Query         psy5060
Match_columns 145
No_of_seqs    123 out of 777
Neff          5.5 
Searched_HMMs 46136
Date          Sat Aug 17 00:43:37 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5060.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5060hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF05485 THAP:  THAP domain;  I  99.8   5E-21 1.1E-25  131.4   6.2   73    7-81     10-83  (84)
  2 smart00692 DM3 Zinc finger dom  99.8 1.1E-19 2.4E-24  118.9   3.1   57   17-78      1-58  (59)
  3 PF13300 DUF4078:  Domain of un  27.3      70  0.0015   22.6   2.7   24   12-35     30-53  (88)
  4 PF15129 FAM150:  FAM150 family  20.4      37  0.0008   25.5   0.2   34   16-53     57-90  (123)
  5 cd01238 PH_Tec Tec pleckstrin   14.8 2.1E+02  0.0045   20.1   3.0   24   13-36     82-105 (106)
  6 cd01237 Unc112 Unc-112 pleckst  13.9 1.3E+02  0.0029   22.0   1.8   16   22-37     87-102 (106)
  7 PF13030 DUF3891:  Protein of u  11.5      56  0.0012   26.5  -0.9   43   10-53     66-108 (221)
  8 CHL00039 psbF photosystem II p   9.7 1.1E+02  0.0023   18.6   0.1   10   70-79     19-28  (39)
  9 PF13790 DUF4182:  Domain of un   9.4 1.7E+02  0.0036   17.8   0.9   24  106-129     5-29  (38)
 10 TIGR01333 cyt_b559_beta cytoch   9.3 1.1E+02  0.0024   18.9   0.1   10   70-79     23-32  (43)

No 1  
>PF05485 THAP:  THAP domain;  InterPro: IPR006612 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. The THAP domain is an ~90-residue domain restricted to animals, which is shared between the THAP family of cellular DNA-binding proteins, and transposases from mobile genomic parasites. The defined THAP domain includes: a C2CH signature (consensus: C-x(2,4)-C-x(35,50)-C-x(2)-H); three additional key residues that are strictly conserved in all THAP domains that have been found to date (THAP1 amino acids P26, W36, F58); a C-terminal AVPTIF box; and several other conserved amino acid positions with distinct physicochemical properties (e.g. hydrophobic and polar). The THAP domain can be found in one or more copies and can be associated with other domains, such as the C2H2-type zinc finger. The THAP domain is supposed to be a DNA-binding domain (DBD) [, ].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding; PDB: 3KDE_C 2D8R_A 2JM3_A 2KO0_A 2JTG_A 2L1G_A.
Probab=99.84  E-value=5e-21  Score=131.40  Aligned_cols=73  Identities=45%  Similarity=0.814  Sum_probs=54.5

Q ss_pred             ccccCCCCcEEEeCCCChHHHHHHHHHhhcCCC-CcCCCceeccccCCcCccccccccCCcccCCCceecccCCCC
Q psy5060           7 NSLFWTSSTKFGRFPEDKLRRKQWCIAMKRDKW-KPSKHSKICSAHFTEDSFETNAWSERKKLSDTAVPSIFTFPD   81 (145)
Q Consensus         7 n~~~k~~~vsfhrFPkD~~rr~kWi~~~~r~~~-~p~k~~~VCS~HF~~~~f~~~~~~~r~~Lk~~AVPTIF~~~~   81 (145)
                      |+...+.+++||+||+|++++++|+++|++.++ .+...++|||+||++++|..  ...+.+|++|||||||+.++
T Consensus        10 ~~~~~~~~~~f~~fP~d~~~~~~W~~~~~~~~~~~~~~~~~ICs~HF~~~~~~~--~~~~~~L~~~AVPtl~~~~~   83 (84)
T PF05485_consen   10 NSSSRKPGVSFFRFPKDPERRKKWLKACGREDWWKPTKNSRICSRHFEPDDFRR--SSKRRRLKPDAVPTLFLPPE   83 (84)
T ss_dssp             TSTCCTTSS-EEE--SSHHHHHHHHHHHTSTCG-GTSTTSEEEGGGSTGGGBST--TTSSSSB-TT---CCC----
T ss_pred             CCCeeCCCeEEEECCCCHHHHHHHHHHhcccccccccCCccchhhhCchhhccc--ccCCCcCCCCCCCcCcCCCC
Confidence            356678899999999999999999999999887 77889999999999999944  34568999999999998654


No 2  
>smart00692 DM3 Zinc finger domain in CG10631, C. elegans LIN-15B and human P52rIPK.
Probab=99.78  E-value=1.1e-19  Score=118.87  Aligned_cols=57  Identities=35%  Similarity=0.584  Sum_probs=50.7

