Query         psy509
Match_columns 158
No_of_seqs    231 out of 1152
Neff          6.7 
Searched_HMMs 46136
Date          Fri Aug 16 17:02:31 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy509.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/509hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1818|consensus              100.0   2E-34 4.3E-39  256.5   6.6  136    1-154   137-272 (634)
  2 PF01363 FYVE:  FYVE zinc finge  99.8 2.3E-21 4.9E-26  129.0   2.4   63   24-86      1-68  (69)
  3 smart00064 FYVE Protein presen  99.8 2.3E-19 5.1E-24  118.9   3.9   63   24-86      2-67  (68)
  4 cd00065 FYVE FYVE domain; Zinc  99.6 1.6E-16 3.4E-21  101.7   2.6   55   29-83      2-56  (57)
  5 KOG1729|consensus               99.6 2.7E-16 5.8E-21  130.6   2.3   69   18-87    154-226 (288)
  6 KOG1819|consensus               99.6 3.2E-16   7E-21  137.4   1.6   63   22-84    891-961 (990)
  7 PTZ00303 phosphatidylinositol   99.5 3.3E-15 7.1E-20  135.8   4.1   71   17-87    444-531 (1374)
  8 KOG1842|consensus               99.0 1.9E-11 4.1E-16  105.8  -1.2   65   23-87    171-260 (505)
  9 KOG1409|consensus               99.0 7.8E-11 1.7E-15   99.5   1.8   70   21-90    274-354 (404)
 10 KOG1841|consensus               99.0 2.2E-10 4.9E-15  107.6   1.8   49   19-67    544-595 (1287)
 11 KOG1843|consensus               98.8 2.7E-09 5.8E-14   91.8   2.0   66   21-86    149-219 (473)
 12 KOG1811|consensus               98.0 5.6E-07 1.2E-11   81.5  -1.5   55   31-85    328-383 (1141)
 13 KOG4424|consensus               97.9 2.7E-06 5.9E-11   76.2   0.5   65   23-88    408-474 (623)
 14 PF02318 FYVE_2:  FYVE-type zin  97.7 3.1E-05 6.8E-10   56.5   2.8   53   28-87     53-106 (118)
 15 smart00726 UIM Ubiquitin-inter  97.6 6.8E-05 1.5E-09   40.9   2.4   22  135-156     1-22  (26)
 16 PF02809 UIM:  Ubiquitin intera  97.5 5.5E-05 1.2E-09   37.8   1.4   17  135-151     2-18  (18)
 17 KOG0230|consensus               97.5 6.4E-05 1.4E-09   73.4   2.6   48   29-87      5-52  (1598)
 18 KOG0230|consensus               97.1 0.00039 8.6E-09   68.1   3.0   55   29-92     97-151 (1598)
 19 KOG2199|consensus               95.9  0.0049 1.1E-07   53.7   2.3   27  130-156   159-185 (462)
 20 KOG1841|consensus               93.6   0.072 1.6E-06   51.7   3.7   54   21-87    646-702 (1287)
 21 PF07975 C1_4:  TFIIH C1-like d  93.1    0.02 4.2E-07   36.1  -0.6   44   31-82      1-50  (51)
 22 KOG0993|consensus               92.7  0.0057 1.2E-07   53.5  -4.6   58   28-87    467-526 (542)
 23 KOG4275|consensus               92.1   0.042 9.1E-07   46.3  -0.0   48   29-85     44-91  (350)
 24 KOG1729|consensus               90.3   0.078 1.7E-06   44.5  -0.1   56   29-84     20-81  (288)
 25 PF09538 FYDLN_acid:  Protein o  89.9    0.22 4.9E-06   35.9   2.0   33   23-55      3-36  (108)
 26 smart00154 ZnF_AN1 AN1-like Zi  89.7     0.2 4.3E-06   29.6   1.3   26   32-59      1-26  (39)
 27 PF13717 zinc_ribbon_4:  zinc-r  89.4     0.2 4.4E-06   29.0   1.2   25   31-55      4-35  (36)
 28 PRK00464 nrdR transcriptional   88.7    0.22 4.7E-06   38.2   1.2   25   31-55      2-38  (154)
 29 TIGR02300 FYDLN_acid conserved  88.7    0.28 6.2E-06   36.4   1.8   33   23-55      3-36  (129)
 30 PF13719 zinc_ribbon_5:  zinc-r  87.8    0.31 6.6E-06   28.3   1.2   25   31-55      4-35  (37)
 31 TIGR00622 ssl1 transcription f  86.8    0.46 9.9E-06   34.6   1.9   45   30-82     56-110 (112)
 32 PF14634 zf-RING_5:  zinc-RING   86.3    0.14 3.1E-06   30.6  -0.8   33   31-64      1-33  (44)
 33 KOG0320|consensus               84.7   0.084 1.8E-06   41.4  -3.0   46   31-87    133-179 (187)
 34 PHA02768 hypothetical protein;  84.4    0.43 9.4E-06   30.4   0.7   26   30-55      6-41  (55)
 35 PF07282 OrfB_Zn_ribbon:  Putat  84.3    0.86 1.9E-05   29.5   2.2   31   25-55     24-56  (69)
 36 PRK03564 formate dehydrogenase  83.2     1.3 2.8E-05   37.6   3.3   72   20-92    178-269 (309)
 37 KOG3576|consensus               83.0    0.35 7.7E-06   39.1  -0.1   28   30-57    118-157 (267)
 38 KOG2164|consensus               82.3     0.4 8.8E-06   43.1  -0.1   52   29-87    186-237 (513)
 39 PF13639 zf-RING_2:  Ring finge  82.0    0.33 7.2E-06   28.7  -0.5   34   30-64      1-34  (44)
 40 PRK00398 rpoP DNA-directed RNA  81.5    0.89 1.9E-05   27.4   1.3   25   31-55      5-31  (46)
 41 PRK00420 hypothetical protein;  80.9     1.1 2.3E-05   32.7   1.8   26   29-54     23-49  (112)
 42 PF01485 IBR:  IBR domain;  Int  80.9     1.2 2.7E-05   27.7   1.9   33   31-63     20-58  (64)
 43 PF10571 UPF0547:  Uncharacteri  80.1     1.1 2.3E-05   24.2   1.2   23   31-55      2-24  (26)
 44 KOG0823|consensus               79.9    0.71 1.5E-05   37.6   0.6   34   49-87     63-96  (230)
 45 PF12773 DZR:  Double zinc ribb  78.9     1.4 2.9E-05   26.7   1.5   26   29-54     12-38  (50)
 46 TIGR02098 MJ0042_CXXC MJ0042 f  76.6     1.5 3.2E-05   25.1   1.1   25   31-55      4-35  (38)
 47 KOG3799|consensus               76.2     1.1 2.4E-05   33.9   0.6   53   28-85     64-117 (169)
 48 KOG3173|consensus               74.7     1.4   3E-05   34.2   0.8   27   30-59    106-132 (167)
 49 KOG0153|consensus               74.5    0.56 1.2E-05   40.4  -1.5   17   29-45     41-57  (377)
 50 smart00647 IBR In Between Ring  74.1     2.7 5.9E-05   26.2   2.0   22   42-63     37-58  (64)
 51 KOG0978|consensus               74.1    0.29 6.3E-06   45.6  -3.5   44   30-84    644-687 (698)
 52 PF07191 zinc-ribbons_6:  zinc-  74.1     1.1 2.5E-05   29.9   0.2   32   31-62      3-39  (70)
 53 PLN03208 E3 ubiquitin-protein   73.4    0.43 9.3E-06   37.9  -2.3   54   30-87     19-80  (193)
 54 KOG1814|consensus               73.3     1.5 3.3E-05   38.6   0.9   40   24-63    361-404 (445)
 55 TIGR00570 cdk7 CDK-activating   73.0     0.8 1.7E-05   38.9  -0.9   50   28-86      2-54  (309)
 56 PF13923 zf-C3HC4_2:  Zinc fing  72.7       1 2.3E-05   25.9  -0.2   29   32-63      1-29  (39)
 57 PF14803 Nudix_N_2:  Nudix N-te  71.9     2.3 4.9E-05   24.4   1.1   27   55-82      2-29  (34)
 58 KOG4739|consensus               71.4     1.8 3.9E-05   35.4   0.8   44   31-86      5-48  (233)
 59 cd00162 RING RING-finger (Real  71.4     1.1 2.4E-05   25.3  -0.3   31   31-64      1-31  (45)
 60 PF12760 Zn_Tnp_IS1595:  Transp  71.1       3 6.5E-05   25.1   1.6   30   24-53     13-45  (46)
 61 PF13901 DUF4206:  Domain of un  71.0     3.1 6.8E-05   32.9   2.1   46   47-92      2-52  (202)
 62 TIGR02605 CxxC_CxxC_SSSS putat  70.7       2 4.4E-05   26.2   0.8   23   31-53      7-34  (52)
 63 PF06750 DiS_P_DiS:  Bacterial   70.4     2.6 5.7E-05   29.4   1.4   30   25-54     29-67  (92)
 64 PF11781 RRN7:  RNA polymerase   69.9     2.8 6.1E-05   24.2   1.2   30   25-54      2-34  (36)
 65 PF13445 zf-RING_UBOX:  RING-ty  69.7     1.3 2.8E-05   26.6  -0.2   31   32-63      1-31  (43)
 66 PF03107 C1_2:  C1 domain;  Int  69.5     4.3 9.4E-05   22.2   1.9   29   31-60      2-30  (30)
 67 TIGR00100 hypA hydrogenase nic  68.9     2.4 5.2E-05   30.7   1.0   24   30-53     71-94  (115)
 68 PF08271 TF_Zn_Ribbon:  TFIIB z  67.8     3.4 7.3E-05   24.4   1.3   25   31-55      2-29  (43)
 69 KOG1829|consensus               66.8     3.6 7.9E-05   37.8   1.9   63   30-92    341-410 (580)
 70 TIGR01562 FdhE formate dehydro  66.3     6.1 0.00013   33.5   3.0   66   26-92    181-269 (305)
 71 KOG0317|consensus               65.7     1.3 2.8E-05   37.2  -1.1   46   29-86    239-284 (293)
 72 PF02591 DUF164:  Putative zinc  65.2     3.9 8.5E-05   25.5   1.3   28   27-54     20-55  (56)
 73 PF01155 HypA:  Hydrogenase exp  64.4     2.2 4.8E-05   30.7   0.0   24   30-53     71-94  (113)
 74 smart00659 RPOLCX RNA polymera  64.3     3.9 8.5E-05   24.7   1.1   23   31-53      4-27  (44)
 75 KOG2462|consensus               64.2       3 6.6E-05   34.9   0.8   12   75-86    243-254 (279)
 76 PRK14559 putative protein seri  64.2     4.2   9E-05   37.9   1.8   30   29-62     15-50  (645)
 77 PRK00432 30S ribosomal protein  64.0     4.6  0.0001   25.0   1.4   26   30-55     21-47  (50)
 78 PF06221 zf-C2HC5:  Putative zi  63.6     2.6 5.6E-05   27.1   0.2   18   41-58     14-31  (57)
 79 smart00834 CxxC_CXXC_SSSS Puta  63.5     3.6 7.7E-05   23.6   0.8   13   31-43      7-19  (41)
 80 PF10367 Vps39_2:  Vacuolar sor  63.1     6.1 0.00013   27.1   2.1   31   29-61     78-108 (109)
 81 COG1996 RPC10 DNA-directed RNA  63.0     3.5 7.6E-05   25.7   0.7   23   31-53      8-32  (49)
 82 COG1439 Predicted nucleic acid  61.5     3.8 8.3E-05   32.1   0.9   21   31-53    141-161 (177)
 83 COG5151 SSL1 RNA polymerase II  60.6     3.5 7.5E-05   35.4   0.5   34   29-62    362-405 (421)
 84 PF00097 zf-C3HC4:  Zinc finger  60.2     2.7 5.8E-05   24.1  -0.1   30   32-64      1-30  (41)
 85 PRK00564 hypA hydrogenase nick  59.7     4.5 9.8E-05   29.3   1.0   24   30-53     72-96  (117)
 86 COG0675 Transposase and inacti  59.5     5.5 0.00012   32.4   1.5   24   29-55    309-332 (364)
 87 PRK12380 hydrogenase nickel in  59.4     4.5 9.9E-05   29.1   0.9   24   30-53     71-94  (113)
 88 PF14353 CpXC:  CpXC protein     59.4     4.8  0.0001   29.2   1.1   11   45-55     38-48  (128)
 89 KOG1356|consensus               59.3     4.8  0.0001   38.5   1.2   46   17-64    212-262 (889)
 90 PF01529 zf-DHHC:  DHHC palmito  59.1     4.7  0.0001   30.2   1.0   24   30-55     49-72  (174)
 91 PF09889 DUF2116:  Uncharacteri  58.8     5.7 0.00012   25.6   1.2   27   45-87      3-30  (59)
 92 PRK12496 hypothetical protein;  58.6     5.8 0.00013   30.5   1.4   13   43-55    125-137 (164)
 93 cd02341 ZZ_ZZZ3 Zinc finger, Z  58.2     4.4 9.5E-05   25.0   0.6   31   31-62      2-35  (48)
 94 PHA02926 zinc finger-like prot  57.8     1.6 3.5E-05   35.6  -1.8   57   29-87    170-231 (242)
 95 PF09538 FYDLN_acid:  Protein o  57.6     5.3 0.00011   28.8   1.0   32   42-86      6-37  (108)
 96 PF04438 zf-HIT:  HIT zinc fing  57.5     6.1 0.00013   21.9   1.0   22   31-57      4-25  (30)
 97 PF09723 Zn-ribbon_8:  Zinc rib  57.2       5 0.00011   23.7   0.7   12   31-42      7-18  (42)
 98 COG5574 PEX10 RING-finger-cont  57.0     2.5 5.5E-05   35.1  -0.8   48   29-86    215-262 (271)
 99 KOG2884|consensus               56.4     6.7 0.00015   32.1   1.5   22  133-154   212-233 (259)
100 PF09947 DUF2180:  Uncharacteri  55.9     6.6 0.00014   26.1   1.1   41   46-86     17-67  (68)
101 cd02340 ZZ_NBR1_like Zinc fing  54.9     6.1 0.00013   23.6   0.8   30   31-62      2-32  (43)
102 PF15135 UPF0515:  Uncharacteri  54.9     7.5 0.00016   32.3   1.5   30   28-57    131-167 (278)
103 PF03604 DNA_RNApol_7kD:  DNA d  54.6     7.8 0.00017   21.9   1.2   23   31-53      2-25  (32)
104 COG1773 Rubredoxin [Energy pro  54.1     5.8 0.00013   25.3   0.6   13   44-56      2-14  (55)
105 PRK03824 hypA hydrogenase nick  54.0     6.4 0.00014   29.3   1.0   12   31-42     72-83  (135)
106 COG4855 Uncharacterized protei  53.6     2.7 5.8E-05   28.0  -1.0   64   24-87      2-75  (76)
107 PF09297 zf-NADH-PPase:  NADH p  53.2     6.4 0.00014   21.8   0.6   25   54-82      4-28  (32)
108 KOG3576|consensus               53.0     3.8 8.3E-05   33.2  -0.4   53   30-82    146-219 (267)
109 PRK14873 primosome assembly pr  51.8     8.6 0.00019   36.0   1.6   40   31-70    394-439 (665)
110 TIGR02300 FYDLN_acid conserved  51.8     7.7 0.00017   28.9   1.1   31   42-85      6-36  (129)
111 smart00531 TFIIE Transcription  51.4     7.9 0.00017   29.0   1.1   25   31-55    101-133 (147)
112 COG3357 Predicted transcriptio  51.2     7.7 0.00017   27.3   0.9   15   41-55     54-68  (97)
113 smart00291 ZnF_ZZ Zinc-binding  51.1     7.2 0.00015   23.2   0.7   21   30-52      5-25  (44)
114 PF01428 zf-AN1:  AN1-like Zinc  50.7     8.5 0.00018   22.8   1.0   16   45-60     13-28  (43)
115 KOG3362|consensus               50.5       8 0.00017   29.5   1.0   31   23-58    111-142 (156)
116 cd02249 ZZ Zinc finger, ZZ typ  50.3     6.9 0.00015   23.4   0.5   30   31-62      2-32  (46)
117 KOG2462|consensus               50.2       6 0.00013   33.1   0.3   26   30-55    188-225 (279)
118 COG1645 Uncharacterized Zn-fin  50.0     8.6 0.00019   28.8   1.1   25   29-61     28-52  (131)
119 TIGR01384 TFS_arch transcripti  49.8     9.4  0.0002   26.6   1.2   24   31-54      2-25  (104)
120 PF04981 NMD3:  NMD3 family ;    49.7     7.7 0.00017   31.3   0.9   28   30-57     14-47  (236)
121 PF10013 DUF2256:  Uncharacteri  49.6     6.9 0.00015   23.6   0.4   16   28-43      7-22  (42)
122 PF09845 DUF2072:  Zn-ribbon co  49.6     7.6 0.00016   29.0   0.7   24   30-53      2-27  (131)
123 PRK03681 hypA hydrogenase nick  49.5     8.2 0.00018   27.8   0.9   24   30-53     71-95  (114)
124 KOG1311|consensus               49.3       8 0.00017   32.0   0.9   24   30-55    114-137 (299)
125 PF10170 C6_DPF:  Cysteine-rich  49.1     9.7 0.00021   27.0   1.2   35   42-86     46-82  (97)
126 PF13920 zf-C3HC4_3:  Zinc fing  48.4       1 2.2E-05   27.3  -3.5   44   30-85      3-47  (50)
127 PRK11595 DNA utilization prote  48.2     4.6  0.0001   32.3  -0.7   31   30-62     21-57  (227)
128 PF15227 zf-C3HC4_4:  zinc fing  47.9     4.4 9.6E-05   23.9  -0.6   16   49-64     14-29  (42)
129 TIGR00595 priA primosomal prot  47.6      13 0.00027   33.5   2.0   39   31-69    224-269 (505)
130 PF15616 TerY-C:  TerY-C metal   47.6     9.8 0.00021   28.4   1.1   23   30-57     78-100 (131)
131 PRK04023 DNA polymerase II lar  47.4      12 0.00027   36.7   1.9   30   29-62    626-660 (1121)
132 PRK06266 transcription initiat  47.4     8.1 0.00018   30.1   0.6   25   31-55    119-146 (178)
133 PF04277 OAD_gamma:  Oxaloaceta  47.1      29 0.00064   22.7   3.3   19  136-154    61-79  (79)
134 PHA02942 putative transposase;  47.1      15 0.00033   31.9   2.4   28   28-55    324-352 (383)
135 PF01286 XPA_N:  XPA protein N-  47.0     8.2 0.00018   22.2   0.5    8   75-82     24-31  (34)
136 KOG2935|consensus               47.0      16 0.00034   30.5   2.3   17  135-151   217-233 (315)
137 PF10263 SprT-like:  SprT-like   46.8      10 0.00022   28.0   1.1   25   31-55    125-153 (157)
138 KOG3795|consensus               46.4     8.8 0.00019   30.4   0.7   24   38-61      8-34  (230)
139 PF02150 RNA_POL_M_15KD:  RNA p  46.0      10 0.00022   21.6   0.8    7   55-61      3-9   (35)
140 PHA02929 N1R/p28-like protein;  45.6     2.7   6E-05   34.4  -2.3   51   29-87    174-228 (238)
141 PRK04179 rpl37e 50S ribosomal   45.6      10 0.00022   24.8   0.8   22   31-53     19-40  (62)
142 TIGR00373 conserved hypothetic  44.9      11 0.00023   28.8   0.9   25   31-55    111-138 (158)
