formation of plasma membrane ruffles, cell migration, wound healing, and Fc-mediated phagocytosis.  Arf6 appears to change the actin structure at the plasma membrane by activating Rac, a Rho family protein involved in membrane ruffling.  Arf6 is required for and enhances Rac formation of ruffles.  Arf6 can regulate dendritic branching in hippocampal neurons, and in yeast it localizes to the growing bud, where it plays a role in polarized growth and bud site selection.  In leukocytes, Arf6 is required for chemokine-stimulated migration across endothelial cells.  Arf6 also plays a role in down-regulation of beta2-adrenergic receptors and luteinizing hormone receptors by facilitating the release of sequestered arrestin to allow endocytosis.  Arf6 is believed t
Probab=93.69  E-value=0.048  Score=56.02  Aligned_cols=27  Identities=19%  Similarity=0.319  Sum_probs=23.0

Q ss_pred             CCCeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      ....|++||.+||||||+++++.+..|
T Consensus         8 ~~~kv~i~G~~~~GKTsli~~l~~~~~   34 (168)
T cd04149           8 KEMRILMLGLDAAGKTTILYKLKLGQS   34 (168)
T ss_pred             CccEEEEECcCCCCHHHHHHHHccCCC
Confidence            346899999999999999999986543


No 447
>cd04132 Rho4_like Rho4-like subfamily.  Rho4 is a GTPase that controls septum degradation by regulating secretion of Eng1 or Agn1 during cytokinesis.  Rho4 also plays a role in cell morphogenesis.  Rho4 regulates septation and cell morphology by controlling the actin cytoskeleton and cytoplasmic microtubules.  The localization of Rho4 is modulated by Rdi1, which may function as a GDI, and by Rga9, which is believed to function as a GAP.  In S. pombe, both Rho4 deletion and Rho4 overexpression result in a defective cell wall, suggesting a role for Rho4 in maintaining cell wall integrity.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=93.68  E-value=0.046  Score=56.67  Aligned_cols=24  Identities=33%  Similarity=0.530  Sum_probs=22.0

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|+|||.+||||||+++++++..|
T Consensus         2 ki~vvG~~~vGKTsli~~l~~~~~   25 (187)
T cd04132           2 KIVVVGDGGCGKTCLLIVYSQGKF   25 (187)
T ss_pred             eEEEECCCCCCHHHHHHHHHhCcC
Confidence            589999999999999999998665


No 448
>COG3596 Predicted GTPase [General function prediction only]
Probab=93.65  E-value=0.051  Score=60.01  Aligned_cols=41  Identities=29%  Similarity=0.408  Sum_probs=28.9

Q ss_pred             CeEE-EeccCCCchHHHHHhhhcCCccccc-CCccccccEEEe
Q psy5059           8 PQIV-VVGTQSSGKSSVIESLVGKSFLPRG-IGIVTRRPLILQ   48 (1036)
Q Consensus         8 p~i~-vvg~~~~gkss~~~~~~g~~~~pr~-~~~~trrpl~l~   48 (1036)
                      |..+ ++|+.|+||||++|+|.+....|.. .|.||+-+..+.
T Consensus        39 pvnvLi~G~TG~GKSSliNALF~~~~~~v~~vg~~t~~~~~~~   81 (296)
T COG3596          39 PVNVLLMGATGAGKSSLINALFQGEVKEVSKVGVGTDITTRLR   81 (296)
T ss_pred             ceeEEEecCCCCcHHHHHHHHHhccCceeeecccCCCchhhHH
Confidence            5565 9999999999999999975555532 444454454443


No 449
>cd04135 Tc10 TC10 subfamily.  TC10 is a Rho family protein that has been shown to induce microspike formation and neurite outgrowth in vitro.  Its expression changes dramatically after peripheral nerve injury, suggesting an important role in promoting axonal outgrowth and regeneration.  TC10 regulates translocation of insulin-stimulated GLUT4 in adipocytes and has also been shown to bind directly to Golgi COPI coat proteins.  GTP-bound TC10 in vitro can bind numerous potential effectors.  Depending on its subcellular localization and distinct functional domains, TC10 can differentially regulate two types of filamentous actin in adipocytes.  TC10 mRNAs are highly expressed in three types of mouse muscle tissues:  leg skeletal muscle, cardiac muscle, and uterus; they were also present in brain, with higher levels in adults than in newborns.  TC10 has also been shown to play a role in regulating the expression of cystic fibrosis transmembrane conductance regulator (CFTR) through interacti
Probab=93.65  E-value=0.051  Score=55.38  Aligned_cols=25  Identities=32%  Similarity=0.525  Sum_probs=22.6

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|+++|.+||||||+++++++..|.
T Consensus         2 ki~i~G~~~~GKTsl~~~~~~~~~~   26 (174)
T cd04135           2 KCVVVGDGAVGKTCLLMSYANDAFP   26 (174)
T ss_pred             EEEEECCCCCCHHHHHHHHHhCCCC
Confidence            5899999999999999999987763


No 450
>cd04111 Rab39 Rab39 subfamily.  Found in eukaryotes, Rab39 is mainly found in epithelial cell lines, but is distributed widely in various human tissues and cell lines.  It is believed to be a novel Rab protein involved in regulating Golgi-associated vesicular transport during cellular endocytosis. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic localization.   Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins.
Probab=93.64  E-value=0.05  Score=58.26  Aligned_cols=26  Identities=27%  Similarity=0.551  Sum_probs=23.2

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      ..|+|||.+||||||+++++++..|.
T Consensus         3 ~KIvvvG~~~vGKTsLi~~l~~~~~~   28 (211)
T cd04111           3 FRLIVIGDSTVGKSSLLKRFTEGRFA   28 (211)
T ss_pred             eEEEEECCCCCCHHHHHHHHHcCCCC
Confidence            46999999999999999999987663


No 451
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated
Probab=93.64  E-value=0.27  Score=54.94  Aligned_cols=25  Identities=16%  Similarity=0.461  Sum_probs=22.4

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCC
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      +.+.|+++|.+++|||+++..|++.
T Consensus        74 ~~~~i~~~G~~g~GKTtl~~~l~~~   98 (270)
T PRK06731         74 EVQTIALIGPTGVGKTTTLAKMAWQ   98 (270)
T ss_pred             CCCEEEEECCCCCcHHHHHHHHHHH
Confidence            3479999999999999999999876


No 452
>cd04164 trmE TrmE (MnmE, ThdF, MSS1) is a 3-domain protein found in bacteria and eukaryotes.  It controls modification of the uridine at the wobble position (U34) of tRNAs that read codons ending with A or G in the mixed codon family boxes.  TrmE contains a GTPase domain that forms a canonical Ras-like fold.  It functions a molecular switch GTPase, and apparently uses a conformational change associated with GTP hydrolysis to promote the tRNA modification reaction, in which the conserved cysteine in the C-terminal domain is thought to function as a catalytic residue.  In bacteria that are able to survive in extremely low pH conditions, TrmE regulates glutamate-dependent acid resistance.
Probab=93.62  E-value=0.069  Score=52.82  Aligned_cols=25  Identities=36%  Similarity=0.683  Sum_probs=22.7

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|+++|.+||||||+++++.|..+.
T Consensus         3 ~i~l~G~~~~GKstli~~l~~~~~~   27 (157)
T cd04164           3 KVVIVGKPNVGKSSLLNALAGRDRA   27 (157)
T ss_pred             EEEEECCCCCCHHHHHHHHHCCceE
Confidence            5899999999999999999997753


No 453
>cd01870 RhoA_like RhoA-like subfamily.  The RhoA subfamily consists of RhoA, RhoB, and RhoC.  RhoA promotes the formation of stress fibers and focal adhesions, regulating cell shape, attachment, and motility.  RhoA can bind to multiple effector proteins, thereby triggering different downstream responses.  In many cell types, RhoA mediates local assembly of the contractile ring, which is necessary for cytokinesis.  RhoA is vital for muscle contraction; in vascular smooth muscle cells, RhoA plays a key role in cell contraction, differentiation, migration, and proliferation.  RhoA activities appear to be elaborately regulated in a time- and space-dependent manner to control cytoskeletal changes.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.  RhoA and RhoC are observed only in geranyl
Probab=93.60  E-value=0.055  Score=55.23  Aligned_cols=25  Identities=24%  Similarity=0.538  Sum_probs=22.8

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      ..|+|+|.+||||||+++++.+..|
T Consensus         2 ~ki~iiG~~~~GKTsl~~~~~~~~~   26 (175)
T cd01870           2 KKLVIVGDGACGKTCLLIVFSKDQF   26 (175)
T ss_pred             cEEEEECCCCCCHHHHHHHHhcCCC
Confidence            5799999999999999999998665


No 454
>cd04147 Ras_dva Ras-dva subfamily.  Ras-dva (Ras - dorsal-ventral anterior localization) subfamily consists of a set of proteins characterized only in Xenopus leavis, to date.  In Xenopus Ras-dva expression is activated by the transcription factor Otx2 and begins during gastrulation throughout the anterior ectoderm.  Ras-dva expression is inhibited in the anterior neural plate by factor Xanf1.  Downregulation of Ras-dva results in head development abnormalities through the inhibition of several regulators of the anterior neural plate and folds patterning, including Otx2, BF-1, Xag2, Pax6, Slug, and Sox9.  Downregulation of Ras-dva also interferes with the FGF-8a signaling within the anterior ectoderm.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=93.55  E-value=0.05  Score=57.38  Aligned_cols=24  Identities=25%  Similarity=0.616  Sum_probs=21.9

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||.+||||||+++++++..|
T Consensus         1 kv~vvG~~~vGKTsll~~~~~~~~   24 (198)
T cd04147           1 RLVFMGAAGVGKTALIQRFLYDTF   24 (198)
T ss_pred             CEEEECCCCCCHHHHHHHHHhCCC
Confidence            489999999999999999998765