Q ss_pred             EEeCCCChHHHHHHHHHhhcCC-CCcCCCceeccccCCcCccccccccCCcccCCCceecccC
Q psy5060          17 FGRFPEDKLRRKQWCIAMKRDK-WKPSKHSKICSAHFTEDSFETNAWSERKKLSDTAVPSIFT   78 (145)
Q Consensus        17 fhrFPkD~~rr~kWi~~~~r~~-~~p~k~~~VCS~HF~~~~f~~~~~~~r~~Lk~~AVPTIF~   78 (145)
                      ||+||+|++++++|+++|++.. +.+.+..+|||+||+++||..     +++|++|||||||+
T Consensus         1 ff~FP~d~~~~~~W~~~~~~~~~~~~~~~~~vCs~HF~~~~~~~-----~~~L~~~AvPt~~l   58 (59)
T smart00692        1 LFRFPKDPELLKKWEHNLRLSPDEKKLKNSRICSRHFEPECFGK-----RRRLKPGAVPTLEL   58 (59)
T ss_pred             CCCCccCHHHHHHHHHHhCCCccccCCCCCCcchhhCCHhHhCC-----ccccCCCCCccccC
Confidence            7999999999999999999864 346789999999999999964     35899999999997


No 3  
>PF13300 DUF4078:  Domain of unknown function (DUF4078)
Probab=27.32  E-value=70  Score=22.65  Aligned_cols=24  Identities=21%  Similarity=0.303  Sum_probs=19.6

Q ss_pred             CCCcEEEeCCCChHHHHHHHHHhh
Q psy5060          12 TSSTKFGRFPEDKLRRKQWCIAMK   35 (145)
Q Consensus        12 ~~~vsfhrFPkD~~rr~kWi~~~~   35 (145)
                      +.|+.||.|..|.+.+++=+..+.
T Consensus        30 ~~Gvgfy~FS~Dee~R~~qme~L~   53 (88)
T PF13300_consen   30 THGVGFYAFSKDEEERQEQMEELE   53 (88)
T ss_pred             HHcceeeecCCCHHHHHHHHHHHH
Confidence            568999999999988887666654


No 4  
>PF15129 FAM150:  FAM150 family
Probab=20.38  E-value=37  Score=25.48  Aligned_cols=34  Identities=24%  Similarity=0.407  Sum_probs=25.2

Q ss_pred             EEEeCCCChHHHHHHHHHhhcCCCCcCCCceeccccCC
Q psy5060          16 KFGRFPEDKLRRKQWCIAMKRDKWKPSKHSKICSAHFT   53 (145)
Q Consensus        16 sfhrFPkD~~rr~kWi~~~~r~~~~p~k~~~VCS~HF~   53 (145)
                      ..=-||.|..+..++++.+..    |-..+--|++||.
T Consensus        57 ~~ei~prdl~~k~kfi~h~tg----pl~fs~~c~k~f~   90 (123)
T PF15129_consen   57 RVEIVPRDLRMKDKFIKHLTG----PLYFSPKCSKHFH   90 (123)
T ss_pred             ceeeccccchhHHHHHHHhCC----ceeeCHHHHHHHH
Confidence            345588999999999887663    4445667999996


No 5  
>cd01238 PH_Tec Tec pleckstrin homology (PH) domain. Tec pleckstrin homology (PH) domain. Proteins in the Tec family of cytoplasmic protein tyrosine kinases that includes Bruton's tyrosine kinase (BTK), BMX, IL2-inducible T-cell kinase (Itk) and Tec. These proteins generally have an N-terminal PH domain, followed by a Tek homology (TH) domain, a SH3 domain, a SH2 domain and a kinase domain. Tec PH domains tether these proteins to membranes following the activation of PI3K and its subsequent phosphorylation of phosphoinositides. The importance of PH domain membrane anchoring is confirmed by the discovery of a mutation of a critical arginine residue in the BTK PH domain, which causes X-linked agammaglobulinemia (XLA) in humans and a related disorder is mice. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few dis
Probab=14.84  E-value=2.1e+02  Score=20.06  Aligned_cols=24  Identities=25%  Similarity=0.404  Sum_probs=18.4

Q ss_pred             CCcEEEeCCCChHHHHHHHHHhhc
Q psy5060          13 SSTKFGRFPEDKLRRKQWCIAMKR   36 (145)
Q Consensus        13 ~~vsfhrFPkD~~rr~kWi~~~~r   36 (145)
                      .+-.||-+-.+++-+..|+.+++.
T Consensus        82 ~~r~~yl~A~s~~er~~WI~ai~~  105 (106)
T cd01238          82 DEGTLYVFAPTEELRKRWIKALKQ  105 (106)
T ss_pred             CCCeEEEEcCCHHHHHHHHHHHHh
Confidence            344677677788889999999864