143 cd02342 ZZ_UBA_plant Zinc fing  44.7      10 0.00022   23.0   0.6   29   31-60      2-31  (43)
144 PF14835 zf-RING_6:  zf-RING of  44.1      15 0.00032   24.2   1.4   29   31-63      9-38  (65)
145 smart00184 RING Ring finger. E  44.1     5.6 0.00012   21.3  -0.6   15   49-63     14-28  (39)
146 PF13248 zf-ribbon_3:  zinc-rib  44.0      13 0.00028   19.6   0.9    6   32-37      5-10  (26)
147 PF09332 Mcm10:  Mcm10 replicat  43.9     9.3  0.0002   33.0   0.5   10   74-83    302-311 (344)
148 PHA00732 hypothetical protein   42.5      18  0.0004   24.4   1.7   10   31-40      3-12  (79)
149 PF02148 zf-UBP:  Zn-finger in   41.8      14 0.00031   23.4   1.1   24   32-58      1-24  (63)
150 PF00569 ZZ:  Zinc finger, ZZ t  41.7     7.1 0.00015   23.5  -0.4   22   30-52      5-26  (46)
151 COG1198 PriA Primosomal protei  41.3      17 0.00036   34.6   1.8   34   31-64    446-486 (730)
152 PTZ00218 40S ribosomal protein  41.2      20 0.00043   22.8   1.6   22   62-87     25-46  (54)
153 PF06677 Auto_anti-p27:  Sjogre  41.2      16 0.00034   21.8   1.1   11   29-39     17-27  (41)
154 cd02345 ZZ_dah Zinc finger, ZZ  41.0      12 0.00026   22.9   0.6   21   31-53      2-23  (49)
155 smart00661 RPOL9 RNA polymeras  40.7      23  0.0005   21.2   1.8   10   74-83     19-28  (52)
156 KOG1818|consensus               40.5     5.7 0.00012   36.9  -1.3   55   30-85     55-110 (634)
157 PF13465 zf-H2C2_2:  Zinc-finge  40.5      14  0.0003   19.4   0.7   13   43-55     12-24  (26)
158 PF13912 zf-C2H2_6:  C2H2-type   40.2     6.9 0.00015   20.2  -0.5   11   31-41      3-13  (27)
159 KOG2593|consensus               40.1      13 0.00028   33.0   0.8   33   30-62    129-170 (436)
160 PRK12496 hypothetical protein;  40.0      14 0.00031   28.3   1.0   25   30-54    128-152 (164)
161 PF00301 Rubredoxin:  Rubredoxi  39.7      14  0.0003   22.7   0.7   13   45-57      1-13  (47)
162 PF04216 FdhE:  Protein involve  39.6      11 0.00023   31.3   0.2   64   25-89    169-252 (290)
163 PF05458 Siva:  Cd27 binding pr  39.3      13 0.00028   29.0   0.7   29   48-81    142-170 (175)
164 COG1579 Zn-ribbon protein, pos  39.2      12 0.00026   30.7   0.4   28   28-55    196-231 (239)
165 KOG1813|consensus               39.0      24 0.00053   29.9   2.3   30   30-63    242-271 (313)
166 PF01927 Mut7-C:  Mut7-C RNAse   38.7      18 0.00039   27.0   1.3   10   30-39     92-101 (147)
167 TIGR00599 rad18 DNA repair pro  38.5      11 0.00024   33.2   0.1   31   29-63     26-56  (397)
168 PF13453 zf-TFIIB:  Transcripti  37.9      20 0.00044   20.8   1.2    9   46-54     20-28  (41)
169 COG1998 RPS31 Ribosomal protei  37.8      18 0.00038   22.7   0.9   24   30-53     20-45  (51)
170 PF12172 DUF35_N:  Rubredoxin-l  37.7      18  0.0004   20.4   1.0    8   47-54     13-20  (37)
171 COG1545 Predicted nucleic-acid  36.6      13 0.00028   27.8   0.3   10   46-55     30-39  (140)
172 PRK04136 rpl40e 50S ribosomal   36.4      20 0.00043   22.2   1.0   22   30-53     15-36  (48)
173 COG1779 C4-type Zn-finger prot  36.3      32 0.00069   27.6   2.4   46   31-76     16-66  (201)
174 PRK05580 primosome assembly pr  36.2      22 0.00048   33.2   1.8   34   31-64    392-432 (679)
175 KOG1314|consensus               36.0     8.8 0.00019   33.4  -0.8   33   20-54     74-114 (414)
176 KOG2932|consensus               35.6      14 0.00031   31.7   0.4   45   30-87     91-135 (389)
177 PRK04351 hypothetical protein;  35.1      21 0.00045   27.1   1.2    9   31-39    114-122 (149)
178 PF05191 ADK_lid:  Adenylate ki  34.8      20 0.00042   20.7   0.8    9   47-55      3-11  (36)
179 TIGR00311 aIF-2beta translatio  34.8      20 0.00043   26.8   1.0   24   31-54     99-127 (133)
180 PF00096 zf-C2H2:  Zinc finger,  34.7      18 0.00038   17.8   0.5    9   47-55      2-10  (23)
181 PF07649 C1_3:  C1-like domain;  34.6       9  0.0002   20.8  -0.7   27   31-58      2-28  (30)
182 PF13913 zf-C2HC_2:  zinc-finge  34.5     8.9 0.00019   20.2  -0.7   11   31-41      4-14  (25)
183 KOG3896|consensus               34.5      19 0.00041   31.3   1.0   28   35-63     15-42  (449)
184 PF13005 zf-IS66:  zinc-finger   34.2      26 0.00057   20.6   1.3   11   30-40      3-13  (47)
185 PF07754 DUF1610:  Domain of un  34.1      28 0.00061   18.4   1.2    9   45-53     16-24  (24)
186 cd02339 ZZ_Mind_bomb Zinc fing  33.9      21 0.00045   21.6   0.8   30   31-61      2-32  (45)
187 PF11023 DUF2614:  Protein of u  33.9      17 0.00036   26.6   0.4   24   31-54     71-94  (114)
188 KOG2935|consensus               33.8      27 0.00059   29.2   1.7   19  133-151   233-251 (315)
189 COG5148 RPN10 26S proteasome r  33.7      24 0.00053   28.3   1.4   17  137-153   207-223 (243)
190 smart00731 SprT SprT homologue  33.5      27 0.00059   25.9   1.6   25   31-55    114-143 (146)
191 PRK14559 putative protein seri  33.1      34 0.00074   32.0   2.4   47   31-87      3-53  (645)
192 PRK06260 threonine synthase; V  32.6      25 0.00054   30.4   1.4   24   31-54      5-28  (397)
193 COG1327 Predicted transcriptio  32.4      23 0.00049   27.2   1.0   15   41-55     24-38  (156)
194 PRK11788 tetratricopeptide rep  32.4      32  0.0007   28.5   2.0   26   46-71    355-386 (389)
195 COG2126 RPL37A Ribosomal prote  32.2      19 0.00042   23.2   0.5    6   48-53     19-24  (61)
196 PHA00733 hypothetical protein   32.0      25 0.00054   25.8   1.1   10   31-40     75-84  (128)
197 KOG3183|consensus               31.8      18  0.0004   29.7   0.4   19  133-151   200-218 (250)
198 COG1997 RPL43A Ribosomal prote  31.6      31 0.00068   24.1   1.5   27   30-57     36-65  (89)
199 PF02945 Endonuclease_7:  Recom  31.4      16 0.00034   25.0  -0.0   26   29-54     22-50  (81)
200 cd00202 ZnF_GATA Zinc finger D  31.4      42 0.00092   20.9   2.0   33   56-88      2-34  (54)
201 PF05443 ROS_MUCR:  ROS/MUCR tr  31.2      14  0.0003   27.6  -0.3   16   30-46     73-88  (132)
202 KOG2807|consensus               30.9      31 0.00068   29.8   1.7   44   30-82    331-374 (378)
203 PRK05978 hypothetical protein;  30.9      27 0.00058   26.6   1.2   34   22-55     21-62  (148)
204 cd02335 ZZ_ADA2 Zinc finger, Z  30.4      57  0.0012   19.7   2.4   31   31-62      2-33  (49)
205 COG5152 Uncharacterized conser  30.3      11 0.00024   30.4  -1.1   29   31-63    198-226 (259)
206 PRK07591 threonine synthase; V  30.0      29 0.00063   30.4   1.4   25   30-55     19-43  (421)
207 PRK03988 translation initiatio  30.0      26 0.00057   26.2   1.0   24   31-54    104-132 (138)
208 smart00504 Ubox Modified RING   30.0      22 0.00048   21.8   0.5   12   50-61     18-29  (63)
209 PF10497 zf-4CXXC_R1:  Zinc-fin  29.9      18 0.00039   25.8   0.1   55   29-85      7-71  (105)
210 COG4338 Uncharacterized protei  29.7     8.6 0.00019   24.0  -1.4   18   27-44     10-27  (54)
211 PRK14890 putative Zn-ribbon RN  29.0      33 0.00071   22.2   1.1   25   30-54      8-34  (59)
212 KOG4323|consensus               28.2      27 0.00059   31.4   0.9   58   30-87    169-227 (464)
213 smart00653 eIF2B_5 domain pres  28.0      30 0.00064   24.9   0.9   23   31-53     82-109 (110)
214 COG3364 Zn-ribbon containing p  28.0      22 0.00048   25.6   0.3   11   45-55      2-12  (112)
215 cd07153 Fur_like Ferric uptake  28.0      27 0.00058   24.3   0.7   15   46-60     74-88  (116)
216 PF14471 DUF4428:  Domain of un  27.9      44 0.00095   20.7   1.6   12   76-87     21-32  (51)
217 PRK08359 transcription factor;  27.9 2.2E+02  0.0047   22.2   5.8   15   73-87     28-42  (176)
218 KOG1734|consensus               27.6      21 0.00046   30.1   0.2   54   28-87    223-282 (328)
219 TIGR01195 oadG_fam sodium pump  27.1      91   0.002   21.1   3.2   20  135-154    61-80  (82)
220 cd02338 ZZ_PCMF_like Zinc fing  27.0      61  0.0013   19.6   2.1   20   31-52      2-22  (49)
221 KOG0006|consensus               27.0      17 0.00036   31.5  -0.6   33   30-62    316-353 (446)
222 cd02336 ZZ_RSC8 Zinc finger, Z  26.9      29 0.00063   21.0   0.6   10   75-84     23-32  (45)
223 PF09862 DUF2089:  Protein of u  26.8      37 0.00081   24.7   1.3   27   32-60      1-27  (113)
224 cd04476 RPA1_DBD_C RPA1_DBD_C:  26.6      32  0.0007   25.8   1.0   57   30-87     35-95  (166)
225 PF06397 Desulfoferrod_N:  Desu  26.6      29 0.00062   20.1   0.5   11   45-55      6-16  (36)
226 cd00350 rubredoxin_like Rubred  26.5      40 0.00086   18.7   1.1   10   46-55      2-11  (33)
227 PF11238 DUF3039:  Protein of u  26.2      60  0.0013   20.9   2.0   15   73-87     42-56  (58)
228 PF00130 C1_1:  Phorbol esters/  26.2      54  0.0012   19.6   1.8   33   30-62     12-45  (53)
229 PF01873 eIF-5_eIF-2B:  Domain   26.1      34 0.00075   25.1   1.0   24   31-54     95-123 (125)
230 COG0498 ThrC Threonine synthas  26.1      27 0.00058   30.9   0.5   26   30-55      6-31  (411)
231 COG3791 Uncharacterized conser  25.9      30 0.00065   25.4   0.6   10   31-40     28-37  (133)
232 PF03966 Trm112p:  Trm112p-like  25.8      40 0.00087   21.7   1.2   15   41-55     49-63  (68)
233 cd00730 rubredoxin Rubredoxin;  25.8      34 0.00073   21.2   0.8   12   45-56      1-12  (50)
234 PF10164 DUF2367:  Uncharacteri  25.7      28 0.00061   24.7   0.4   14   42-55     85-98  (98)
235 PRK09678 DNA-binding transcrip  25.7      46 0.00099   22.3   1.4   14   42-55     24-39  (72)
236 PF13894 zf-C2H2_4:  C2H2-type   25.7      34 0.00073   16.3   0.7    9   47-55      2-10  (24)
237 TIGR00244 transcriptional regu  25.6      39 0.00085   25.7   1.2   14   42-55     25-38  (147)
238 cd00021 BBOX B-Box-type zinc f  25.6      26 0.00056   19.4   0.2   18   45-62     12-29  (39)
239 PRK08197 threonine synthase; V  25.1      41 0.00088   29.1   1.4   24   30-54      8-31  (394)
240 PF01667 Ribosomal_S27e:  Ribos  25.1      43 0.00093   21.3   1.2   27   31-57      9-38  (55)
241 PLN02400 cellulose synthase     24.9      42  0.0009   33.3   1.6   53   29-88     36-91  (1085)
242 PRK12495 hypothetical protein;  24.9      39 0.00086   27.5   1.2   11   30-40     43-53  (226)
243 PF12251 zf-SNAP50_C:  snRNA-ac  24.8      36 0.00078   26.9   0.9   39   44-87    138-177 (196)
244 COG5273 Uncharacterized protei  24.7      26 0.00057   29.6   0.2   23   30-54    110-132 (309)
245 PRK12336 translation initiatio  24.7      36 0.00079   26.9   1.0   25   31-55    100-129 (201)
246 PRK08329 threonine synthase; V  24.6      45 0.00097   28.3   1.6   23   31-55      3-25  (347)
247 KOG2272|consensus               24.2      35 0.00076   28.6   0.8   33   25-57    216-266 (332)
248 PF12171 zf-C2H2_jaz:  Zinc-fin  24.1      41 0.00088   17.4   0.8   10   46-55      2-11  (27)
249 COG1499 NMD3 NMD protein affec  24.1      32 0.00069   29.8   0.6   30   54-83     22-51  (355)
250 KOG1315|consensus               24.1      25 0.00054   29.9  -0.1   22   31-54    111-132 (307)
251 cd00729 rubredoxin_SM Rubredox  24.0      45 0.00098   18.7   1.0   10   46-55      3-12  (34)
252 PF03833 PolC_DP2:  DNA polymer  24.0      26 0.00056   33.9   0.0    7   31-37    657-663 (900)
253 PF06689 zf-C4_ClpX:  ClpX C4-t  23.7      34 0.00073   20.1   0.5   15   74-88     23-37  (41)
254 KOG2177|consensus               23.7      16 0.00035   28.4  -1.2   34   28-65     12-45  (386)
255 COG4530 Uncharacterized protei  23.6      41 0.00089   24.6   1.0   26   30-55     10-36  (129)
256 PF14446 Prok-RING_1:  Prokaryo  23.5      46   0.001   21.1   1.1   25   30-54      6-30  (54)
257 KOG4317|consensus               23.4      39 0.00085   29.1   1.0   23   31-57      9-31  (383)
258 PRK00762 hypA hydrogenase nick  23.4      40 0.00086   24.6   0.9   11   30-41     71-81  (124)
259 PF14445 Prok-RING_2:  Prokaryo  23.1      15 0.00032   23.2  -1.2   45   30-86      8-52  (57)
260 PF12647 RNHCP:  RNHCP domain;   23.0      48   0.001   23.3   1.2   24   30-53      5-32  (92)
261 PF10892 DUF2688:  Protein of u  22.9      27 0.00059   22.4  -0.1   11   45-55     10-20  (60)
262 KOG0804|consensus               22.9      30 0.00066   31.0   0.2   28   28-59    227-254 (493)
263 PRK14892 putative transcriptio  22.6      60  0.0013   23.0   1.7   14   50-63     39-52  (99)
264 PF00643 zf-B_box:  B-box zinc   22.5      19 0.00042   20.6  -0.8   28   31-62      5-32  (42)
265 PRK08351 DNA-directed RNA poly  22.5      42  0.0009   21.8   0.7    9   47-55      5-13  (61)
266 PRK06450 threonine synthase; V  22.3      51  0.0011   28.0   1.5   23   31-54      5-27  (338)
267 KOG2463|consensus               22.0      35 0.00076   29.5   0.4   23   31-54    244-266 (376)
268 COG0353 RecR Recombinational D  22.0      56  0.0012   26.1   1.5   21   43-63     52-76  (198)
269 KOG1074|consensus               21.9      55  0.0012   31.7   1.7   52   30-82    606-669 (958)
270 smart00290 ZnF_UBP Ubiquitin C  21.8      57  0.0012   19.2   1.3   24   32-59      2-25  (50)
271 TIGR03826 YvyF flagellar opero  21.8      35 0.00075   25.6   0.3   26   46-86      4-29  (137)
272 PRK06393 rpoE DNA-directed RNA  21.8      41  0.0009   22.0   0.6   16   47-62      7-26  (64)
273 PF14279 HNH_5:  HNH endonuclea  21.7      83  0.0018   20.8   2.1   11   77-87     32-42  (71)
274 KOG2879|consensus               21.4      50  0.0011   27.9   1.2   32   29-63    239-270 (298)
275 PF05225 HTH_psq:  helix-turn-h  21.4      71  0.0015   19.0   1.6    9  137-145     2-10  (45)
276 KOG1812|consensus               21.4      42 0.00091   29.3   0.8   32   31-63    308-341 (384)
277 PRK14714 DNA polymerase II lar  21.3      57  0.0012   33.0   1.7   48   30-86    668-720 (1337)
278 PF11682 DUF3279:  Protein of u  21.1      66  0.0014   23.9   1.7   46    5-53     67-118 (128)
279 cd02344 ZZ_HERC2 Zinc finger,   21.0      51  0.0011   19.9   0.9   31   31-62      2-33  (45)
280 PLN02569 threonine synthase     20.9      55  0.0012   29.4   1.4   26   29-55     49-74  (484)
281 PRK13130 H/ACA RNA-protein com  20.8      74  0.0016   20.2   1.6   22   30-55      6-27  (56)
282 PLN02189 cellulose synthase     20.8      57  0.0012   32.3   1.6   53   28-87     33-88  (1040)
283 PRK12286 rpmF 50S ribosomal pr  20.7      54  0.0012   20.8   1.0   20   30-52     28-47  (57)
284 cd02337 ZZ_CBP Zinc finger, ZZ  20.5      37 0.00081   20.0   0.2   28   31-61      2-30  (41)
285 PRK05638 threonine synthase; V  20.5      55  0.0012   28.8   1.3   23   31-55      3-25  (442)
286 COG4098 comFA Superfamily II D  20.3      41 0.00089   29.6   0.5   10   52-61     59-68  (441)
287 PF02132 RecR:  RecR protein;    20.3      17 0.00038   21.3  -1.3   12   43-54     15-26  (41)
288 PTZ00073 60S ribosomal protein  20.3      50  0.0011   23.1   0.8   22   31-53     18-39  (91)