No 455
>COG0481 LepA Membrane GTPase LepA [Cell envelope biogenesis, outer membrane]
Probab=93.52  E-value=0.22  Score=58.56  Aligned_cols=58  Identities=24%  Similarity=0.298  Sum_probs=39.8

Q ss_pred             ccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHH
Q psy5059         377 VDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLK  456 (1036)
Q Consensus       377 ~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~  456 (1036)
                      ..+--.|-|+||+||-.++.+.                         +..++.+-+ .+...-.+-+||++|.++.++++
T Consensus       126 e~~LeIiPViNKIDLP~Adper-------------------------vk~eIe~~i-Gid~~dav~~SAKtG~gI~~iLe  179 (603)
T COG0481         126 ENNLEIIPVLNKIDLPAADPER-------------------------VKQEIEDII-GIDASDAVLVSAKTGIGIEDVLE  179 (603)
T ss_pred             HcCcEEEEeeecccCCCCCHHH-------------------------HHHHHHHHh-CCCcchheeEecccCCCHHHHHH
Confidence            3455678899999998766543                         344444433 33444456789999999999998


Q ss_pred             Hhhh
Q psy5059         457 LAKE  460 (1036)
Q Consensus       457 la~~  460 (1036)
                      ..-+
T Consensus       180 ~Iv~  183 (603)
T COG0481         180 AIVE  183 (603)
T ss_pred             HHHh
Confidence            7643


No 456
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily.  Arl5 (Arf-like 5) and Arl8, like Arl4 and Arl7, are localized to the nucleus and nucleolus.  Arl5 is developmentally regulated during embryogenesis in mice.  Human Arl5 interacts with the heterochromatin protein 1-alpha (HP1alpha), a nonhistone chromosomal protein that is associated with heterochromatin and telomeres, and prevents telomere fusion.  Arl5 may also play a role in embryonic nuclear dynamics and/or signaling cascades. Arl8 was identified from a fetal cartilage cDNA library.  It is found in brain, heart, lung, cartilage, and kidney.  No function has been assigned for Arl8 to date.
Probab=93.52  E-value=0.055  Score=55.72  Aligned_cols=26  Identities=15%  Similarity=0.402  Sum_probs=22.9

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      -..|+++|.+||||||++++|.+..|
T Consensus        15 ~~kv~~~G~~~~GKTsl~~~l~~~~~   40 (174)
T cd04153          15 EYKVIIVGLDNAGKTTILYQFLLGEV   40 (174)
T ss_pred             ccEEEEECCCCCCHHHHHHHHccCCC
Confidence            35799999999999999999987654


No 457
>TIGR03597 GTPase_YqeH ribosome biogenesis GTPase YqeH. This family describes YqeH, a member of a larger family of GTPases involved in ribosome biogenesis. Like YqlF, it shows a cyclical permutation relative to GTPases EngA (in which the GTPase domain is duplicated), Era, and others. Members of this protein family are found in a relatively small number of bacterial species, including Bacillus subtilis but not Escherichia coli.
Probab=93.50  E-value=0.29  Score=57.00  Aligned_cols=99  Identities=22%  Similarity=0.234  Sum_probs=64.3

Q ss_pred             HHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCceEEEEecccccCCCchhhhhhcCccccccccccc
Q psy5059         336 AQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDG  415 (1036)
Q Consensus       336 ~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~  415 (1036)
                      ..+.++...|.. ..+++++|||+. |.+.+-...+.+.+.  +.+.+.|+||.||.++....                 
T Consensus        51 e~f~~~l~~~~~-~~~~Il~VvD~~-d~~~s~~~~l~~~~~--~~piilV~NK~DLl~k~~~~-----------------  109 (360)
T TIGR03597        51 DDFLNLLNSLGD-SNALIVYVVDIF-DFEGSLIPELKRFVG--GNPVLLVGNKIDLLPKSVNL-----------------  109 (360)
T ss_pred             HHHHHHHhhccc-CCcEEEEEEECc-CCCCCccHHHHHHhC--CCCEEEEEEchhhCCCCCCH-----------------
Confidence            355667777755 557899999984 444444444555442  67899999999998754321                 


Q ss_pred             ccchHHHHHHHHHHhhccCCCc--ceeeeecccchhhhHHHHHHhhhc
Q psy5059         416 RRTYIEAQIKQLVLHYISNPNS--IILAVVTANTDMATSESLKLAKET  461 (1036)
Q Consensus       416 ~~~~~~~~l~~~v~~~i~~~~~--ipla~ISA~td~~~qeil~la~~v  461 (1036)
                            ..+...+.++.+....  ..+..+||+++.++.+++....+.
T Consensus       110 ------~~~~~~l~~~~k~~g~~~~~i~~vSAk~g~gv~eL~~~l~~~  151 (360)
T TIGR03597       110 ------SKIKEWMKKRAKELGLKPVDIILVSAKKGNGIDELLDKIKKA  151 (360)
T ss_pred             ------HHHHHHHHHHHHHcCCCcCcEEEecCCCCCCHHHHHHHHHHH
Confidence                  2223333333333222  246679999999999999888665


No 458
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional
Probab=93.48  E-value=0.2  Score=58.78  Aligned_cols=28  Identities=18%  Similarity=0.195  Sum_probs=22.1

Q ss_pred             EEEecccccCCCchhhhhhcCccccccc
Q psy5059         384 AVVTKIDLMDAGTDAIDILCGRVIPVKL  411 (1036)
Q Consensus       384 ~VitK~Dl~~~g~~~~~~l~~~~~~~~~  411 (1036)
                      .|+||+|-...+..+++++.---+|+..
T Consensus       317 ~I~TKlDet~~~G~~l~~~~~~~~Pi~y  344 (388)
T PRK12723        317 VIFTKLDETTCVGNLISLIYEMRKEVSY  344 (388)
T ss_pred             EEEEeccCCCcchHHHHHHHHHCCCEEE
Confidence            5799999999998888777666666654


No 459
>cd04144 Ras2 Ras2 subfamily.  The Ras2 subfamily, found exclusively in fungi, was first identified in Ustilago maydis.  In U. maydis, Ras2 is regulated by Sql2, a protein that is homologous to GEFs (guanine nucleotide exchange factors) of the CDC25 family.  Ras2 has been shown to induce filamentous growth, but the signaling cascade through which Ras2 and Sql2 regulate cell morphology is not known.  Most Ras proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Ras proteins.
Probab=93.41  E-value=0.053  Score=56.73  Aligned_cols=24  Identities=29%  Similarity=0.504  Sum_probs=21.5

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|+|||.+||||||+++++++-.|
T Consensus         1 ki~ivG~~~vGKTsli~~l~~~~f   24 (190)
T cd04144           1 KLVVLGDGGVGKTALTIQLCLNHF   24 (190)
T ss_pred             CEEEECCCCCCHHHHHHHHHhCCC
Confidence            389999999999999999987655


No 460
>TIGR00993 3a0901s04IAP86 chloroplast protein import component Toc86/159, G and M domains. The long precursor of the 86K protein originally described is proposed to have three domains. The N-terminal A-domain is acidic, repetitive, weakly conserved, readily removed by proteolysis during chloroplast isolation, and not required for protein translocation. The other domains are designated G (GTPase) and M (membrane anchor); this family includes most of the G domain and all of M.
Probab=93.29  E-value=0.089  Score=64.59  Aligned_cols=27  Identities=33%  Similarity=0.578  Sum_probs=23.6

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPR   35 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr   35 (1036)
                      .|++||.+||||||++|+|+|......
T Consensus       120 rIvLVGKTGVGKSSLINSILGekvf~v  146 (763)
T TIGR00993       120 NILVLGKSGVGKSATINSIFGEVKFST  146 (763)
T ss_pred             EEEEECCCCCCHHHHHHHHhccccccc
Confidence            699999999999999999999764443


No 461
>COG1162 Predicted GTPases [General function prediction only]
Probab=93.26  E-value=0.14  Score=57.59  Aligned_cols=77  Identities=18%  Similarity=0.376  Sum_probs=0.0

Q ss_pred             EEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhccCCCCccccccccccccccccchhhhh
Q psy5059          87 VVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFDDIR  166 (1036)
Q Consensus        87 vVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~df~~~r  166 (1036)
                      |++|..++|||||+|+|.+..                                                           
T Consensus       168 vl~GqSGVGKSSLiN~L~p~~-----------------------------------------------------------  188 (301)
T COG1162         168 VLLGQSGVGKSTLINALLPEL-----------------------------------------------------------  188 (301)
T ss_pred             EEECCCCCcHHHHHHhhCchh-----------------------------------------------------------


Q ss_pred             hhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHHHHHHhcCCCCCcCCCcEEEEE-eecCccccee
Q psy5059         167 REIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICSEPIILKI-YSTSVLNLTL  245 (1036)
Q Consensus       167 ~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~~~~~~g~~~~~S~d~I~L~I-~~P~~~~Ltl  245 (1036)
                                                                 ..-..+.+...|.++--|....-+.+ .|-.     +
T Consensus       189 -------------------------------------------~~~t~eIS~~~~rGkHTTt~~~l~~l~~gG~-----i  220 (301)
T COG1162         189 -------------------------------------------NQKTGEISEKLGRGRHTTTHVELFPLPGGGW-----I  220 (301)
T ss_pred             -------------------------------------------hhhhhhhcccCCCCCCccceEEEEEcCCCCE-----E


Q ss_pred             ecCCCccccCC-CCCchhHHHHHHHH
Q psy5059         246 VDLPGITKVPV-GDQPDDIEAQIKQL  270 (1036)
Q Consensus       246 VDLPGi~~~~~-~~q~~di~~~ir~l  270 (1036)
                      |||||+..... ..+++++.....++
T Consensus       221 iDTPGf~~~~l~~~~~e~l~~~F~ef  246 (301)
T COG1162         221 IDTPGFRSLGLAHLEPEDLVQAFPEF  246 (301)
T ss_pred             EeCCCCCccCcccCCHHHHHHHhHHH