No 6  
>cd01237 Unc112 Unc-112 pleckstrin homology (PH) domain. Unc-112 pleckstrin homology (PH) domain.  Unc-112 and related proteins contain two FERM domains with a PH domain between them. Both the PH and FERM domains have a PH-like fold.  The FERM domains are likely responsible for the role of Unc-112 in organizing beta-integrin. The specific role of the Unc-112 PH domain is not known, but it is predicted to be involved in mediating membrane interactions. PH domains share little sequence conservation, but all have a common fold, which is electrostatically polarized. PH domains also have diverse functions. They are often involved in targeting proteins to the plasma membrane, but few display strong specificity in lipid binding.  Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains.
Probab=13.92  E-value=1.3e+02  Score=21.98  Aligned_cols=16  Identities=13%  Similarity=0.397  Sum_probs=13.3

Q ss_pred             CChHHHHHHHHHhhcC
Q psy5060          22 EDKLRRKQWCIAMKRD   37 (145)
Q Consensus        22 kD~~rr~kWi~~~~r~   37 (145)
                      .+++.+.+|+++|+.+
T Consensus        87 dsEeqya~Wmaa~rla  102 (106)
T cd01237          87 DNEKQYAKWMAACRLA  102 (106)
T ss_pred             CCHHHHHHHHHHHHHh
Confidence            3568889999999975


No 7  
>PF13030 DUF3891:  Protein of unknown function (DUF3891)
Probab=11.48  E-value=56  Score=26.51  Aligned_cols=43  Identities=14%  Similarity=0.237  Sum_probs=30.2

Q ss_pred             cCCCCcEEEeCCCChHHHHHHHHHhhcCCCCcCCCceeccccCC
Q psy5060          10 FWTSSTKFGRFPEDKLRRKQWCIAMKRDKWKPSKHSKICSAHFT   53 (145)
Q Consensus        10 ~k~~~vsfhrFPkD~~rr~kWi~~~~r~~~~p~k~~~VCS~HF~   53 (145)
                      ..|...+|.-+|.+ .....|..-+....-...--..+||.|+.
T Consensus        66 ~~g~P~~F~~~p~~-~~~~~~~~gi~~~~~~~~yaaLL~S~H~~  108 (221)
T PF13030_consen   66 ETGAPYDFMDYPLQ-EKLAFYRRGIDEAEQKSPYAALLCSMHYS  108 (221)
T ss_pred             ccCCccchhhCChh-HHHHHHHHHHHHHHHcCCHHHHHHHHHHH
Confidence            45778899999944 56688888877642222235789999984


No 8  
>CHL00039 psbF photosystem II protein VI
Probab=9.66  E-value=1.1e+02  Score=18.63  Aligned_cols=10  Identities=40%  Similarity=0.786  Sum_probs=7.6

Q ss_pred             CCceecccCC
Q psy5060          70 DTAVPSIFTF   79 (145)
Q Consensus        70 ~~AVPTIF~~   79 (145)
                      .-||||+|..
T Consensus        19 ~lavPtvffl   28 (39)
T CHL00039         19 GLAVPTVFFL   28 (39)
T ss_pred             cccCCceeec
Confidence            3589999874


No 9  
>PF13790 DUF4182:  Domain of unknown function (DUF4182)
Probab=9.43  E-value=1.7e+02  Score=17.77  Aligned_cols=24  Identities=25%  Similarity=0.487  Sum_probs=15.4

Q ss_pred             hccCccccccCCCCe-eeeecccce
Q psy5060         106 VCKTSKAWFENPGSQ-FTFLYHFCR  129 (145)
Q Consensus       106 ~~~~~~~~~~~~~sq-~~~~~~~~~  129 (145)
                      +|.+=+..++-.++. +..+|+.|.
T Consensus         5 vCq~C~~~Id~~e~ekV~~lYg~C~   29 (38)
T PF13790_consen    5 VCQHCNETIDHFETEKVTTLYGKCG   29 (38)
T ss_pred             EeccccceeeeecCCcEEEEEEECC
Confidence            444444555555556 889999885


No 10 
>TIGR01333 cyt_b559_beta cytochrome b559, beta subunit. This model describes the beta subunit of cytochrome b559, about 40 residues in length. It is homologous to the N-terminal half of the alpha subunit, a protein of about 83 residues. Cytochrome b559 is associated with photosystem II.
Probab=9.30  E-value=1.1e+02  Score=18.89  Aligned_cols=10  Identities=40%  Similarity=0.929  Sum_probs=7.6

Q ss_pred             CCceecccCC
Q psy5060          70 DTAVPSIFTF   79 (145)
Q Consensus        70 ~~AVPTIF~~   79 (145)
                      --||||+|..
T Consensus        23 ~lavPtVffl   32 (43)
T TIGR01333        23 ALAIPTVFFF   32 (43)
T ss_pred             cccCCceeec
Confidence            3589999874


Done!