No 1  
>KOG1818|consensus
Probab=100.00  E-value=2e-34  Score=256.47  Aligned_cols=136  Identities=56%  Similarity=0.926  Sum_probs=122.9

Q ss_pred             CccCCCcCCCCCcccccccCCCCCCcccCCCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChh
Q psy509            1 MKAEGFQFPVLKESDAMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCED   80 (158)
Q Consensus         1 l~~~g~~fp~~~~s~~~~~~~~~p~W~~~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~   80 (158)
                      ||.+||+||+.++.|+||+++++|.|+|...|..|.++|++|+||||||+||+|||..|+++.++||.+|+.++||||+.
T Consensus       137 lk~~g~~Fpe~~e~d~mf~~~~~pdW~D~~~C~rCr~~F~~~~rkHHCr~CG~vFC~qcss~s~~lP~~Gi~~~VRVCd~  216 (634)
T KOG1818|consen  137 LKGGGHVFPELDENDAMFDAETAPDWIDSEECLRCRVKFGLTNRKHHCRNCGQVFCGQCSSKSLTLPKLGIEKPVRVCDS  216 (634)
T ss_pred             HhcCCccccccccchhhhcccCCcccccccccceeeeeeeeccccccccccchhhccCccccccCcccccccccceehhh
Confidence            78999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hHHHHhcccCCCCCCCCCCCCCCCCchhhhccccCCCCCCCCCCCCCCCchhhhcchHHHHHHHHhcHHHHhhc
Q psy509           81 CHEKFTNYYRSPTPGAAGSKSEEMLPAEYLNSSLALQPQVPPPKATGGKTEEELKEEEELQLALALSQSEAESN  154 (158)
Q Consensus        81 C~~~l~~~~~~~~~~~~~~~~~~~l~~~~~~s~~~~~~~~~~~~a~~~~~~~~~~eeedl~~aia~Sl~e~e~~  154 (158)
                      ||+.+.+.    +.+.         .+.++++...++...+.+     .....++|+|||++||+||++|+++.
T Consensus       217 C~E~l~~~----s~~~---------~~~~~~s~~s~~~~~k~r-----~~~~~~keeed~~lAi~lSq~E~~~~  272 (634)
T KOG1818|consen  217 CYELLTRA----SVGE---------KAAALNSKLSPQKTKKDR-----AKALEEKEEEDLSLAIALSQSEAEAA  272 (634)
T ss_pred             hHHHhhhc----ccch---------hhhhhhcccchhhhcccc-----cccccchhhHHHHHHHHHhHHHHHHh
Confidence            99999872    1111         267778888777777666     56778899999999999999999986