No 462
>PLN03108 Rab family protein; Provisional
Probab=93.22  E-value=0.063  Score=57.37  Aligned_cols=27  Identities=26%  Similarity=0.550  Sum_probs=23.9

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      -.|+|||.+||||||+++++++..|.|
T Consensus         7 ~kivivG~~gvGKStLi~~l~~~~~~~   33 (210)
T PLN03108          7 FKYIIIGDTGVGKSCLLLQFTDKRFQP   33 (210)
T ss_pred             eEEEEECCCCCCHHHHHHHHHhCCCCC
Confidence            469999999999999999999877643


No 463
>cd04151 Arl1 Arl1 subfamily.  Arl1 (Arf-like 1) localizes to the Golgi complex, where it is believed to recruit effector proteins to the trans-Golgi network.  Like most members of the Arf family, Arl1 is myristoylated at its N-terminal helix and mutation of the myristoylation site disrupts Golgi targeting.  In humans, the Golgi-localized proteins golgin-97 and golgin-245 have been identified as Arl1 effectors.  Golgins are large coiled-coil proteins found in the Golgi, and these golgins contain a C-terminal GRIP domain, which is the site of Arl1 binding.  Additional Arl1 effectors include the GARP (Golgi-associated retrograde protein)/VFT (Vps53) vesicle-tethering complex and Arfaptin 2.  Arl1 is not required for exocytosis, but appears necessary for trafficking from the endosomes to the Golgi.  In Drosophila zygotes, mutation of Arl1 is lethal, and in the host-bloodstream form of Trypanosoma brucei, Arl1 is essential for viability.
Probab=93.20  E-value=0.062  Score=54.11  Aligned_cols=23  Identities=22%  Similarity=0.485  Sum_probs=20.1

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .|++||.+||||||+++++.+..
T Consensus         1 kv~lvG~~~~GKTsl~~~l~~~~   23 (158)
T cd04151           1 RILILGLDNAGKTTILYRLQLGE   23 (158)
T ss_pred             CEEEECCCCCCHHHHHHHHccCC
Confidence            48999999999999999996543


No 464
>KOG1954|consensus
Probab=93.18  E-value=0.43  Score=54.50  Aligned_cols=27  Identities=33%  Similarity=0.635  Sum_probs=25.2

Q ss_pred             CCCceEEeCcCCCChhhHHhhhcCCCc
Q psy5059          82 QLPQIVVVGTQSSGKSSVIESLVGKSF  108 (1036)
Q Consensus        82 ~lPqIvVvG~QSsGKSSlLEal~G~~f  108 (1036)
                      .-|-|.++|.=|.||||.+.-|.+-+|
T Consensus        57 ~KPmill~GqyStGKTtfi~yLle~dy   83 (532)
T KOG1954|consen   57 AKPMILLVGQYSTGKTTFIRYLLEQDY   83 (532)
T ss_pred             cCceEEEEeccccchhHHHHHHHhCCC
Confidence            369999999999999999999999996


No 465
>cd04101 RabL4 RabL4 (Rab-like4) subfamily.  RabL4s are novel proteins that have high sequence similarity with Rab family members, but display features that are distinct from Rabs, and have been termed Rab-like.  As in other Rab-like proteins, RabL4 lacks a prenylation site at the C-terminus.  The specific function of RabL4 remains unknown.
Probab=93.12  E-value=0.064  Score=54.01  Aligned_cols=21  Identities=24%  Similarity=0.479  Sum_probs=19.6

Q ss_pred             eEEEeccCCCchHHHHHhhhc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVG   29 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g   29 (1036)
                      .|+|||.+|||||||++++.+
T Consensus         2 ki~vvG~~~~GKtsl~~~l~~   22 (164)
T cd04101           2 RCAVVGDPAVGKTAFVQMFHS   22 (164)
T ss_pred             EEEEECCCCCCHHHHHHHHhc
Confidence            589999999999999999985


No 466
>cd04141 Rit_Rin_Ric Rit/Rin/Ric subfamily.  Rit (Ras-like protein in all tissues), Rin (Ras-like protein in neurons) and Ric (Ras-related protein which interacts with calmodulin) form a subfamily with several unique structural and functional characteristics.   These proteins all lack a the C-terminal CaaX lipid-binding motif typical of Ras family proteins, and Rin and Ric contain calmodulin-binding domains.  Rin, which is expressed only in neurons, induces neurite outgrowth in rat pheochromocytoma cells through its association with calmodulin and its activation of endogenous Rac/cdc42.  Rit, which is ubiquitously expressed in mammals, inhibits growth-factor withdrawl-mediated apoptosis and induces neurite extension in pheochromocytoma cells.  Rit and Rin are both able to form a ternary complex with PAR6, a cell polarity-regulating protein, and Rac/cdc42.  This ternary complex is proposed to have physiological function in processes such as tumorigenesis.  Activated Ric is likely to sign
Probab=93.11  E-value=0.066  Score=55.20  Aligned_cols=24  Identities=38%  Similarity=0.657  Sum_probs=22.3

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|+|||.+|||||||++++++..|
T Consensus         4 ki~vvG~~~vGKTsL~~~~~~~~f   27 (172)
T cd04141           4 KIVMLGAGGVGKSAVTMQFISHSF   27 (172)
T ss_pred             EEEEECCCCCcHHHHHHHHHhCCC
Confidence            589999999999999999998776


No 467
>PTZ00369 Ras-like protein; Provisional
Probab=93.11  E-value=0.067  Score=55.93  Aligned_cols=26  Identities=31%  Similarity=0.462  Sum_probs=23.4

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      -..|+|||.+||||||+++++++..|
T Consensus         5 ~~Ki~iiG~~~~GKTsLi~~~~~~~~   30 (189)
T PTZ00369          5 EYKLVVVGGGGVGKSALTIQFIQNHF   30 (189)
T ss_pred             ceEEEEECCCCCCHHHHHHHHhcCCC
Confidence            36899999999999999999998665


No 468
>cd04134 Rho3 Rho3 subfamily.  Rho3 is a member of the Rho family found only in fungi.  Rho3 is believed to regulate cell polarity by interacting with the diaphanous/formin family protein For3 to control both the actin cytoskeleton and microtubules.  Rho3 is also believed to have a direct role in exocytosis that is independent of its role in regulating actin polarity.  The function in exocytosis may be two-pronged: first, in the transport of post-Golgi vesicles from the mother cell to the bud, mediated by myosin (Myo2); second, in the docking and fusion of vesicles to the plasma membrane, mediated by an exocyst (Exo70) protein.  Most Rho proteins contain a lipid modification site at the C-terminus, with a typical sequence motif CaaX, where a = an aliphatic amino acid and X = any amino acid.  Lipid binding is essential for membrane attachment, a key feature of most Rho proteins.
Probab=93.08  E-value=0.069  Score=55.90  Aligned_cols=24  Identities=29%  Similarity=0.598  Sum_probs=22.0

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||.+||||||+++++++..|
T Consensus         2 kivivG~~~vGKTsli~~~~~~~~   25 (189)
T cd04134           2 KVVVLGDGACGKTSLLNVFTRGYF   25 (189)
T ss_pred             EEEEECCCCCCHHHHHHHHhcCCC
Confidence            589999999999999999998665


No 469
>TIGR00491 aIF-2 translation initiation factor aIF-2/yIF-2. This model describes archaeal and eukaryotic orthologs of bacterial IF-2. Like IF-2, it helps convey the initiator tRNA to the ribosome, although the initiator is N-formyl-Met in bacteria and Met here. This protein is not closely related to the subunits of eIF-2 of eukaryotes, which is also involved in the initiation of translation. The aIF-2 of Methanococcus jannaschii contains a large intein interrupting a region of very strongly conserved sequence very near the amino end; this model does not correctly align the sequences from Methanococcus jannaschii and Pyrococcus horikoshii in this region.
Probab=93.07  E-value=0.071  Score=65.78  Aligned_cols=34  Identities=24%  Similarity=0.489  Sum_probs=28.7

Q ss_pred             CCCeEEEeccCCCchHHHHHhhhcCCcccccCCc
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGI   39 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~   39 (1036)
                      --|.|+|+|.+++|||||||+|.|..+.....|.
T Consensus         3 r~piV~IiG~~d~GKTSLln~l~~~~v~~~e~gg   36 (590)
T TIGR00491         3 RSPIVSVLGHVDHGKTTLLDKIRGSAVAKREAGG   36 (590)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHhccccccccCCc
Confidence            4599999999999999999999998776544444


No 470
>KOG0093|consensus
Probab=93.07  E-value=0.3  Score=49.08  Aligned_cols=42  Identities=19%  Similarity=0.287  Sum_probs=31.9

Q ss_pred             ccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEeccccccccc
Q psy5059         241 LNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATS  295 (1036)
Q Consensus       241 ~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~An~D~~~s  295 (1036)
                      .+|.+-|+.|.             +..+.+...|++....+||+-+..|.+.-|+
T Consensus        70 iklQiwDTagq-------------EryrtiTTayyRgamgfiLmyDitNeeSf~s  111 (193)
T KOG0093|consen   70 IKLQIWDTAGQ-------------ERYRTITTAYYRGAMGFILMYDITNEESFNS  111 (193)
T ss_pred             EEEEEEecccc-------------hhhhHHHHHHhhccceEEEEEecCCHHHHHH
Confidence            34556678884             2357788899999999999999888766554