No 2  
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=99.82  E-value=2.3e-21  Score=128.98  Aligned_cols=63  Identities=44%  Similarity=1.043  Sum_probs=45.9

Q ss_pred             CCccc---CCCccccCccccccccccccccccceecCCCCCCccccC--CCCCCCceeeChhhHHHHh
Q psy509           24 PEWMD---GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLP--KFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        24 p~W~~---~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp--~~~~~~~~RVC~~C~~~l~   86 (158)
                      |.|++   ...|+.|+++|++|+||||||.||.+||..|+.+++.++  ..+...++|||+.|+..|+
T Consensus         1 ~~W~~d~~~~~C~~C~~~F~~~~rrhhCr~CG~~vC~~Cs~~~~~~~~~~~~~~~~~RvC~~C~~~~~   68 (69)
T PF01363_consen    1 PHWVPDSEASNCMICGKKFSLFRRRHHCRNCGRVVCSSCSSQRIPLPTPSSGSGEPVRVCDSCYSKLQ   68 (69)
T ss_dssp             --SSSGGG-SB-TTT--B-BSSS-EEE-TTT--EEECCCS-EEEEET--GGTESEEEEE-HHHHHHHH
T ss_pred             CCcCCCCCCCcCcCcCCcCCCceeeEccCCCCCEECCchhCCEEcccccccCCCCcCEECHHHHHHhc
Confidence            78997   479999999999999999999999999999999998887  5666799999999999886


No 3  
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=99.62  E-value=1.6e-16  Score=101.68  Aligned_cols=55  Identities=47%  Similarity=1.112  Sum_probs=50.7

Q ss_pred             CCCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHH
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHE   83 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~   83 (158)
                      ...|..|++.|+++.|+|||+.||.+||..|+.+...++..+..+++|||..||.
T Consensus         2 ~~~C~~C~~~F~~~~rk~~Cr~Cg~~~C~~C~~~~~~~~~~~~~~~~rvC~~C~~   56 (57)
T cd00065           2 ASSCMGCGKPFTLTRRRHHCRNCGRIFCSKCSSNRIPLPSMGGGKPVRVCDSCYE   56 (57)
T ss_pred             cCcCcccCccccCCccccccCcCcCCcChHHcCCeeecCcccCCCccEeChHHhC
Confidence            4679999999999999999999999999999999998887566799999999985


No 5  
>KOG1729|consensus
Probab=99.60  E-value=2.7e-16  Score=130.63  Aligned_cols=69  Identities=36%  Similarity=0.890  Sum_probs=61.6

Q ss_pred             ccCCCCCCcccC---CCccccCc-cccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           18 FSADTAPEWMDG---DTCHRCRT-TFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        18 ~~~~~~p~W~~~---~~C~~C~~-~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      .....++.|+|+   ..|+.|++ .|+++.||||||+||.|||..|+.++..+|... .+++|||+.||..+..
T Consensus       154 ~~~~~~~~W~PD~ea~~C~~C~~~~Ftl~~RRHHCR~CG~ivC~~Cs~n~~~l~~~~-~k~~rvC~~CF~el~~  226 (288)
T KOG1729|consen  154 PSNNSAAVWLPDSEATECMVCGCTEFTLSERRHHCRNCGDIVCAPCSRNRFLLPNLS-TKPIRVCDICFEELEK  226 (288)
T ss_pred             CCCCcCCcccCcccceecccCCCccccHHHHHHHHHhcchHhhhhhhcCcccccccC-CCCceecHHHHHHHhc
Confidence            345568999985   68999999 999999999999999999999999998888665 7899999999999975


No 6  
>KOG1819|consensus
Probab=99.58  E-value=3.2e-16  Score=137.41  Aligned_cols=63  Identities=40%  Similarity=1.099  Sum_probs=58.5

Q ss_pred             CCCCcccC---CCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeCh-----hhHHH
Q psy509           22 TAPEWMDG---DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCE-----DCHEK   84 (158)
Q Consensus        22 ~~p~W~~~---~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~-----~C~~~   84 (158)
                      .+|.|+++   ..|+.|..+|+.|+||||||+||.|||+.|+...+++|.+|+.+.+|||.     .||..
T Consensus       891 sppawipd~~a~~cmacq~pf~afrrrhhcrncggifcg~cs~asapip~~gl~ka~rvcrpqsnldc~~r  961 (990)
T KOG1819|consen  891 SPPAWIPDEDAEQCMACQMPFNAFRRRHHCRNCGGIFCGKCSCASAPIPEHGLDKAPRVCRPQSNLDCLTR  961 (990)
T ss_pred             CCcccCCCCcchhhhhccCcHHHHHHhhhhcccCceeecccccCCCCCcccccccCceecCCcccccceee
Confidence            48899974   68999999999999999999999999999999999999999999999999     77764


No 7  
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=99.54  E-value=3.3e-15  Score=135.79  Aligned_cols=71  Identities=31%  Similarity=0.775  Sum_probs=54.1

Q ss_pred             cccCCCCCCcccC----CCccccCcccccc-----ccccccccccceecCCCCCCccccC-----CCCC---CCceeeCh
Q psy509           17 MFSADTAPEWMDG----DTCHRCRTTFSLV-----QRKHHCRACGQVFCQLCSSKSTSLP-----KFGI---EKEVRVCE   79 (158)
Q Consensus        17 ~~~~~~~p~W~~~----~~C~~C~~~F~~~-----~RkhhCr~CG~vfC~~Cs~~~~~lp-----~~~~---~~~~RVC~   79 (158)
                      |-.....|.|+++    +.|+.|++.|+++     .||||||+||++||..||++++.+|     ..+.   ..+.|||+
T Consensus       444 l~k~LhAPvWqpDDEaSdtC~~C~kkFfSlsK~L~~RKHHCRkCGrVFC~~CSSnRs~yp~aKLpKPgsseE~ppRRVCD  523 (1374)
T PTZ00303        444 LTKLLHNPSWQKDDESSDSCPSCGRAFISLSRPLGTRAHHCRSCGIRLCVFCITKRAHYSFAKLAKPGSSDEAEERLVCD  523 (1374)
T ss_pred             hhhhccCCCCCCCcccCCcccCcCCcccccccccccccccccCCccccCccccCCcccCcccccCCCCCcccccccchhH
Confidence            3334568999963    4699999999864     6999999999999999999876533     2221   23678999


Q ss_pred             hhHHHHhc
Q psy509           80 DCHEKFTN   87 (158)
Q Consensus        80 ~C~~~l~~   87 (158)
                      .||+.+..
T Consensus       524 ~CYdq~En  531 (1374)
T PTZ00303        524 TCYKEYET  531 (1374)
T ss_pred             HHHHHHHh
Confidence            99976654


No 8  
>KOG1842|consensus
Probab=99.05  E-value=1.9e-11  Score=105.76  Aligned_cols=65  Identities=32%  Similarity=0.885  Sum_probs=50.1

Q ss_pred             CCCcccC---CCccccCccccccccccccccccceecCCCCCCcc-------------cc---CC-----C-CCCCceee
Q psy509           23 APEWMDG---DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKST-------------SL---PK-----F-GIEKEVRV   77 (158)
Q Consensus        23 ~p~W~~~---~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~-------------~l---p~-----~-~~~~~~RV   77 (158)
                      -..|.|+   .-|..|+.+|++.+||||||.||.|+|..|+..-.             ..   |.     + ....+.|+
T Consensus       171 vVpW~DDs~V~~CP~Ca~~F~l~rRrHHCRLCG~VmC~~C~k~iSle~a~~ltsss~~dt~~e~~qq~~~lH~~~~~iRl  250 (505)
T KOG1842|consen  171 VVPWLDDSSVQFCPECANSFGLTRRRHHCRLCGRVMCRDCSKFISLEIAIGLTSSSASDTHFEPNQQKDDLHQHPQPIRL  250 (505)
T ss_pred             cccccCCCcccccccccchhhhHHHhhhhhhcchHHHHHHHHhcChHHHHHHhhccCCCCCcCcccCcccccCChhHhHH
Confidence            4579975   47999999999999999999999999999987632             00   00     0 11356899


Q ss_pred             ChhhHHHHhc
Q psy509           78 CEDCHEKFTN   87 (158)
Q Consensus        78 C~~C~~~l~~   87 (158)
                      |..|...|-.
T Consensus       251 C~hCl~~L~~  260 (505)
T KOG1842|consen  251 CMHCLDNLFR  260 (505)
T ss_pred             HHHHHHHHHH
Confidence            9999988754


No 9  
>KOG1409|consensus
Probab=99.03  E-value=7.8e-11  Score=99.54  Aligned_cols=70  Identities=41%  Similarity=0.954  Sum_probs=62.7

Q ss_pred             CCCCCcccCCCccccCccccc-----------cccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhccc
Q psy509           21 DTAPEWMDGDTCHRCRTTFSL-----------VQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTNYY   89 (158)
Q Consensus        21 ~~~p~W~~~~~C~~C~~~F~~-----------~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~~~   89 (158)
                      ...|.|.+++.|..|..+|.+           -.|.||||.||+.||..|++++...|..|+.-.+|+|+.||..+....
T Consensus       274 ~etpewl~s~~cQ~c~qpffwn~~~m~~~k~~glr~h~crkcg~avc~~c~s~~~~~p~mg~e~~vR~~~~c~~~i~~~~  353 (404)
T KOG1409|consen  274 VETPEWLDSDSCQKCNQPFFWNFRQMWDRKQLGLRQHHCRKCGKAVCGKCSSNRSSYPTMGFEFSVRVCDSCYPTIKDEE  353 (404)
T ss_pred             ecCccccccchhhhhCchHHHHHHHHHhhhhhhhhhhhhhhhhhhcCcccccCccccccccceeEEEEecccchhhhcCC
Confidence            458999999999999999952           368899999999999999999999999999999999999999998744


Q ss_pred             C
Q psy509           90 R   90 (158)
Q Consensus        90 ~   90 (158)
                      +
T Consensus       354 ~  354 (404)
T KOG1409|consen  354 R  354 (404)
T ss_pred             C
Confidence            3


No 10 
>KOG1841|consensus
Probab=98.95  E-value=2.2e-10  Score=107.55  Aligned_cols=49  Identities=35%  Similarity=0.998  Sum_probs=43.1

Q ss_pred             cCCCCCCcccC---CCccccCccccccccccccccccceecCCCCCCccccC
Q psy509           19 SADTAPEWMDG---DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLP   67 (158)
Q Consensus        19 ~~~~~p~W~~~---~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp   67 (158)
                      ...+.|.|+++   ..||.|..+|++++||||||+||+|+|+.|++.+..+-
T Consensus       544 lgkkqP~wvpdse~pncm~clqkft~ikrrhhcRacgkVlcgvccnek~~le  595 (1287)
T KOG1841|consen  544 LGKKQPSWVPDSEAPNCMDCLQKFTPIKRRHHCRACGKVLCGVCCNEKSALE  595 (1287)
T ss_pred             cCCCCCccCccccCchHHHHHhhcccccccccchhccceeehhhcchhhhhh
Confidence            35569999985   57889999999999999999999999999999887653


No 11 
>KOG1843|consensus
Probab=98.77  E-value=2.7e-09  Score=91.83  Aligned_cols=66  Identities=21%  Similarity=0.331  Sum_probs=55.5

Q ss_pred             CCCCCcccC---CCccccCcccc-ccccccccccccceecCCCCCCccccC-CCCCCCceeeChhhHHHHh
Q psy509           21 DTAPEWMDG---DTCHRCRTTFS-LVQRKHHCRACGQVFCQLCSSKSTSLP-KFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        21 ~~~p~W~~~---~~C~~C~~~F~-~~~RkhhCr~CG~vfC~~Cs~~~~~lp-~~~~~~~~RVC~~C~~~l~   86 (158)
                      -.+|.|..+   ..|+.|...|+ ++.||||||.|+.+||..|+.....+| ++....+.|||+.|+..+.
T Consensus       149 ~~ap~f~yskskglfagvSvegsaI~erR~anR~~yg~~cra~~ilsg~vp~p~a~d~l~RVldS~~~nl~  219 (473)
T KOG1843|consen  149 GEAPVFLYSKSKGLFAGVSVEGSAIIERREANRKFYGIFCRAKSILSGLVPVPFAADPLQRVLDSCAFNLE  219 (473)
T ss_pred             CcCccccccccccceeeeecccceeeecchhhhhhcCccchhhhhhccCCCCCcccCCHHHHHhhHhhccC
Confidence            358999975   47999999999 678999999999999999998765554 3445688999999999883


No 12 
>KOG1811|consensus
Probab=98.04  E-value=5.6e-07  Score=81.54  Aligned_cols=55  Identities=35%  Similarity=0.778  Sum_probs=48.9

Q ss_pred             Cccc-cCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHH
Q psy509           31 TCHR-CRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKF   85 (158)
Q Consensus        31 ~C~~-C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l   85 (158)
                      -|+. |+..|..|+||||||.||...|..|...+....+-|...|.++|+.|+..-
T Consensus       328 ~~~a~~R~~~kd~~Rk~~~~g~Ga~e~aa~ea~kgiqEd~gse~~Adg~Dq~psvs  383 (1141)
T KOG1811|consen  328 ICMACCREHFKDFNRKHHCRGCGALECAACEAKKGIQEDCGSENPADGCDQCPSVS  383 (1141)
T ss_pred             HHHHHHHHHHHHHHHhhhccccchHHHhHHHHhhhhhhcccccCcccccccccchh
Confidence            5774 678999999999999999999999999988888888789999999999653


No 13 
>KOG4424|consensus
Probab=97.91  E-value=2.7e-06  Score=76.17  Aligned_cols=65  Identities=31%  Similarity=0.618  Sum_probs=53.8

Q ss_pred             CCCccc-CCCccccCcccc-ccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhcc
Q psy509           23 APEWMD-GDTCHRCRTTFS-LVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTNY   88 (158)
Q Consensus        23 ~p~W~~-~~~C~~C~~~F~-~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~~   88 (158)
                      .|.|.. ...|+.|+..|+ ...|||||+.||.++|+.|+.+...+. +......|||..||......
T Consensus       408 ~~r~~~k~~~c~~c~e~~~s~t~~R~~~k~~~~vlc~~cs~~~~~l~-~~~s~ssrv~~~~~~~~~~a  474 (623)
T KOG4424|consen  408 APRRDNKVTSCDSCEETFNSITFRRHRCKAKGAVLCDKCSDFMAKLS-YDNSRSSRVCMDRYLTPSGA  474 (623)
T ss_pred             CcccccccccchhhcCchhhHHHhhhhhhhccceeeccccchhhhhc-ccccchhhhhhhhccCCCCC
Confidence            668843 578999999997 567999999999999999999976654 24467889999999987653


No 14 
>PF02318 FYVE_2:  FYVE-type zinc finger;  InterPro: IPR003315 This entry represents the zinc-binding domain found in rabphilin Rab3A. The small G protein Rab3A plays an important role in the regulation of neurotransmitter release. The crystal structure of the small G protein Rab3A complexed with the effector domain of rabphilin-3A shows that the effector domain of rabphilin-3A contacts Rab3A in two distinct areas. The first interface involves the Rab3A switch I and switch II regions, which are sensitive to the nucleotide-binding state of Rab3A. The second interface consists of a deep pocket in Rab3A that interacts with a SGAWFF structural element of rabphilin-3A. Sequence and structure analysis, and biochemical data suggest that this pocket, or Rab complementarity-determining region (RabCDR), establishes a specific interaction between each Rab protein and its effectors. It has been suggested that RabCDRs could be major determinants of effector specificity during vesicle trafficking and fusion [].; GO: 0008270 zinc ion binding, 0017137 Rab GTPase binding, 0006886 intracellular protein transport; PDB: 2CSZ_A 2ZET_C 1ZBD_B 3BC1_B 2CJS_C 2A20_A.
Probab=97.67  E-value=3.1e-05  Score=56.52  Aligned_cols=53  Identities=23%  Similarity=0.640  Sum_probs=42.5

Q ss_pred             cCCCccccCcccccc-ccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           28 DGDTCHRCRTTFSLV-QRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        28 ~~~~C~~C~~~F~~~-~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      ....|..|+++|+++ ++.+.|..|+..||..|..+.       ...+.-+|..|+....-
T Consensus        53 ~~~~C~~C~~~fg~l~~~~~~C~~C~~~VC~~C~~~~-------~~~~~WlC~vC~k~rel  106 (118)
T PF02318_consen   53 GERHCARCGKPFGFLFNRGRVCVDCKHRVCKKCGVYS-------KKEPIWLCKVCQKQREL  106 (118)
T ss_dssp             CCSB-TTTS-BCSCTSTTCEEETTTTEEEETTSEEET-------SSSCCEEEHHHHHHHHH
T ss_pred             CCcchhhhCCcccccCCCCCcCCcCCccccCccCCcC-------CCCCCEEChhhHHHHHH
Confidence            456899999999976 689999999999999998771       24678999999987543


No 15 
>smart00726 UIM Ubiquitin-interacting motif. Present in proteasome subunit S5a and other ubiquitin-associated proteins.
Probab=97.56  E-value=6.8e-05  Score=40.87  Aligned_cols=22  Identities=55%  Similarity=0.699  Sum_probs=19.0

Q ss_pred             cchHHHHHHHHhcHHHHhhcCC
Q psy509          135 KEEEELQLALALSQSEAESNKP  156 (158)
Q Consensus       135 ~eeedl~~aia~Sl~e~e~~~~  156 (158)
                      +||++|++||++|+.|++....
T Consensus         1 ~EDe~Lq~Ai~lSl~e~e~~~~   22 (26)
T smart00726        1 DEDEDLQLALELSLQEAEESXX   22 (26)
T ss_pred             ChHHHHHHHHHHhHHHhhhccc
Confidence            4799999999999999987643


No 16 
>PF02809 UIM:  Ubiquitin interaction motif;  InterPro: IPR003903 The Ubiquitin Interacting Motif (UIM), or 'LALAL-motif', is a stretch of about 20 amino acid residues, which was first described in the 26S proteasome subunit PSD4/RPN-10 that is known to recognise ubiquitin [,]. In addition, the UIM is found, often in tandem or triplet arrays, in a variety of proteins either involved in ubiquitination and ubiquitin metabolism, or known to interact with ubiquitin-like modifiers. Among the UIM proteins are two different subgroups of the UBP (ubiquitin carboxy-terminal hydrolase) family of deubiquitinating enzymes, one F-box protein, one family of HECT-containing ubiquitin-ligases (E3s) from plants, and several proteins containing ubiquitin-associated UBA and/or UBX domains []. In most of these proteins, the UIM occurs in multiple copies and in association with other domains such as UBA (IPR015940 from INTERPRO), UBX (IPR001012 from INTERPRO), ENTH, EH (IPR000261 from INTERPRO), VHS (IPR002014 from INTERPRO), SH3 (IPR001452 from INTERPRO), HECT (IPR000569 from INTERPRO), VWFA (IPR002035 from INTERPRO), EF-hand calcium-binding, WD-40 (IPR001680 from INTERPRO), F-box (IPR001810 from INTERPRO), LIM (IPR001781 from INTERPRO), protein kinase (IPR000719 from INTERPRO), ankyrin (IPR002110 from INTERPRO), PX (IPR001683 from INTERPRO), phosphatidylinositol 3- and 4-kinase (IPR000403 from INTERPRO), C2 (IPR000008 from INTERPRO), OTU (IPR003323 from INTERPRO), dnaJ (IPR001623 from INTERPRO), RING-finger (IPR001841 from INTERPRO) or FYVE-finger (IPR017455 from INTERPRO). UIMs have been shown to bind ubiquitin and to serve as a specific targeting signal important for monoubiquitination. Thus, UIMs may have several functions in ubiquitin metabolism each of which may require different numbers of UIMs [, , ].  The UIM is unlikely to form an independent folding domain. Instead, based on the spacing of the conserved residues, the motif probably forms a short alpha-helix that can be embedded into different protein folds []. Some proteins known to contain an UIM are listed below:    Eukaryotic PSD4/RPN-10/S5, a multi-ubiquitin binding subunit of the 26S proteasome.  Vertebrate Machado-Joseph disease protein 1 (Ataxin-3), which acts as a histone-binding protein that regulates transcription; defects in Ataxin-3 cause the neurodegenerative disorder Machado-Joseph disease (MJD). Vertebrate epsin and epsin2.  Vertebrate hepatocyte growth factor-regulated tyrosine kinase substrate (HRS).  Mammalian epidermal growth factor receptor substrate 15 (EPS15), which is involved in cell growth regulation.  Mammalian epidermal growth factor receptor substrate EPS15R.   Drosophila melanogaster (Fruit fly) liquid facets (lqf), an epsin.  Yeast VPS27 vacuolar sorting protein, which is required for membrane traffic to the vacuole.   ; PDB: 2KDE_A 2KDF_A 1YX6_A 1YX5_A 1YX4_A 1P9C_A 1UEL_B 1P9D_S 2KLZ_A.
Probab=97.49  E-value=5.5e-05  Score=37.77  Aligned_cols=17  Identities=53%  Similarity=0.659  Sum_probs=15.2

Q ss_pred             cchHHHHHHHHhcHHHH
Q psy509          135 KEEEELQLALALSQSEA  151 (158)
Q Consensus       135 ~eeedl~~aia~Sl~e~  151 (158)
                      +||++|++||++|++|+
T Consensus         2 ~Ed~~L~~Al~~S~~e~   18 (18)
T PF02809_consen    2 DEDEDLQRALEMSLEEA   18 (18)
T ss_dssp             HHHHHHHHHHHHHHHHC
T ss_pred             chHHHHHHHHHhhhccC
Confidence            57999999999999874


No 17 
>KOG0230|consensus
Probab=97.47  E-value=6.4e-05  Score=73.41  Aligned_cols=48  Identities=40%  Similarity=1.120  Sum_probs=39.7