No 471
>cd01890 LepA LepA subfamily.  LepA belongs to the GTPase family of and exhibits significant homology to the translation factors EF-G and EF-Tu, indicating its possible involvement in translation and association with the ribosome.  LepA is ubiquitous in bacteria and eukaryota (e.g. yeast GUF1p), but is missing from archaea.  This pattern of phyletic distribution suggests that LepA evolved through a duplication of the EF-G gene in bacteria, followed by early transfer into the eukaryotic lineage, most likely from the promitochondrial endosymbiont.  Yeast GUF1p is not essential and mutant cells did not reveal any marked phenotype.
Probab=93.05  E-value=0.053  Score=55.57  Aligned_cols=22  Identities=18%  Similarity=0.386  Sum_probs=20.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGK   30 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~   30 (1036)
                      -|++||.++||||||+++|++.
T Consensus         2 ni~~vG~~~~GKssL~~~l~~~   23 (179)
T cd01890           2 NFSIIAHIDHGKSTLADRLLEL   23 (179)
T ss_pred             cEEEEeecCCCHHHHHHHHHHH
Confidence            4899999999999999999984


No 472
>cd00880 Era_like Era (E. coli Ras-like protein)-like.  This family includes several distinct subfamilies (TrmE/ThdF, FeoB, YihA (EngG), Era, and EngA/YfgK) that generally show sequence conservation in the region between the Walker A and B motifs (G1 and G3 box motifs), to the exclusion of other GTPases. TrmE is ubiquitous in bacteria and is a widespread mitochondrial protein in eukaryotes, but is absent from archaea. The yeast member of TrmE family, MSS1, is involved in mitochondrial translation; bacterial members are often present in translation-related operons.  FeoB represents an unusual adaptation of GTPases for high-affinity iron (II) transport. YihA (EngB) family of GTPases is typified by the E. coli YihA, which is an essential protein involved in cell division control.  Era is characterized by a distinct derivative of the KH domain (the pseudo-KH domain) which is located C-terminal to the GTPase domain.  EngA and its orthologs are composed of two GTPase domains and, since the se
Probab=92.99  E-value=0.081  Score=51.59  Aligned_cols=22  Identities=32%  Similarity=0.668  Sum_probs=20.1

Q ss_pred             EeccCCCchHHHHHhhhcCCcc
Q psy5059          12 VVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus        12 vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      ++|..||||||++++|+|..+.
T Consensus         1 i~G~~gsGKstl~~~l~~~~~~   22 (163)
T cd00880           1 LFGRTNAGKSSLLNALLGQEVA   22 (163)
T ss_pred             CcCCCCCCHHHHHHHHhCcccc
Confidence            5899999999999999998765


No 473
>KOG1489|consensus
Probab=92.99  E-value=0.11  Score=58.33  Aligned_cols=22  Identities=27%  Similarity=0.524  Sum_probs=19.3

Q ss_pred             CeEEEeccCCCchHHHHHhhhc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVG   29 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g   29 (1036)
                      +-|-.||.||+||||||++|.-
T Consensus       197 advGLVG~PNAGKSTLL~als~  218 (366)
T KOG1489|consen  197 ADVGLVGFPNAGKSTLLNALSR  218 (366)
T ss_pred             cccceecCCCCcHHHHHHHhhc
Confidence            4566899999999999999976


No 474
>TIGR00064 ftsY signal recognition particle-docking protein FtsY. There is a weak division between FtsY and SRP54; both are GTPases. In E.coli, ftsY is an essential gene located in an operon with cell division genes ftsE and ftsX, but its apparent function is as the signal recognition particle docking protein.
Probab=92.99  E-value=0.61  Score=52.26  Aligned_cols=22  Identities=36%  Similarity=0.593  Sum_probs=19.4

Q ss_pred             ceEEeCcCCCChhhHHhhhcCC
Q psy5059          85 QIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        85 qIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      -|+++|.+++|||+++-.|+..
T Consensus        74 vi~l~G~~G~GKTTt~akLA~~   95 (272)
T TIGR00064        74 VILFVGVNGVGKTTTIAKLANK   95 (272)
T ss_pred             EEEEECCCCCcHHHHHHHHHHH
Confidence            5789999999999999999853


No 475
>cd04161 Arl2l1_Arl13_like Arl2l1/Arl13 subfamily.  Arl2l1 (Arl2-like protein 1) and Arl13 form a subfamily of the Arf family of small GTPases.  Arl2l1 was identified in human cells during a search for the gene(s) responsible for Bardet-Biedl syndrome (BBS).  Like Arl6, the identified BBS gene, Arl2l1 is proposed to have cilia-specific functions.  Arl13 is found on the X chromosome, but its expression has not been confirmed; it may be a pseudogene.
Probab=92.98  E-value=0.065  Score=54.85  Aligned_cols=22  Identities=27%  Similarity=0.690  Sum_probs=20.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGK   30 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~   30 (1036)
                      .|+++|.+||||||++++++|.
T Consensus         1 ~i~~~G~~~~GKTsl~~~l~~~   22 (167)
T cd04161           1 TLLTVGLDNAGKTTLVSALQGE   22 (167)
T ss_pred             CEEEECCCCCCHHHHHHHHhCC
Confidence            4899999999999999999875


No 476
>COG0480 FusA Translation elongation factors (GTPases) [Translation, ribosomal structure and biogenesis]
Probab=92.95  E-value=0.56  Score=58.93  Aligned_cols=27  Identities=22%  Similarity=0.291  Sum_probs=23.2

Q ss_pred             HHHhhhccccCCceEEEEecccccCCC
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAG  395 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g  395 (1036)
                      -.+-|.++..+.+.|.++||.|.+-..
T Consensus       118 Etv~rqa~~~~vp~i~fiNKmDR~~a~  144 (697)
T COG0480         118 ETVWRQADKYGVPRILFVNKMDRLGAD  144 (697)
T ss_pred             HHHHHHHhhcCCCeEEEEECccccccC
Confidence            457788889999999999999998765


No 477
>PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional
Probab=92.86  E-value=0.27  Score=58.28  Aligned_cols=23  Identities=17%  Similarity=0.391  Sum_probs=20.9

Q ss_pred             CceEEeCcCCCChhhHHhhhcCC
Q psy5059          84 PQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        84 PqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      -.|++||..++||||++-.|+|.
T Consensus       192 ~vi~lvGpnG~GKTTtlakLA~~  214 (420)
T PRK14721        192 GVYALIGPTGVGKTTTTAKLAAR  214 (420)
T ss_pred             cEEEEECCCCCCHHHHHHHHHHH
Confidence            36899999999999999999885


No 478
>PF00005 ABC_tran:  ABC transporter This structure is on hold until Dec 1999;  InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). On the basis of sequence similarities a family of related ATP-binding proteins has been characterised [, , , , ].  The proteins belonging to this family also contain one or two copies of the 'A' consensus sequence [] or the 'P-loop' [] (see IPR001687 from INTERPRO).; GO: 0005524 ATP binding, 0016887 ATPase activity; PDB: 3NHB_A 3NH9_A 3NHA_A 3NH6_A 1VCI_A 1V43_A 2YZ2_B 2PMK_A 2FFA_A 1XEF_D ....
Probab=92.85  E-value=0.07  Score=52.49  Aligned_cols=23  Identities=35%  Similarity=0.648  Sum_probs=21.6

Q ss_pred             eEEEeccCCCchHHHHHhhhcCC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .++|+|..|||||||++.|.|..
T Consensus        13 ~~~i~G~nGsGKStLl~~l~g~~   35 (137)
T PF00005_consen   13 IVAIVGPNGSGKSTLLKALAGLL   35 (137)
T ss_dssp             EEEEEESTTSSHHHHHHHHTTSS
T ss_pred             EEEEEccCCCccccceeeecccc
Confidence            58999999999999999999976


No 479
>PLN03110 Rab GTPase; Provisional
Probab=92.85  E-value=0.074  Score=57.13  Aligned_cols=25  Identities=28%  Similarity=0.587  Sum_probs=22.5

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCCc
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      -.|++||.+|||||||++++++..|
T Consensus        13 ~Ki~ivG~~~vGKStLi~~l~~~~~   37 (216)
T PLN03110         13 FKIVLIGDSGVGKSNILSRFTRNEF   37 (216)
T ss_pred             eEEEEECCCCCCHHHHHHHHhcCCC
Confidence            3799999999999999999998765


No 480
>KOG0462|consensus
Probab=92.83  E-value=0.36  Score=57.72  Aligned_cols=82  Identities=20%  Similarity=0.233  Sum_probs=59.3

Q ss_pred             EEEEEecCccccchHHHHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhc
Q psy5059         353 ILAVVTANTDMATSESLKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYI  432 (1036)
Q Consensus       353 ~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i  432 (1036)
                      ++.|||+++++...-...+ ..+-..|-+.|-|+||+|+-.+..+                         .+...+.+-+
T Consensus       152 ~lLvVDA~qGvqAQT~anf-~lAfe~~L~iIpVlNKIDlp~adpe-------------------------~V~~q~~~lF  205 (650)
T KOG0462|consen  152 ALLVVDASQGVQAQTVANF-YLAFEAGLAIIPVLNKIDLPSADPE-------------------------RVENQLFELF  205 (650)
T ss_pred             eEEEEEcCcCchHHHHHHH-HHHHHcCCeEEEeeeccCCCCCCHH-------------------------HHHHHHHHHh
Confidence            7889999998766543332 2344679999999999999766544                         3444444444


Q ss_pred             cCCCcceeeeecccchhhhHHHHHHhhhc
Q psy5059         433 SNPNSIILAVVTANTDMATSESLKLAKET  461 (1036)
Q Consensus       433 ~~~~~ipla~ISA~td~~~qeil~la~~v  461 (1036)
                       .......+++||++|.+..++++.+-+.
T Consensus       206 -~~~~~~~i~vSAK~G~~v~~lL~AII~r  233 (650)
T KOG0462|consen  206 -DIPPAEVIYVSAKTGLNVEELLEAIIRR  233 (650)
T ss_pred             -cCCccceEEEEeccCccHHHHHHHHHhh
Confidence             3445588999999999999999886443


No 481
>KOG2486|consensus
Probab=92.77  E-value=0.029  Score=61.78  Aligned_cols=98  Identities=20%  Similarity=0.175  Sum_probs=56.7