Q ss_pred             CCCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      ...|..|+   +.++|+|||+.||++||++|....        ....|||..|+.....
T Consensus         5 ~~~~~~~~---t~~~~~~~~~~~g~~~~~~~~~~~--------~~~i~~~~~~~~~~~~   52 (1598)
T KOG0230|consen    5 SNVCYDCD---TSVNRRHHCRVCGRVFCSKCQDSP--------ETSIRVCNECRGQWEQ   52 (1598)
T ss_pred             ccchhccc---cccccCCCCcccCceeccccCCCC--------ccceeehhhhhhhccc
Confidence            45677888   788999999999999999999332        2378999999998764


No 18 
>KOG0230|consensus
Probab=97.05  E-value=0.00039  Score=68.12  Aligned_cols=55  Identities=31%  Similarity=0.791  Sum_probs=40.0

Q ss_pred             CCCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhcccCCC
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTNYYRSP   92 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~~~~~~   92 (158)
                      +..|..|+..|..|+|+|||  ||++||..|-    ..-.++.....   +.|......+..+.
T Consensus        97 ~~ec~~~~~~~~t~Rr~~~~--~gqi~~ss~~----~~~~~~~~~e~---d~c~~~~~~~~~ss  151 (1598)
T KOG0230|consen   97 SKECYDCEQKFETFRRKHHC--CGQIFCSSCI----DGMSIRCDGEL---DYCSRYVEDFAKSS  151 (1598)
T ss_pred             cchhhhhccchhhhhccccc--CccccCCccc----CCccccccccc---chhHHHhhhhhccC
Confidence            46899999999999999999  9999999991    11112222222   88888887665443


No 19 
>KOG2199|consensus
Probab=95.90  E-value=0.0049  Score=53.65  Aligned_cols=27  Identities=37%  Similarity=0.430  Sum_probs=23.1

Q ss_pred             chhhhcchHHHHHHHHhcHHHHhhcCC
Q psy509          130 TEEELKEEEELQLALALSQSEAESNKP  156 (158)
Q Consensus       130 ~~~~~~eeedl~~aia~Sl~e~e~~~~  156 (158)
                      .....+|||||+.||+|||+|.|.|+.
T Consensus       159 ~v~~k~EeEdiaKAi~lSL~E~~~Q~k  185 (462)
T KOG2199|consen  159 TVSSKQEEEDIAKAIELSLKEQEKQKK  185 (462)
T ss_pred             cccccccHHHHHHHHHhhHHHHhhchh
Confidence            345568999999999999999999864


No 20 
>KOG1841|consensus
Probab=93.60  E-value=0.072  Score=51.66  Aligned_cols=54  Identities=26%  Similarity=0.532  Sum_probs=43.0

Q ss_pred             CCCCCcccC---CCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           21 DTAPEWMDG---DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        21 ~~~p~W~~~---~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      ++++.|+.+   ..|+.|.+.|.++.++||||  |.+|          + .+...+..|+|..|...+.+
T Consensus       646 e~ksVw~aDg~aPng~la~t~~~~~~e~~hsr--~~ls----------~-~~~s~~~~~~~n~t~s~~rn  702 (1287)
T KOG1841|consen  646 EVKSVWFADGIAPNGELAETRFTFTGERHHSR--GKLS----------L-LYSSRKEARPCNITHSVLRN  702 (1287)
T ss_pred             eecceeccCCcCCCceecccceeeeccccccc--cccc----------c-cccccccCCCCcccCccchh
Confidence            568999974   68999999999999999999  8887          1 11124567899999988776


No 21 
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=93.10  E-value=0.02  Score=36.08  Aligned_cols=44  Identities=23%  Similarity=0.647  Sum_probs=25.8

Q ss_pred             CccccCcccccc------ccccccccccceecCCCCCCccccCCCCCCCceeeChhhH
Q psy509           31 TCHRCRTTFSLV------QRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCH   82 (158)
Q Consensus        31 ~C~~C~~~F~~~------~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~   82 (158)
                      .|.+|.++|...      ..++.|..|+++||..|=.+.        ...+..|..|.
T Consensus         1 ~CfgC~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fi--------HE~LH~CPGC~   50 (51)
T PF07975_consen    1 YCFGCQKPFPDGPEKKADSSRYRCPKCKNHFCIDCDVFI--------HETLHNCPGCE   50 (51)
T ss_dssp             EETTTTEE-TTS-------EEE--TTTT--B-HHHHHTT--------TTTS-SSSTT-
T ss_pred             CCccCCCCCCCcccccccCCeEECCCCCCccccCcChhh--------hccccCCcCCC
Confidence            388999999875      468999999999999995442        34456666663


No 22 
>KOG0993|consensus
Probab=92.68  E-value=0.0057  Score=53.50  Aligned_cols=58  Identities=26%  Similarity=0.625  Sum_probs=50.3

Q ss_pred             cCCCccccCcccccccccccccc--ccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           28 DGDTCHRCRTTFSLVQRKHHCRA--CGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        28 ~~~~C~~C~~~F~~~~RkhhCr~--CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      +...|..|..+|..++-+-||-+  ||++||.+|+.-.  +|.+....+..||..|+..+.+
T Consensus       467 ~ve~c~~~~aS~~slk~e~erl~qq~eqi~~~~~~Kat--vp~l~~e~~akv~rlq~eL~~s  526 (542)
T KOG0993|consen  467 DVEQCSNCDASFASLKVEPERLHQQCEQIFCMNCLKAT--VPSLPNERPAKVCRLQHELLNS  526 (542)
T ss_pred             HHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHhHHHhh--cccccccchHHHHHHHHHHhhh
Confidence            35789999999999999999988  9999999999764  5666667899999999998775


No 23 
>KOG4275|consensus
Probab=92.10  E-value=0.042  Score=46.25  Aligned_cols=48  Identities=29%  Similarity=0.731  Sum_probs=41.0

Q ss_pred             CCCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHH
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKF   85 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l   85 (158)
                      +.+|..|+..|..+.+||.|-.|.+-||..||..         ....|.|..|...-
T Consensus        44 ~p~ckacg~~f~~~~~k~~c~dckk~fc~tcs~v---------~~~lr~c~~c~r~~   91 (350)
T KOG4275|consen   44 APHCKACGEEFEDAQSKSDCEDCKKEFCATCSRV---------SISLRTCTSCRRVN   91 (350)
T ss_pred             cchhhhhchhHhhhhhhhhhhhhhHHHHHHHHHh---------cccchhhhHHHHHH
Confidence            4589999999999999999999999999999933         23468899998753


No 24 
>KOG1729|consensus
Probab=90.32  E-value=0.078  Score=44.54  Aligned_cols=56  Identities=21%  Similarity=0.528  Sum_probs=42.5

Q ss_pred             CCCccccCccccccccccccccccceecCCCCC-Cc---cccCCC--CCCCceeeChhhHHH
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSS-KS---TSLPKF--GIEKEVRVCEDCHEK   84 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~-~~---~~lp~~--~~~~~~RVC~~C~~~   84 (158)
                      +..|..|...|.++.|.|||+.||++||..|+. +.   .+-+.+  -......+|..|+..
T Consensus        20 ~~s~~~~~~e~~~~~r~~~~~~~grv~~~q~~~~k~~rk~~q~r~~~l~~D~~~~~~~~~~~   81 (288)
T KOG1729|consen   20 ANSCRNCKVEFCFGRRGHPCRECGRVLCRQGTLVKRCRKKLQSRSFFLFNDILVYGNIVSDN   81 (288)
T ss_pred             chhhhhhcccchhhhccCcccccchhhhhhhhhHHHHhcccccccccccccchhhcccccCH
Confidence            568999999999999999999999999999988 21   111111  124567788888776


No 25 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=89.86  E-value=0.22  Score=35.94  Aligned_cols=33  Identities=30%  Similarity=0.658  Sum_probs=25.6

Q ss_pred             CCCcccCCCccccCccccccccc-ccccccccee
Q psy509           23 APEWMDGDTCHRCRTTFSLVQRK-HHCRACGQVF   55 (158)
Q Consensus        23 ~p~W~~~~~C~~C~~~F~~~~Rk-hhCr~CG~vf   55 (158)
                      .|.|--=..|..|+++|==|+|. -+|..||.+|
T Consensus         3 kpelGtKR~Cp~CG~kFYDLnk~PivCP~CG~~~   36 (108)
T PF09538_consen    3 KPELGTKRTCPSCGAKFYDLNKDPIVCPKCGTEF   36 (108)
T ss_pred             ccccCCcccCCCCcchhccCCCCCccCCCCCCcc
Confidence            46676667999999999766654 5588888876


No 26 
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=89.73  E-value=0.2  Score=29.58  Aligned_cols=26  Identities=42%  Similarity=1.076  Sum_probs=19.6

Q ss_pred             ccccCccccccccccccccccceecCCC
Q psy509           32 CHRCRTTFSLVQRKHHCRACGQVFCQLC   59 (158)
Q Consensus        32 C~~C~~~F~~~~RkhhCr~CG~vfC~~C   59 (158)
                      |..|++.-.++  ...|+.||.+||...
T Consensus         1 C~~C~~~~~l~--~f~C~~C~~~FC~~H   26 (39)
T smart00154        1 CHFCRKKVGLT--GFKCRHCGNLFCGEH   26 (39)
T ss_pred             CcccCCccccc--CeECCccCCcccccc
Confidence            56677765554  678999999998754


No 27 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=89.45  E-value=0.2  Score=29.02  Aligned_cols=25  Identities=40%  Similarity=1.058  Sum_probs=18.9

Q ss_pred             CccccCccccc-------ccccccccccccee
Q psy509           31 TCHRCRTTFSL-------VQRKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~-------~~RkhhCr~CG~vf   55 (158)
                      .|..|++.|.+       -.++..|.+||++|
T Consensus         4 ~Cp~C~~~y~i~d~~ip~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEKIPPKGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHHCCCCCcEEECCCCCCEe
Confidence            58888888864       34667888888876


No 28 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=88.69  E-value=0.22  Score=38.21  Aligned_cols=25  Identities=32%  Similarity=0.832  Sum_probs=19.4

Q ss_pred             CccccCcccc------------cccccccccccccee
Q psy509           31 TCHRCRTTFS------------LVQRKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~------------~~~RkhhCr~CG~vf   55 (158)
                      .|..|+.+++            ..+|+++|.+||..|
T Consensus         2 ~cp~c~~~~~~~~~s~~~~~~~~~~~~~~c~~c~~~f   38 (154)
T PRK00464          2 RCPFCGHPDTRVIDSRPAEDGNAIRRRRECLACGKRF   38 (154)
T ss_pred             cCCCCCCCCCEeEeccccCCCCceeeeeeccccCCcc
Confidence            4888887772            356679999999987


No 29 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.68  E-value=0.28  Score=36.45  Aligned_cols=33  Identities=18%  Similarity=0.310  Sum_probs=25.7

Q ss_pred             CCCcccCCCccccCcccccc-cccccccccccee
Q psy509           23 APEWMDGDTCHRCRTTFSLV-QRKHHCRACGQVF   55 (158)
Q Consensus        23 ~p~W~~~~~C~~C~~~F~~~-~RkhhCr~CG~vf   55 (158)
                      .|.|---..|..|+++|--+ ++-.+|..||.+|
T Consensus         3 k~elGtKr~Cp~cg~kFYDLnk~p~vcP~cg~~~   36 (129)
T TIGR02300         3 KPDLGTKRICPNTGSKFYDLNRRPAVSPYTGEQF   36 (129)
T ss_pred             chhhCccccCCCcCccccccCCCCccCCCcCCcc
Confidence            46777777999999999755 4567888888875


No 30 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=87.78  E-value=0.31  Score=28.33  Aligned_cols=25  Identities=48%  Similarity=1.055  Sum_probs=19.7

Q ss_pred             CccccCccccc-------ccccccccccccee
Q psy509           31 TCHRCRTTFSL-------VQRKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~-------~~RkhhCr~CG~vf   55 (158)
                      .|..|++.|.+       -.++..|..||.+|
T Consensus         4 ~CP~C~~~f~v~~~~l~~~~~~vrC~~C~~~f   35 (37)
T PF13719_consen    4 TCPNCQTRFRVPDDKLPAGGRKVRCPKCGHVF   35 (37)
T ss_pred             ECCCCCceEEcCHHHcccCCcEEECCCCCcEe
Confidence            58899998863       35688888888887


No 31 
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=86.79  E-value=0.46  Score=34.61  Aligned_cols=45  Identities=24%  Similarity=0.685  Sum_probs=33.1

Q ss_pred             CCccccCcccccc----------ccccccccccceecCCCCCCccccCCCCCCCceeeChhhH
Q psy509           30 DTCHRCRTTFSLV----------QRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCH   82 (158)
Q Consensus        30 ~~C~~C~~~F~~~----------~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~   82 (158)
                      ..|.+|.+.|.-.          ..++-|..|+++||-.|=.+.        ...+..|-.|.
T Consensus        56 ~~C~~C~~~f~~~~~~~~~~~~~~~~y~C~~C~~~FC~dCD~fi--------He~Lh~CPGC~  110 (112)
T TIGR00622        56 RFCFGCQGPFPKPPVSPFDELKDSHRYVCAVCKNVFCVDCDVFV--------HESLHCCPGCI  110 (112)
T ss_pred             CcccCcCCCCCCcccccccccccccceeCCCCCCccccccchhh--------hhhccCCcCCC
Confidence            4699999999742          446889999999999997553        23445566664


No 32 
>PF14634 zf-RING_5:  zinc-RING finger domain
Probab=86.28  E-value=0.14  Score=30.56  Aligned_cols=33  Identities=30%  Similarity=0.837  Sum_probs=23.2

Q ss_pred             CccccCccccccccccccccccceecCCCCCCcc
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKST   64 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~   64 (158)
                      .|..|...|+ -.++-.=-.||++||..|.....
T Consensus         1 ~C~~C~~~~~-~~~~~~l~~CgH~~C~~C~~~~~   33 (44)
T PF14634_consen    1 HCNICFEKYS-EERRPRLTSCGHIFCEKCLKKLK   33 (44)
T ss_pred             CCcCcCcccc-CCCCeEEcccCCHHHHHHHHhhc
Confidence            4778888882 22334445899999999987754


No 33 
>KOG0320|consensus
Probab=84.74  E-value=0.084  Score=41.44  Aligned_cols=46  Identities=33%  Similarity=0.761  Sum_probs=31.7

Q ss_pred             CccccCcccccccccc-ccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           31 TCHRCRTTFSLVQRKH-HCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        31 ~C~~C~~~F~~~~Rkh-hCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      .|.+|--.|+   .|. .--.||+|||..|....+        +..++|..|..+|..
T Consensus       133 ~CPiCl~~~s---ek~~vsTkCGHvFC~~Cik~al--------k~~~~CP~C~kkIt~  179 (187)
T KOG0320|consen  133 KCPICLDSVS---EKVPVSTKCGHVFCSQCIKDAL--------KNTNKCPTCRKKITH  179 (187)
T ss_pred             CCCceecchh---hccccccccchhHHHHHHHHHH--------HhCCCCCCcccccch
Confidence            5666665553   222 446899999999987642        445789999877654


No 34 
>PHA02768 hypothetical protein; Provisional
Probab=84.41  E-value=0.43  Score=30.45  Aligned_cols=26  Identities=15%  Similarity=0.346  Sum_probs=17.8

Q ss_pred             CCccccCcccccc------cc----cccccccccee
Q psy509           30 DTCHRCRTTFSLV------QR----KHHCRACGQVF   55 (158)
Q Consensus        30 ~~C~~C~~~F~~~------~R----khhCr~CG~vf   55 (158)
                      -.|..|++.|+..      .|    .+.|-.||++|
T Consensus         6 y~C~~CGK~Fs~~~~L~~H~r~H~k~~kc~~C~k~f   41 (55)
T PHA02768          6 YECPICGEIYIKRKSMITHLRKHNTNLKLSNCKRIS   41 (55)
T ss_pred             cCcchhCCeeccHHHHHHHHHhcCCcccCCccccee
Confidence            3799999999732      23    34477777766


No 35 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=84.33  E-value=0.86  Score=29.51  Aligned_cols=31  Identities=29%  Similarity=0.535  Sum_probs=23.9

Q ss_pred             CcccCCCccccCccccc--ccccccccccccee
Q psy509           25 EWMDGDTCHRCRTTFSL--VQRKHHCRACGQVF   55 (158)
Q Consensus        25 ~W~~~~~C~~C~~~F~~--~~RkhhCr~CG~vf   55 (158)
                      .|..+..|..|+..-..  -.|.++|..||..+
T Consensus        24 ~~~TSq~C~~CG~~~~~~~~~r~~~C~~Cg~~~   56 (69)
T PF07282_consen   24 EAYTSQTCPRCGHRNKKRRSGRVFTCPNCGFEM   56 (69)
T ss_pred             CCCCccCccCcccccccccccceEEcCCCCCEE
Confidence            33457789999876654  78899999999874


No 36 
>PRK03564 formate dehydrogenase accessory protein FdhE; Provisional
Probab=83.17  E-value=1.3  Score=37.63  Aligned_cols=72  Identities=22%  Similarity=0.409  Sum_probs=46.3

Q ss_pred             CCCCCCcccCCCccccCcc--ccc-------cccccccccccc------eecCCCCCCccccCC--CCC---CCceeeCh
Q psy509           20 ADTAPEWMDGDTCHRCRTT--FSL-------VQRKHHCRACGQ------VFCQLCSSKSTSLPK--FGI---EKEVRVCE   79 (158)
Q Consensus        20 ~~~~p~W~~~~~C~~C~~~--F~~-------~~RkhhCr~CG~------vfC~~Cs~~~~~lp~--~~~---~~~~RVC~   79 (158)
                      ....+.|.....|..||..  .++       -.|..||..||.      +-|..|.+.. .+--  +..   ...+-+|+
T Consensus       178 ~~~~~~~~~~~~CPvCGs~P~~s~v~~~~~~G~RyL~CslC~teW~~~R~~C~~Cg~~~-~l~y~~~~~~~~~~r~e~C~  256 (309)
T PRK03564        178 KARAEYGEQRQFCPVCGSMPVSSVVQIGTTQGLRYLHCNLCESEWHVVRVKCSNCEQSG-KLHYWSLDSEQAAVKAESCG  256 (309)
T ss_pred             ccccccccCCCCCCCCCCcchhheeeccCCCCceEEEcCCCCCcccccCccCCCCCCCC-ceeeeeecCCCcceEeeecc
Confidence            3345556667899999975  232       357889999985      4788887642 2211  111   23467999


Q ss_pred             hhHHHHhcccCCC
Q psy509           80 DCHEKFTNYYRSP   92 (158)
Q Consensus        80 ~C~~~l~~~~~~~   92 (158)
                      .|...+.-.+...
T Consensus       257 ~C~~YlK~~~~~~  269 (309)
T PRK03564        257 DCGTYLKILYQEK  269 (309)
T ss_pred             cccccceeccccc
Confidence            9999887754443


No 37 
>KOG3576|consensus
Probab=82.99  E-value=0.35  Score=39.05  Aligned_cols=28  Identities=36%  Similarity=0.876  Sum_probs=21.6

Q ss_pred             CCccccCccccc---cc---------cccccccccceecC
Q psy509           30 DTCHRCRTTFSL---VQ---------RKHHCRACGQVFCQ   57 (158)
Q Consensus        30 ~~C~~C~~~F~~---~~---------RkhhCr~CG~vfC~   57 (158)
                      -.|..|++.|++   ++         |||-|+.||+-|=.
T Consensus       118 ftCrvCgK~F~lQRmlnrh~kch~~vkr~lct~cgkgfnd  157 (267)
T KOG3576|consen  118 FTCRVCGKKFGLQRMLNRHLKCHSDVKRHLCTFCGKGFND  157 (267)
T ss_pred             eeeehhhhhhhHHHHHHHHhhhccHHHHHHHhhccCcccc
Confidence            479999999983   43         47888899988733


No 38 
>KOG2164|consensus
Probab=82.32  E-value=0.4  Score=43.05  Aligned_cols=52  Identities=25%  Similarity=0.465  Sum_probs=38.3

Q ss_pred             CCCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      +..|.+|=..+.+-.|-    +||+|||..|.-...-.+   -....+-|..|+..+..
T Consensus       186 ~~~CPICL~~~~~p~~t----~CGHiFC~~CiLqy~~~s---~~~~~~~CPiC~s~I~~  237 (513)
T KOG2164|consen  186 DMQCPICLEPPSVPVRT----NCGHIFCGPCILQYWNYS---AIKGPCSCPICRSTITL  237 (513)
T ss_pred             CCcCCcccCCCCccccc----ccCceeeHHHHHHHHhhh---cccCCccCCchhhhccc
Confidence            46899998877755443    499999999976543333   23556889999999875


No 39 
>PF13639 zf-RING_2:  Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A ....
Probab=82.00  E-value=0.33  Score=28.72  Aligned_cols=34  Identities=26%  Similarity=0.549  Sum_probs=24.4

Q ss_pred             CCccccCccccccccccccccccceecCCCCCCcc
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKST   64 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~   64 (158)
                      +.|.+|...|..-..-.-. .||++||..|...++
T Consensus         1 d~C~IC~~~~~~~~~~~~l-~C~H~fh~~Ci~~~~   34 (44)
T PF13639_consen    1 DECPICLEEFEDGEKVVKL-PCGHVFHRSCIKEWL   34 (44)
T ss_dssp             -CETTTTCBHHTTSCEEEE-TTSEEEEHHHHHHHH
T ss_pred             CCCcCCChhhcCCCeEEEc-cCCCeeCHHHHHHHH
Confidence            4689999988653333333 499999999987764


No 40 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=81.55  E-value=0.89  Score=27.39  Aligned_cols=25  Identities=28%  Similarity=0.644  Sum_probs=17.6

Q ss_pred             CccccCcccccccc--cccccccccee
Q psy509           31 TCHRCRTTFSLVQR--KHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~~~R--khhCr~CG~vf   55 (158)
                      .|..|+..|.+-..  ..+|..||.-+
T Consensus         5 ~C~~CG~~~~~~~~~~~~~Cp~CG~~~   31 (46)
T PRK00398          5 KCARCGREVELDEYGTGVRCPYCGYRI   31 (46)
T ss_pred             ECCCCCCEEEECCCCCceECCCCCCeE
Confidence            58888888865443  57888887643


No 41 
>PRK00420 hypothetical protein; Validated
Probab=80.94  E-value=1.1  Score=32.67  Aligned_cols=26  Identities=19%  Similarity=0.399  Sum_probs=17.1

Q ss_pred             CCCccccCccccc-cccccccccccce
Q psy509           29 GDTCHRCRTTFSL-VQRKHHCRACGQV   54 (158)
Q Consensus        29 ~~~C~~C~~~F~~-~~RkhhCr~CG~v   54 (158)
                      +..|..|+.+|.- -..+..|.+||.+
T Consensus        23 ~~~CP~Cg~pLf~lk~g~~~Cp~Cg~~   49 (112)
T PRK00420         23 SKHCPVCGLPLFELKDGEVVCPVHGKV   49 (112)
T ss_pred             cCCCCCCCCcceecCCCceECCCCCCe
Confidence            4789999987764 3445555555554


No 42 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=80.91  E-value=1.2  Score=27.73  Aligned_cols=33  Identities=24%  Similarity=0.588  Sum_probs=20.1

Q ss_pred             Cccc--cCcccccccc----ccccccccceecCCCCCCc
Q psy509           31 TCHR--CRTTFSLVQR----KHHCRACGQVFCQLCSSKS   63 (158)
Q Consensus        31 ~C~~--C~~~F~~~~R----khhCr~CG~vfC~~Cs~~~   63 (158)
                      .|..  |+..|..-..    ...|..||..||..|...+
T Consensus        20 ~Cp~~~C~~~~~~~~~~~~~~~~C~~C~~~fC~~C~~~~   58 (64)
T PF01485_consen   20 WCPNPDCEYIIEKDDGCNSPIVTCPSCGTEFCFKCGEPW   58 (64)
T ss_dssp             --TTSST---ECS-SSTTS--CCTTSCCSEECSSSTSES
T ss_pred             CCCCCCCcccEEecCCCCCCeeECCCCCCcCccccCccc
Confidence            5654  8877754332    2689999999999998654


No 43 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=80.14  E-value=1.1  Score=24.19  Aligned_cols=23  Identities=30%  Similarity=0.748  Sum_probs=12.5

Q ss_pred             CccccCcccccccccccccccccee
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vf   55 (158)
                      .|..|++.-....  .-|.+||..|
T Consensus         2 ~CP~C~~~V~~~~--~~Cp~CG~~F   24 (26)
T PF10571_consen    2 TCPECGAEVPESA--KFCPHCGYDF   24 (26)
T ss_pred             cCCCCcCCchhhc--CcCCCCCCCC
Confidence            4666666443332  2466677665


No 44 
>KOG0823|consensus
Probab=79.95  E-value=0.71  Score=37.58  Aligned_cols=34  Identities=21%  Similarity=0.549  Sum_probs=26.1

Q ss_pred             ccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           49 RACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        49 r~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      -.||+.||+-|.-+|..+.     .....|-.|...+..
T Consensus        63 TlCGHLFCWpClyqWl~~~-----~~~~~cPVCK~~Vs~   96 (230)
T KOG0823|consen   63 TLCGHLFCWPCLYQWLQTR-----PNSKECPVCKAEVSI   96 (230)
T ss_pred             eecccceehHHHHHHHhhc-----CCCeeCCcccccccc
Confidence            3799999999999986542     334677888887765