Q ss_pred             CCeEEEeccCCCchHHHHHhhhcCCcccccCCcc----cc------ccEEEeeccCCCch------hhhhh--------h
Q psy5059           7 LPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIV----TR------RPLILQLYYCPKDD------REKRT--------A   62 (1036)
Q Consensus         7 lp~i~vvg~~~~gkss~~~~~~g~~~~pr~~~~~----tr------rpl~l~l~~~~~~~------~~~~~--------~   62 (1036)
                      .|.+++.|+.|||||||||.++.+.-. +.++..    |+      -=.-+.+...++..      +-...        +
T Consensus       136 ~pe~~~~g~SNVGKSSLln~~~r~k~~-~~t~k~K~g~Tq~in~f~v~~~~~~vDlPG~~~a~y~~~~~~d~~~~t~~Y~  214 (320)
T KOG2486|consen  136 RPELAFYGRSNVGKSSLLNDLVRVKNI-ADTSKSKNGKTQAINHFHVGKSWYEVDLPGYGRAGYGFELPADWDKFTKSYL  214 (320)
T ss_pred             CceeeeecCCcccHHHHHhhhhhhhhh-hhhcCCCCccceeeeeeeccceEEEEecCCcccccCCccCcchHhHhHHHHH
Confidence            469999999999999999999985532 222210    11      11112222333311      00011        1


Q ss_pred             HHHHHHHHHhhh----hcCCCCCCCCceEEeCcCCCChhhHHhhhcCC
Q psy5059          63 AAVINKLQDVFN----TVGTDAIQLPQIVVVGTQSSGKSSVIESLVGK  106 (1036)
Q Consensus        63 ~~l~~kL~~~~~----~~g~~~i~lPqIvVvG~QSsGKSSlLEal~G~  106 (1036)
                      ++--+ |-.+|-    ..+....++|.|.-+|.-++|+++|+..+--.
T Consensus       215 leR~n-Lv~~FLLvd~sv~i~~~D~~~i~~~ge~~VP~t~vfTK~DK~  261 (320)
T KOG2486|consen  215 LEREN-LVRVFLLVDASVPIQPTDNPEIAWLGENNVPMTSVFTKCDKQ  261 (320)
T ss_pred             Hhhhh-hheeeeeeeccCCCCCCChHHHHHHhhcCCCeEEeeehhhhh
Confidence            11111 112221    23346788999999999999999999887544


No 482
>cd04148 RGK RGK subfamily.  The RGK (Rem, Rem2, Rad, Gem/Kir) subfamily of Ras GTPases are expressed in a tissue-specific manner and are dynamically regulated by transcriptional and posttranscriptional mechanisms in response to environmental cues.   RGK proteins bind to the beta subunit of L-type calcium channels, causing functional down-regulation of these voltage-dependent calcium channels, and either termination of calcium-dependent secretion or modulation of electrical conduction and contractile function.  Inhibition of L-type calcium channels by Rem2 may provide a mechanism for modulating calcium-triggered exocytosis in hormone-secreting cells, and has been proposed to influence the secretion of insulin in pancreatic beta cells.  RGK proteins also interact with and inhibit the Rho/Rho kinase pathway to modulate remodeling of the cytoskeleton.  Two characteristics of RGK proteins cited in the literature are N-terminal and C-terminal extensions beyond the GTPase domain typical of Ra
Probab=92.75  E-value=0.079  Score=57.19  Aligned_cols=24  Identities=25%  Similarity=0.569  Sum_probs=21.3

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||.+|||||||++++++..|
T Consensus         2 KI~lvG~~gvGKTsLi~~~~~~~~   25 (221)
T cd04148           2 RVVMLGSPGVGKSSLASQFTSGEY   25 (221)
T ss_pred             EEEEECCCCCcHHHHHHHHhcCCc
Confidence            589999999999999999986544


No 483
>cd01894 EngA1 EngA1 subfamily.  This CD represents the first GTPase domain of EngA and its orthologs, which are composed of two adjacent GTPase domains.  Since the sequences of the two domains are more similar to each other than to other GTPases, it is likely that an ancient gene duplication, rather than a fusion of evolutionarily distinct GTPases, gave rise to this family. Although the exact function of these proteins has not been elucidated, studies have revealed that the E. coli EngA homolog, Der, and Neisseria gonorrhoeae EngA are essential for cell viability.  A recent report suggests that E. coli Der functions in ribosome assembly and stability.
Probab=92.71  E-value=0.052  Score=53.78  Aligned_cols=20  Identities=35%  Similarity=0.717  Sum_probs=18.7

Q ss_pred             EEeccCCCchHHHHHhhhcC
Q psy5059          11 VVVGTQSSGKSSVIESLVGK   30 (1036)
Q Consensus        11 ~vvg~~~~gkss~~~~~~g~   30 (1036)
                      |++|.+||||||++|+|.|.
T Consensus         1 ~l~G~~~~GKssl~~~l~~~   20 (157)
T cd01894           1 AIVGRPNVGKSTLFNRLTGR   20 (157)
T ss_pred             CccCCCCCCHHHHHHHHhCC
Confidence            68999999999999999976


No 484
>PLN03118 Rab family protein; Provisional
Probab=92.70  E-value=0.08  Score=56.43  Aligned_cols=24  Identities=33%  Similarity=0.631  Sum_probs=22.0

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|+|||.+||||||++++|.+..+
T Consensus        16 kv~ivG~~~vGKTsli~~l~~~~~   39 (211)
T PLN03118         16 KILLIGDSGVGKSSLLVSFISSSV   39 (211)
T ss_pred             EEEEECcCCCCHHHHHHHHHhCCC
Confidence            899999999999999999988653


No 485
>PF03205 MobB:  Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A.
Probab=92.70  E-value=0.077  Score=53.43  Aligned_cols=23  Identities=39%  Similarity=0.777  Sum_probs=20.8

Q ss_pred             CeEEEeccCCCchHHHHHhhhcC
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGK   30 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~   30 (1036)
                      |.|.|||..|||||||++.|+..
T Consensus         1 pvv~VvG~~~sGKTTl~~~Li~~   23 (140)
T PF03205_consen    1 PVVQVVGPKNSGKTTLIRKLINE   23 (140)
T ss_dssp             -EEEEEESTTSSHHHHHHHHHHH
T ss_pred             CEEEEECCCCCCHHHHHHHHHHH
Confidence            78999999999999999999875


No 486
>PRK09554 feoB ferrous iron transport protein B; Reviewed
Probab=92.69  E-value=0.12  Score=65.85  Aligned_cols=33  Identities=15%  Similarity=0.204  Sum_probs=27.7

Q ss_pred             CCCC-CChhHHHHHHHHHHHHhhccHHHHHHHHHHHH
Q psy5059         900 PALF-VPEVSFELLVKRQIRRLEEPSQRCVELVHEEM  935 (1036)
Q Consensus       900 ~~lf-vp~~aFe~Lvk~qI~~l~~Psl~cvdlV~~EL  935 (1036)
                      ...| +|-.||--|+=   -.|--||+.-+--++.|.
T Consensus       655 ~~~f~~~~~a~a~l~F---~lly~PC~at~~ai~~E~  688 (772)
T PRK09554        655 SQKFGSAAAAYSYLIF---VLLYVPCISVMGAIARES  688 (772)
T ss_pred             hhccCCHHHHHHHHHH---HHHHHHHHHHHHHHHHHh
Confidence            4567 89999998886   567889999999999998


No 487
>cd04120 Rab12 Rab12 subfamily.  Rab12 was first identified in canine cells, where it was localized to the Golgi complex.  The specific function of Rab12 remains unknown, and inconsistent results about its cellular localization have been reported.  More recent studies have identified Rab12 associated with post-Golgi vesicles, or with other small vesicle-like structures but not with the Golgi complex.  Most Rab GTPases contain a lipid modification site at the C-terminus, with sequence motifs CC, CXC, or CCX. Lipid binding is essential for membrane attachment, a key feature of most Rab proteins. GTPase activating proteins (GAPs) interact with GTP-bound Rab and accelerate the hydrolysis of GTP to GDP. Guanine nucleotide exchange factors (GEFs) interact with GDP-bound Rabs to promote the formation of the GTP-bound state.  Rabs are further regulated by guanine nucleotide dissociation inhibitors (GDIs), which facilitate Rab recycling by masking C-terminal lipid binding and promoting cytosolic
Probab=92.69  E-value=0.085  Score=56.34  Aligned_cols=25  Identities=24%  Similarity=0.689  Sum_probs=22.8

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      ||++||..||||||++.++++-.|.
T Consensus         2 ~vvvlG~~gVGKTSli~r~~~~~f~   26 (202)
T cd04120           2 QVIIIGSRGVGKTSLMRRFTDDTFC   26 (202)
T ss_pred             EEEEECcCCCCHHHHHHHHHhCCCC
Confidence            7999999999999999999987663


No 488
>PRK00098 GTPase RsgA; Reviewed
Probab=92.66  E-value=0.086  Score=59.74  Aligned_cols=29  Identities=28%  Similarity=0.387  Sum_probs=0.0

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcccccC
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLPRGI   37 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~pr~~   37 (1036)
                      .+++||.+|||||||+|+|.|..-.-.|.
T Consensus       166 ~~~~~G~sgvGKStlin~l~~~~~~~~g~  194 (298)
T PRK00098        166 VTVLAGQSGVGKSTLLNALAPDLELKTGE  194 (298)
T ss_pred             eEEEECCCCCCHHHHHHHHhCCcCCCCcc


No 489
>TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily. Members of this family are adenylate kinase, EC 2.7.4.3. This clade is found only in eukaryotes and includes human adenylate kinase isozyme 1 (myokinase). Within the adenylate kinase superfamily, this set appears specifically closely related to a subfamily of eukaryotic UMP-CMP kinases (TIGR01359), rather than to the large clade of bacterial, archaeal, and eukaryotic adenylate kinase family members in TIGR01351.
Probab=92.63  E-value=0.084  Score=54.74  Aligned_cols=23  Identities=35%  Similarity=0.508  Sum_probs=21.7

Q ss_pred             CCCeEEEeccCCCchHHHHHhhh
Q psy5059           6 QLPQIVVVGTQSSGKSSVIESLV   28 (1036)
Q Consensus         6 ~lp~i~vvg~~~~gkss~~~~~~   28 (1036)
                      +.|.|+|+|.+||||||+.+.|.
T Consensus         2 ~~~ii~i~G~~GsGKsTl~~~l~   24 (188)
T TIGR01360         2 KCKIIFIVGGPGSGKGTQCEKIV   24 (188)
T ss_pred             CCcEEEEECCCCCCHHHHHHHHH
Confidence            46899999999999999999998


No 490
>PTZ00141 elongation factor 1- alpha; Provisional
Probab=92.61  E-value=0.4  Score=57.44  Aligned_cols=79  Identities=18%  Similarity=0.253  Sum_probs=48.2

Q ss_pred             ccEEEeeccCCCc--hhhhhhhHHHHHHHHHhhhhcCCCCCCCCceEEeCcCCCCh---h---------hHHhhhcCCCc
Q psy5059          43 RPLILQLYYCPKD--DREKRTAAAVINKLQDVFNTVGTDAIQLPQIVVVGTQSSGK---S---------SVIESLVGKSF  108 (1036)
Q Consensus        43 rpl~l~l~~~~~~--~~~~~~~~~l~~kL~~~~~~~g~~~i~lPqIvVvG~QSsGK---S---------SlLEal~G~~f  108 (1036)
                      +++++.+||+|..  +-....+..+.+++++.+...|...-+.|-|-+-|-++.|=   |         ||+|+|..+.-
T Consensus       146 ~~iiv~vNKmD~~~~~~~~~~~~~i~~~i~~~l~~~g~~~~~~~~ipiSa~~g~ni~~~~~~~~Wy~G~tL~~~l~~~~~  225 (446)
T PTZ00141        146 KQMIVCINKMDDKTVNYSQERYDEIKKEVSAYLKKVGYNPEKVPFIPISGWQGDNMIEKSDNMPWYKGPTLLEALDTLEP  225 (446)
T ss_pred             CeEEEEEEccccccchhhHHHHHHHHHHHHHHHHhcCCCcccceEEEeecccCCCcccCCCCCcccchHHHHHHHhCCCC
Confidence            3578999999842  22345677888899988887775333455555555444432   1         69999988763


Q ss_pred             CcccccccccCce
Q psy5059         109 LPRGIGIVTRRPL  121 (1036)
Q Consensus       109 lPrg~G~cTR~Pl  121 (1036)
                      -.|...-.-|+|+
T Consensus       226 ~~~~~~~p~r~~I  238 (446)
T PTZ00141        226 PKRPVDKPLRLPL  238 (446)
T ss_pred             CCcCCCCCeEEEE
Confidence            2233333444444


No 491
>cd04103 Centaurin_gamma Centaurin gamma.  The centaurins (alpha, beta, gamma, and delta) are large, multi-domain proteins that all contain an ArfGAP domain and ankyrin repeats, and in some cases, numerous additional domains.  Centaurin gamma contains an additional GTPase domain near its N-terminus.  The specific function of this GTPase domain has not been well characterized, but centaurin gamma 2 (CENTG2) may play a role in the development of autism.  Centaurin gamma 1 is also called PIKE (phosphatidyl inositol (PI) 3-kinase enhancer) and centaurin gamma 2 is also known as AGAP (ArfGAP protein with a GTPase-like domain, ankyrin repeats and a Pleckstrin homology domain) or GGAP.  Three isoforms of PIKE have been identified. PIKE-S (short) and PIKE-L (long) are brain-specific isoforms, with PIKE-S restricted to the nucleus and PIKE-L found in multiple cellular compartments.  A third isoform, PIKE-A was identified in human glioblastoma brain cancers and has been found in various tissues. 
Probab=92.57  E-value=0.091  Score=53.54  Aligned_cols=26  Identities=27%  Similarity=0.540  Sum_probs=23.1

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCccc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFLP   34 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~p   34 (1036)
                      .|++||..||||||++.++++..|.+
T Consensus         2 ki~vvG~~gvGKTsli~~~~~~~f~~   27 (158)
T cd04103           2 KLGIVGNLQSGKSALVHRYLTGSYVQ   27 (158)
T ss_pred             EEEEECCCCCcHHHHHHHHHhCCCCC
Confidence            58999999999999999999877743


No 492
>COG0699 Predicted GTPases (dynamin-related) [General function prediction only]
Probab=92.55  E-value=1.7  Score=52.78  Aligned_cols=147  Identities=30%  Similarity=0.356  Sum_probs=112.6

Q ss_pred             ccChhHHHHHHHHHHHHHHhhcchhHHHHHHHHHHHHhhhccCCCCccchhchhhhhhhh------------------hh
Q psy5059         618 KKNPALHERIVEVVTQLLRRRLPATNTMVENLLAIELAYINTKHPDFHKDAALVPSLIKS------------------AE  679 (1036)
Q Consensus       618 ~r~p~L~~rI~evv~~lL~~~~~~~~~~i~~li~~E~~yint~hpdf~~~~~~~~~~~~~------------------~~  679 (1036)
                      ..||.+...+.+.+.++......++...+...++++..|+||.||+|.....+.....+.                  ..
T Consensus       321 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~  400 (546)
T COG0699         321 SPFPKLSEALEEVVNQLKNKVDSGLESGLLAIIDIEERYINTKHPLFLSLRQAAAILSKVLDNLEALLRSLDDSRLRELS  400 (546)
T ss_pred             ccchhhHHHHHHHHHHHHHHhhhhHHHHHHHHHHHHHHHHhhcCcchHHHHHHHHHHHHHHHHHHHHHHhhccccccchh
Confidence            578999999999999988899999999999999999999999999998764443211110                  00


Q ss_pred             -------------HH-----h----------------------------hhhcchhhhhhhHHHHHHHHHHHHHHHHHHh
Q psy5059         680 -------------ED-----Y----------------------------QRRTLSEKEKRDCDVIERLIKSYFYIIRKSI  713 (1036)
Q Consensus       680 -------------~~-----~----------------------------~~~~~~~~~~~~~~~i~~~~~sYf~iv~k~~  713 (1036)
                                   ..     +                            ....+++....+...|..++.+| .++...+
T Consensus       401 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~~-~~~~~~~  479 (546)
T COG0699         401 DMGLNSLLSNNLEEHLLGSDFSLYKFLNEFLELKKLDALLATLGEALRRLTGLLPERKTLEKQLIKSLLESL-LILAQKI  479 (546)
T ss_pred             hcccchhHHHHHHHHhhcchhhHHHHHHHHhhhccchhhhccchHHHHHhhcccchhhhhhhHHHHHHHHHH-HHHHHHH
Confidence                         00     0                            00112233334456679999999 9999999


Q ss_pred             hhhhhHHHHHHHHHHHHHHHHHHHHHHhhcccchHHhhhcCHHHHHhhhhhh
Q psy5059         714 QDTVPKAIMHFLVNYVKDNLQSELVTHLYKADSASELLNESEWVAQRRKEAS  765 (1036)
Q Consensus       714 ~d~vPk~i~~~lv~~~~~~l~~~l~~~l~~~~~~~~ll~E~~~ia~rR~~~~  765 (1036)
                      .+.++++++.++.+..+...+......+|.....+.+..+.+.+.+.+..+.
T Consensus       480 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~  531 (546)
T COG0699         480 RDSVLKAIFELLKNKRKRLAQKQRLKRLYLEQLEDELLRTAEEILELRLLLE  531 (546)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHH
Confidence            9999999999998888888888888888888888888888877777666443


No 493
>cd00882 Ras_like_GTPase Ras-like GTPase superfamily. The Ras-like superfamily of small GTPases consists of several families with an extremely high degree of structural and functional similarity. The Ras superfamily is divided into at least four families in eukaryotes: the Ras, Rho, Rab, and Sar1/Arf families.  This superfamily also includes proteins like the GTP translation factors, Era-like GTPases, and G-alpha chain of the heterotrimeric G proteins.  Members of the Ras superfamily regulate a wide variety of cellular functions: the Ras family regulates gene expression, the Rho family regulates cytoskeletal reorganization and gene expression, the Rab and Sar1/Arf families regulate vesicle trafficking, and the Ran family regulates nucleocytoplasmic transport and microtubule organization. The GTP translation factor family regulate initiation, elongation, termination, and release in translation, and the Era-like GTPase family regulates cell division, sporulation, and DNA replication. Memb
Probab=92.54  E-value=0.058  Score=51.77  Aligned_cols=21  Identities=43%  Similarity=0.798  Sum_probs=19.2

Q ss_pred             EeccCCCchHHHHHhhhcCCc
Q psy5059          12 VVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus        12 vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      |+|.+||||||++++|.|...
T Consensus         1 iiG~~~~GKStl~~~l~~~~~   21 (157)
T cd00882           1 VVGDSGVGKTSLLNRLLGGEF   21 (157)
T ss_pred             CCCcCCCcHHHHHHHHHhCCc
Confidence            689999999999999999774


No 494
>cd01879 FeoB Ferrous iron transport protein B (FeoB) subfamily.  E. coli has an iron(II) transport system, known as feo, which may make an important contribution to the iron supply of the cell under anaerobic conditions.  FeoB has been identified as part of this transport system.  FeoB is a large 700-800 amino acid integral membrane protein. The N terminus contains a P-loop motif suggesting that iron transport may be ATP dependent.
Probab=92.53  E-value=0.097  Score=52.11  Aligned_cols=22  Identities=27%  Similarity=0.530  Sum_probs=19.7

Q ss_pred             EeccCCCchHHHHHhhhcCCcc
Q psy5059          12 VVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus        12 vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      ++|.+||||||++|++.|..+.
T Consensus         1 l~G~~~~GKssl~~~~~~~~~~   22 (158)
T cd01879           1 LVGNPNVGKTTLFNALTGARQK   22 (158)
T ss_pred             CCCCCCCCHHHHHHHHhcCccc
Confidence            5899999999999999997653


No 495
>PF00071 Ras:  Ras family;  InterPro: IPR001806 Small GTPases form an independent superfamily within the larger class of regulatory GTP hydrolases. This superfamily contains proteins that control a vast number of important processes and possess a common, structurally preserved GTP-binding domain [, ]. Sequence comparisons of small G proteins from various species have revealed that they are conserved in primary structures at the level of 30-55% similarity []. Crystallographic analysis of various small G proteins revealed the presence of a 20 kDa catalytic domain that is unique for the whole superfamily [, ]. The domain is built of five alpha helices (A1-A5), six beta-strands (B1-B6) and five polypeptide loops (G1-G5). A structural comparison of the GTP- and GDP-bound form, allows one to distinguish two functional loop regions: switch I and switch II that surround the gamma-phosphate group of the nucleotide. The G1 loop (also called the P-loop) that connects the B1 strand and the A1 helix is responsible for the binding of the phosphate groups. The G3 loop provides residues for Mg(2+) and phosphate binding and is located at the N terminus of the A2 helix. The G1 and G3 loops are sequentially similar to Walker A and Walker B boxes that are found in other nucleotide binding motifs. The G2 loop connects the A1 helix and the B2 strand and contains a conserved Thr residue responsible for Mg(2+) binding. The guanine base is recognised by the G4 and G5 loops. The consensus sequence NKXD of the G4 loop contains Lys and Asp residues directly interacting with the nucleotide. Part of the G5 loop located between B6 and A5 acts as a recognition site for the guanine base []. The small GTPase superfamily can be divided into at least 8 different families, including:  Arf small GTPases. GTP-binding proteins involved in protein trafficking by modulating vesicle budding and uncoating within the Golgi apparatus. Ran small GTPases. GTP-binding proteins involved in nucleocytoplasmic transport. Required for the import of proteins into the nucleus and also for RNA export. Rab small GTPases. GTP-binding proteins involved in vesicular traffic. Rho small GTPases. GTP-binding proteins that control cytoskeleton reorganisation. Ras small GTPases. GTP-binding proteins involved in signalling pathways. Sar1 small GTPases. Small GTPase component of the coat protein complex II (COPII) which promotes the formation of transport vesicles from the endoplasmic reticulum (ER). Mitochondrial Rho (Miro). Small GTPase domain found in mitochondrial proteins involved in mitochondrial trafficking. Roc small GTPases domain. Small GTPase domain always found associated with the COR domain. ; GO: 0005525 GTP binding, 0007264 small GTPase mediated signal transduction; PDB: 1M7B_A 2V55_B 3EG5_C 3LAW_A 1YHN_A 1T91_B 1HE8_B 3SEA_B 3T5G_A 1XTS_A ....
Probab=92.51  E-value=0.088  Score=52.88  Aligned_cols=24  Identities=46%  Similarity=0.771  Sum_probs=22.2

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|+|||.++|||||+++++++..|
T Consensus         1 Ki~vvG~~~vGKtsl~~~~~~~~~   24 (162)
T PF00071_consen    1 KIVVVGDSGVGKTSLINRLINGEF   24 (162)
T ss_dssp             EEEEEESTTSSHHHHHHHHHHSST
T ss_pred             CEEEECCCCCCHHHHHHHHHhhcc
Confidence            489999999999999999998776


No 496
>KOG2655|consensus
Probab=92.51  E-value=0.66  Score=53.59  Aligned_cols=214  Identities=20%  Similarity=0.246  Sum_probs=0.0

Q ss_pred             eEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhccCCCCccccccccccccccccchhhh
Q psy5059          86 IVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWGQFLHTKDKVFRDFDDI  165 (1036)
Q Consensus        86 IvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~~~~~~~~w~~~~~~~~~~~~df~~~  165 (1036)
                      +-|||+.+.|||+++++|.+-++                                                         
T Consensus        24 lmvvG~sGlGKsTfiNsLf~~~l---------------------------------------------------------   46 (366)
T KOG2655|consen   24 LMVVGESGLGKSTFINSLFLTDL---------------------------------------------------------   46 (366)
T ss_pred             EEEecCCCccHHHHHHHHHhhhc---------------------------------------------------------


Q ss_pred             hhhhhHHHHHhhccCCCcccccccccccccccCCcccCChhHHHHHHHHH-----HHHhcCCCCCcCCCcEEEEEeecCc
Q psy5059         166 RREIEDETERLAGKNKGICTMDLDAWGQFLHTKDKVFRDFDDIRREIEDE-----TERLAGKNKGICSEPIILKIYSTSV  240 (1036)
Q Consensus       166 r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~~~~~~~~~~~~~I~~~I~~~-----~~~~~g~~~~~S~d~I~L~I~~P~~  240 (1036)
                                                                     ...     ...-......+-.....++=.| --
T Consensus        47 -----------------------------------------------~~~~~~~~~~~~~~~t~~i~~~~~~iee~g-~~   78 (366)
T KOG2655|consen   47 -----------------------------------------------SGNREVPGASERIKETVEIESTKVEIEENG-VK   78 (366)
T ss_pred             -----------------------------------------------cCCcccCCcccCccccceeeeeeeeecCCC-eE


Q ss_pred             ccceeecCCCc-cccCCCCCchhHHHHHHHHHHHhhc-------------CCCcEEEEEeccccccccchhhhhhhhcCC
Q psy5059         241 LNLTLVDLPGI-TKVPVGDQPDDIEAQIKQLVLHYIS-------------NPNSIILAVVTANTDMATSESLKLAKETDV  306 (1036)
Q Consensus       241 ~~LtlVDLPGi-~~~~~~~q~~di~~~ir~lv~~yI~-------------~~n~IIL~V~~An~D~~~s~al~l~r~~Dp  306 (1036)
                      .+||+|||||+ -.+....--.-+...|.+--..|+.             +-||-+-+..|....+.--|          
T Consensus        79 l~LtvidtPGfGD~vdns~~w~pi~~yi~~q~~~yl~~E~~~~R~~~~D~RVH~cLYFI~P~ghgL~p~D----------  148 (366)
T KOG2655|consen   79 LNLTVIDTPGFGDAVDNSNCWRPIVNYIDSQFDQYLDEESRLNRSKIKDNRVHCCLYFISPTGHGLKPLD----------  148 (366)
T ss_pred             EeeEEeccCCCcccccccccchhhhHHHHHHHHHHHhhhccCCcccccCCceEEEEEEeCCCCCCCcHhh----------


Q ss_pred             CCCcccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHHHHHhhhccccCCceEEEE
Q psy5059         307 DGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGRRTLAVV  386 (1036)
Q Consensus       307 ~g~RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~~~la~~~d~~g~rti~Vi  386 (1036)
                                                                                -....+|+..|     -+|-||
T Consensus       149 ----------------------------------------------------------i~~Mk~l~~~v-----NiIPVI  165 (366)
T KOG2655|consen  149 ----------------------------------------------------------IEFMKKLSKKV-----NLIPVI  165 (366)
T ss_pred             ----------------------------------------------------------HHHHHHHhccc-----ccccee


Q ss_pred             ecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCcceeeeecccchhhhHHHHHHhhhcCcCCC
Q psy5059         387 TKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNSIILAVVTANTDMATSESLKLAKETDVDGR  466 (1036)
Q Consensus       387 tK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~ipla~ISA~td~~~qeil~la~~vd~~g~  466 (1036)
                      .|-|.+.++..                        ..++..+++-+....=-+--|-..-.+....+-.+..+..-|   
T Consensus       166 ~KaD~lT~~El------------------------~~~K~~I~~~i~~~nI~vf~fp~~~~d~~~~~~~~~l~~~~P---  218 (366)
T KOG2655|consen  166 AKADTLTKDEL------------------------NQFKKRIRQDIEEHNIKVFDFPTDESDEELKEEEQDLKSSIP---  218 (366)
T ss_pred             eccccCCHHHH------------------------HHHHHHHHHHHHHcCcceecCCCCcchhhhHHHHHHHhhcCC---


Q ss_pred             ceeeeecccccccccchHHHHhcCcceeeeecEEEEEcCChhhh
Q psy5059         467 RTLAVVTKIDLMDAGTDAIDILCGRVIPVKLGIIGVVNRSQQDI  510 (1036)
Q Consensus       467 RtIgVlTK~Dlmd~gt~~~~il~g~~~~L~LG~~~V~NRs~~di  510 (1036)
                        .+|+......+.+....  ++|+.+|  .|.+.|-|...-|.
T Consensus       219 --FAIigs~~~~e~~G~~~--vrgR~Yp--WG~veien~~h~DF  256 (366)
T KOG2655|consen  219 --FAIIGSNTEIEEKGKKR--VRGRKYP--WGTVEIENPEHCDF  256 (366)
T ss_pred             --eEEEecCceeecCCceE--eeceecC--CceeeccCCCcchH


No 497
>cd01874 Cdc42 Cdc42 subfamily.  Cdc42 is an essential GTPase that belongs to the Rho family of Ras-like GTPases.  These proteins act as molecular switches by responding to exogenous and/or endogenous signals and relaying those signals to activate downstream components of a biological pathway.  Cdc42 transduces signals to the actin cytoskeleton to initiate and maintain polarized growth and to mitogen-activated protein morphogenesis. In the budding yeast Saccharomyces cerevisiae, Cdc42 plays an important role in multiple actin-dependent morphogenetic events such as bud emergence, mating-projection formation, and pseudohyphal growth.  In mammalian cells, Cdc42 regulates a variety of actin-dependent events and induces the JNK/SAPK protein kinase cascade, which leads to the activation of transcription factors within the nucleus.  Cdc42 mediates these processes through interactions with a myriad of downstream effectors, whose number and regulation we are just starting to understand.  In addi
Probab=92.51  E-value=0.096  Score=54.20  Aligned_cols=24  Identities=33%  Similarity=0.537  Sum_probs=22.4

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSF   32 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~   32 (1036)
                      .|++||..||||||++.++++..|
T Consensus         3 ki~vvG~~~vGKTsl~~~~~~~~f   26 (175)
T cd01874           3 KCVVVGDGAVGKTCLLISYTTNKF   26 (175)
T ss_pred             EEEEECCCCCCHHHHHHHHHcCCC
Confidence            589999999999999999998776


No 498
>PF03308 ArgK:  ArgK protein;  InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components. In Escherichia coli, the arginine-ornithine transport system requires an arginine-ornithine-binding protein and the lysine-arginine-ornithine (LAO) transport system includes a LAO-binding protein. Both periplasmic proteins can be phosphorylated by a single kinase, ArgK [] resulting in reduced levels of transport activity of the periplasmic transport systems that include each of the binding proteins. The ArgK protein acts as an ATPase enzyme and as a kinase.; PDB: 3MD0_A 3P32_A 2QM7_A 2QM8_A 2WWW_D 2P67_A 3NXS_A.
Probab=92.49  E-value=0.81  Score=50.63  Aligned_cols=186  Identities=16%  Similarity=0.205  Sum_probs=0.0

Q ss_pred             HHhhhhcCCCCCCCCceEEeCcCCCChhhHHhhhcCCCcCcccccccccCceEEEEeeCCCCchhhhhhccCCCCccccc
Q psy5059          70 QDVFNTVGTDAIQLPQIVVVGTQSSGKSSVIESLVGKSFLPRGIGIVTRRPLILQLYYCPKDDREKRTAAAGTMDLDAWG  149 (1036)
Q Consensus        70 ~~~~~~~g~~~i~lPqIvVvG~QSsGKSSlLEal~G~~flPrg~G~cTR~Pl~l~l~~~~~~~~~~~~~~~~~~~~~~w~  149 (1036)
                      ++++..+-.+.-.-+.|-+.|.+++|||||+++|.                                             
T Consensus        16 ~~ll~~l~~~~g~a~~iGiTG~PGaGKSTli~~l~---------------------------------------------   50 (266)
T PF03308_consen   16 RELLKRLYPHTGRAHVIGITGPPGAGKSTLIDALI---------------------------------------------   50 (266)
T ss_dssp             HHHHHHHGGGTT-SEEEEEEE-TTSSHHHHHHHHH---------------------------------------------
T ss_pred             HHHHHHHHhhcCCceEEEeeCCCCCcHHHHHHHHH---------------------------------------------


Q ss_pred             cccccccccccchhhhhhhhhHHHHHhhccCCCccccccccccccc---------------------ccCCcccCChhHH
Q psy5059         150 QFLHTKDKVFRDFDDIRREIEDETERLAGKNKGICTMDLDAWGQFL---------------------HTKDKVFRDFDDI  208 (1036)
Q Consensus       150 ~~~~~~~~~~~df~~~r~ei~~e~~r~~~~~~~i~~~~~~~~~~f~---------------------~~~~~~~~~~~~I  208 (1036)
                                              .++....+.+.-...+.-++|.                     .-+-..-.....+
T Consensus        51 ------------------------~~~~~~g~~VaVlAVDPSSp~tGGAlLGDRiRM~~~~~d~~vfIRS~atRG~lGGl  106 (266)
T PF03308_consen   51 ------------------------RELRERGKRVAVLAVDPSSPFTGGALLGDRIRMQELSRDPGVFIRSMATRGSLGGL  106 (266)
T ss_dssp             ------------------------HHHHHTT--EEEEEE-GGGGCC---SS--GGGCHHHHTSTTEEEEEE---SSHHHH
T ss_pred             ------------------------HHHhhcCCceEEEEECCCCCCCCCcccccHHHhcCcCCCCCEEEeecCcCCCCCCc


Q ss_pred             HHHHHHHHHHhcCCCCCcCCCcEEEEEeecCcccceeecCCCccccCCCCCchhHHHHHHHHHHHhhcCCCcEEEEEecc
Q psy5059         209 RREIEDETERLAGKNKGICSEPIILKIYSTSVLNLTLVDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTA  288 (1036)
Q Consensus       209 ~~~I~~~~~~~~g~~~~~S~d~I~L~I~~P~~~~LtlVDLPGi~~~~~~~q~~di~~~ir~lv~~yI~~~n~IIL~V~~A  288 (1036)
                      .....+...-+..-    --|.|.++=.|-..-..-++++.                             +++++++.|.
T Consensus       107 s~~t~~~v~ll~aa----G~D~IiiETVGvGQsE~~I~~~a-----------------------------D~~v~v~~Pg  153 (266)
T PF03308_consen  107 SRATRDAVRLLDAA----GFDVIIIETVGVGQSEVDIADMA-----------------------------DTVVLVLVPG  153 (266)
T ss_dssp             HHHHHHHHHHHHHT----T-SEEEEEEESSSTHHHHHHTTS-----------------------------SEEEEEEESS
T ss_pred             cHhHHHHHHHHHHc----CCCEEEEeCCCCCccHHHHHHhc-----------------------------CeEEEEecCC


Q ss_pred             ccccccchhhhhhhhcCCCCCcccceeccCCCCcccccCCCCCchHHHHHHHHHHhhhcCCCceEEEEEecCccccchHH
Q psy5059         289 NTDMATSESLKLAKETDVDGRRTLDLLDIDLPGITKVPVGDQPDDIEAQIKQLVLHYISNPNSIILAVVTANTDMATSES  368 (1036)
Q Consensus       289 n~D~~~s~al~l~r~~Dp~g~RTigvl~~~~~g~~~~~~~~~~~~~~~~~~~~~~~y~~~~~~~~~~~v~~~~d~~~~~~  368 (1036)
                      .-|-..-.=..+..-.|                                                               
T Consensus       154 ~GD~iQ~~KaGimEiaD---------------------------------------------------------------  170 (266)
T PF03308_consen  154 LGDEIQAIKAGIMEIAD---------------------------------------------------------------  170 (266)
T ss_dssp             TCCCCCTB-TTHHHH-S---------------------------------------------------------------
T ss_pred             CccHHHHHhhhhhhhcc---------------------------------------------------------------


Q ss_pred             HHHhhhccccCCceEEEEecccccCCCchhhhhhcCcccccccccccccchHHHHHHHHHHhhccCCCc------ceeee
Q psy5059         369 LKLAKETDVDGRRTLAVVTKIDLMDAGTDAIDILCGRVIPVKLDVDGRRTYIEAQIKQLVLHYISNPNS------IILAV  442 (1036)
Q Consensus       369 ~~la~~~d~~g~rti~VitK~Dl~~~g~~~~~~l~~~~~~~~~~~~~~~~~~~~~l~~~v~~~i~~~~~------ipla~  442 (1036)
                                    |.|+||.|+-..                           +.....+...+.....      .|+.-
T Consensus       171 --------------i~vVNKaD~~gA---------------------------~~~~~~l~~~l~l~~~~~~~W~ppV~~  209 (266)
T PF03308_consen  171 --------------IFVVNKADRPGA---------------------------DRTVRDLRSMLHLLREREDGWRPPVLK  209 (266)
T ss_dssp             --------------EEEEE--SHHHH---------------------------HHHHHHHHHHHHHCSTSCTSB--EEEE
T ss_pred             --------------EEEEeCCChHHH---------------------------HHHHHHHHHHHhhccccccCCCCCEEE


Q ss_pred             ecccchhhhHHHHHHhhhc
Q psy5059         443 VTANTDMATSESLKLAKET  461 (1036)
Q Consensus       443 ISA~td~~~qeil~la~~v  461 (1036)
                      +||.++..+.++.+...+.
T Consensus       210 tsA~~~~Gi~eL~~~i~~~  228 (266)
T PF03308_consen  210 TSALEGEGIDELWEAIDEH  228 (266)
T ss_dssp             EBTTTTBSHHHHHHHHHHH
T ss_pred             EEeCCCCCHHHHHHHHHHH


No 499
>COG0012 Predicted GTPase, probable translation factor [Translation, ribosomal structure and biogenesis]
Probab=92.47  E-value=0.11  Score=59.90  Aligned_cols=24  Identities=29%  Similarity=0.454  Sum_probs=21.5

Q ss_pred             CeEEEeccCCCchHHHHHhhhcCC
Q psy5059           8 PQIVVVGTQSSGKSSVIESLVGKS   31 (1036)
Q Consensus         8 p~i~vvg~~~~gkss~~~~~~g~~   31 (1036)
                      .++-+||-|||||||+||+|...+
T Consensus         3 l~~GIVGlPNVGKSTlFnAlT~~~   26 (372)
T COG0012           3 LKIGIVGLPNVGKSTLFNALTKAG   26 (372)
T ss_pred             ceeEEecCCCCcHHHHHHHHHcCC
Confidence            478999999999999999998755


No 500
>COG1100 GTPase SAR1 and related small G proteins [General function prediction only]
Probab=92.46  E-value=0.088  Score=55.93  Aligned_cols=25  Identities=40%  Similarity=0.755  Sum_probs=23.3

Q ss_pred             eEEEeccCCCchHHHHHhhhcCCcc
Q psy5059           9 QIVVVGTQSSGKSSVIESLVGKSFL   33 (1036)
Q Consensus         9 ~i~vvg~~~~gkss~~~~~~g~~~~   33 (1036)
                      .|+|+|..||||||+++++++..|.
T Consensus         7 kivv~G~~g~GKTtl~~~l~~~~~~   31 (219)
T COG1100           7 KIVVLGDGGVGKTTLLNRLVGDEFP   31 (219)
T ss_pred             EEEEEcCCCccHHHHHHHHhcCcCc
Confidence            7999999999999999999998874


Done!