No 45 
>PF12773 DZR:  Double zinc ribbon
Probab=78.94  E-value=1.4  Score=26.74  Aligned_cols=26  Identities=31%  Similarity=0.648  Sum_probs=16.8

Q ss_pred             CCCccccCcccc-ccccccccccccce
Q psy509           29 GDTCHRCRTTFS-LVQRKHHCRACGQV   54 (158)
Q Consensus        29 ~~~C~~C~~~F~-~~~RkhhCr~CG~v   54 (158)
                      +..|..|+.++. .......|..||..
T Consensus        12 ~~fC~~CG~~l~~~~~~~~~C~~Cg~~   38 (50)
T PF12773_consen   12 AKFCPHCGTPLPPPDQSKKICPNCGAE   38 (50)
T ss_pred             ccCChhhcCChhhccCCCCCCcCCcCC
Confidence            567888888776 23345667777763


No 46 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=76.58  E-value=1.5  Score=25.11  Aligned_cols=25  Identities=40%  Similarity=1.027  Sum_probs=14.5

Q ss_pred             CccccCcccccc-------cccccccccccee
Q psy509           31 TCHRCRTTFSLV-------QRKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~~-------~RkhhCr~CG~vf   55 (158)
                      .|..|++.|.+-       ..+-.|.+||..|
T Consensus         4 ~CP~C~~~~~v~~~~~~~~~~~v~C~~C~~~~   35 (38)
T TIGR02098         4 QCPNCKTSFRVVDSQLGANGGKVRCGKCGHVW   35 (38)
T ss_pred             ECCCCCCEEEeCHHHcCCCCCEEECCCCCCEE
Confidence            477777777532       2235566666654


No 47 
>KOG3799|consensus
Probab=76.23  E-value=1.1  Score=33.88  Aligned_cols=53  Identities=32%  Similarity=0.685  Sum_probs=38.7

Q ss_pred             cCCCccccCc-cccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHH
Q psy509           28 DGDTCHRCRT-TFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKF   85 (158)
Q Consensus        28 ~~~~C~~C~~-~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l   85 (158)
                      ++..|.+|.+ +|.--. -|.|..|.--||..|.-+- .+   ..++-..||..|....
T Consensus        64 ddatC~IC~KTKFADG~-GH~C~YCq~r~CARCGGrv-~l---rsNKv~wvcnlc~k~q  117 (169)
T KOG3799|consen   64 DDATCGICHKTKFADGC-GHNCSYCQTRFCARCGGRV-SL---RSNKVMWVCNLCRKQQ  117 (169)
T ss_pred             cCcchhhhhhccccccc-CcccchhhhhHHHhcCCee-ee---ccCceEEeccCCcHHH
Confidence            4668999975 664333 4999999999999998663 22   2256678999997654


No 48 
>KOG3173|consensus
Probab=74.68  E-value=1.4  Score=34.19  Aligned_cols=27  Identities=37%  Similarity=1.045  Sum_probs=22.7

Q ss_pred             CCccccCccccccccccccccccceecCCC
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVFCQLC   59 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vfC~~C   59 (158)
                      ..|..|+++-++..  .||| ||.+||+..
T Consensus       106 ~rC~~C~kk~gltg--f~Cr-CG~~fC~~H  132 (167)
T KOG3173|consen  106 KRCFKCRKKVGLTG--FKCR-CGNTFCGTH  132 (167)
T ss_pred             hhhhhhhhhhcccc--cccc-cCCcccccc
Confidence            36999999888887  8886 999998854


No 49 
>KOG0153|consensus
Probab=74.46  E-value=0.56  Score=40.39  Aligned_cols=17  Identities=24%  Similarity=0.714  Sum_probs=14.4

Q ss_pred             CCCccccCccccccccc
Q psy509           29 GDTCHRCRTTFSLVQRK   45 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~Rk   45 (158)
                      +..|.+|.++|++|+.+
T Consensus        41 gkECKICtrPfT~Frw~   57 (377)
T KOG0153|consen   41 GKECKICTRPFTIFRWC   57 (377)
T ss_pred             CCccceecCcceEEEec
Confidence            46899999999988654


No 50 
>smart00647 IBR In Between Ring fingers. the domains occurs between pairs og RING fingers
Probab=74.15  E-value=2.7  Score=26.17  Aligned_cols=22  Identities=27%  Similarity=0.608  Sum_probs=18.5

Q ss_pred             cccccccccccceecCCCCCCc
Q psy509           42 VQRKHHCRACGQVFCQLCSSKS   63 (158)
Q Consensus        42 ~~RkhhCr~CG~vfC~~Cs~~~   63 (158)
                      ......|..||..||..|...+
T Consensus        37 ~~~~v~C~~C~~~fC~~C~~~~   58 (64)
T smart00647       37 GCNRVTCPKCGFSFCFRCKVPW   58 (64)
T ss_pred             CCCeeECCCCCCeECCCCCCcC
Confidence            4678899999999999997654


No 51 
>KOG0978|consensus
Probab=74.14  E-value=0.29  Score=45.63  Aligned_cols=44  Identities=30%  Similarity=0.738  Sum_probs=31.2

Q ss_pred             CCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHH
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEK   84 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~   84 (158)
                      -.|..|.+.+-    ---=..||++||..|...+.       ....|-|..|-.-
T Consensus       644 LkCs~Cn~R~K----d~vI~kC~H~FC~~Cvq~r~-------etRqRKCP~Cn~a  687 (698)
T KOG0978|consen  644 LKCSVCNTRWK----DAVITKCGHVFCEECVQTRY-------ETRQRKCPKCNAA  687 (698)
T ss_pred             eeCCCccCchh----hHHHHhcchHHHHHHHHHHH-------HHhcCCCCCCCCC
Confidence            36999987653    11124799999999998762       4567889888643


No 52 
>PF07191 zinc-ribbons_6:  zinc-ribbons;  InterPro: IPR010807 This family consists of several short, hypothetical bacterial proteins of around 70 residues in length. Members of this family 8 highly conserved cysteine residues. The function of the family is unknown.; PDB: 2JRP_A 2JNE_A.
Probab=74.07  E-value=1.1  Score=29.89  Aligned_cols=32  Identities=31%  Similarity=0.834  Sum_probs=19.1

Q ss_pred             CccccCccccccccccccccccce-----ecCCCCCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV-----FCQLCSSK   62 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v-----fC~~Cs~~   62 (158)
                      .|..|+....+...+.||..|+.-     +|..|-..
T Consensus         3 ~CP~C~~~L~~~~~~~~C~~C~~~~~~~a~CPdC~~~   39 (70)
T PF07191_consen    3 TCPKCQQELEWQGGHYHCEACQKDYKKEAFCPDCGQP   39 (70)
T ss_dssp             B-SSS-SBEEEETTEEEETTT--EEEEEEE-TTT-SB
T ss_pred             cCCCCCCccEEeCCEEECccccccceecccCCCcccH
Confidence            588888888877788888888765     45555443


No 53 
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional
Probab=73.37  E-value=0.43  Score=37.93  Aligned_cols=54  Identities=22%  Similarity=0.498  Sum_probs=35.9

Q ss_pred             CCccccCccccccccccccccccceecCCCCCCccccCC--------CCCCCceeeChhhHHHHhc
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPK--------FGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~--------~~~~~~~RVC~~C~~~l~~   87 (158)
                      -.|.+|...|.-    -.--.||++||..|...+.....        ....+....|-.|...+..
T Consensus        19 ~~CpICld~~~d----PVvT~CGH~FC~~CI~~wl~~s~~s~~~~~~~~~~k~~~~CPvCR~~Is~   80 (193)
T PLN03208         19 FDCNICLDQVRD----PVVTLCGHLFCWPCIHKWTYASNNSRQRVDQYDHKREPPKCPVCKSDVSE   80 (193)
T ss_pred             cCCccCCCcCCC----cEEcCCCchhHHHHHHHHHHhccccccccccccccCCCCcCCCCCCcCCh
Confidence            579999887642    22357999999999976643211        1112345689999988764


No 54 
>KOG1814|consensus
Probab=73.31  E-value=1.5  Score=38.61  Aligned_cols=40  Identities=28%  Similarity=0.928  Sum_probs=32.6

Q ss_pred             CCccc--CCCccccCccccccc--cccccccccceecCCCCCCc
Q psy509           24 PEWMD--GDTCHRCRTTFSLVQ--RKHHCRACGQVFCQLCSSKS   63 (158)
Q Consensus        24 p~W~~--~~~C~~C~~~F~~~~--RkhhCr~CG~vfC~~Cs~~~   63 (158)
                      -.|+.  +..|..|........  -|+||-.||..||+-|+...
T Consensus       361 ekwl~~N~krCP~C~v~IEr~eGCnKM~C~~c~~~fc~~c~~~l  404 (445)
T KOG1814|consen  361 EKWLESNSKRCPKCKVVIERSEGCNKMHCTKCGTYFCWICAELL  404 (445)
T ss_pred             HHHHHhcCCCCCcccceeecCCCccceeeccccccceeehhhhc
Confidence            37875  678999998776553  58999999999999998654


No 55 
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=72.98  E-value=0.8  Score=38.88  Aligned_cols=50  Identities=24%  Similarity=0.594  Sum_probs=30.4

Q ss_pred             cCCCccccCcc--cccccc-ccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHh
Q psy509           28 DGDTCHRCRTT--FSLVQR-KHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        28 ~~~~C~~C~~~--F~~~~R-khhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~   86 (158)
                      ++..|..|.+.  ++.-.+ -.+  .||+.||..|.......       +...|..|...+.
T Consensus         2 d~~~CP~Ck~~~y~np~~kl~i~--~CGH~~C~sCv~~l~~~-------~~~~CP~C~~~lr   54 (309)
T TIGR00570         2 DDQGCPRCKTTKYRNPSLKLMVN--VCGHTLCESCVDLLFVR-------GSGSCPECDTPLR   54 (309)
T ss_pred             CCCCCCcCCCCCccCcccccccC--CCCCcccHHHHHHHhcC-------CCCCCCCCCCccc
Confidence            44689999873  321111 123  79999999998874221       1236777755544


No 56 
>PF13923 zf-C3HC4_2:  Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A.
Probab=72.68  E-value=1  Score=25.89  Aligned_cols=29  Identities=28%  Similarity=0.686  Sum_probs=19.2

Q ss_pred             ccccCccccccccccccccccceecCCCCCCc
Q psy509           32 CHRCRTTFSLVQRKHHCRACGQVFCQLCSSKS   63 (158)
Q Consensus        32 C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~   63 (158)
                      |.+|..   .+.....-..||++||..|...+
T Consensus         1 C~iC~~---~~~~~~~~~~CGH~fC~~C~~~~   29 (39)
T PF13923_consen    1 CPICLD---ELRDPVVVTPCGHSFCKECIEKY   29 (39)
T ss_dssp             ETTTTS---B-SSEEEECTTSEEEEHHHHHHH
T ss_pred             CCCCCC---cccCcCEECCCCCchhHHHHHHH
Confidence            445544   33334567889999999997664


No 57 
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=71.92  E-value=2.3  Score=24.39  Aligned_cols=27  Identities=33%  Similarity=0.821  Sum_probs=12.2

Q ss_pred             ecCCCCCC-ccccCCCCCCCceeeChhhH
Q psy509           55 FCQLCSSK-STSLPKFGIEKEVRVCEDCH   82 (158)
Q Consensus        55 fC~~Cs~~-~~~lp~~~~~~~~RVC~~C~   82 (158)
                      ||..|... ...+| .|.+++..||..|-
T Consensus         2 fC~~CG~~l~~~ip-~gd~r~R~vC~~Cg   29 (34)
T PF14803_consen    2 FCPQCGGPLERRIP-EGDDRERLVCPACG   29 (34)
T ss_dssp             B-TTT--B-EEE---TT-SS-EEEETTTT
T ss_pred             ccccccChhhhhcC-CCCCccceECCCCC
Confidence            44555443 22334 33468889999884


No 58 
>KOG4739|consensus
Probab=71.44  E-value=1.8  Score=35.41  Aligned_cols=44  Identities=32%  Similarity=0.698  Sum_probs=29.4

Q ss_pred             CccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHh
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~   86 (158)
                      +|..|+..=+  ....+=-.|++|||..|.....+          ++|..|...+.
T Consensus         5 hCn~C~~~~~--~~~f~LTaC~HvfC~~C~k~~~~----------~~C~lCkk~ir   48 (233)
T KOG4739|consen    5 HCNKCFRFPS--QDPFFLTACRHVFCEPCLKASSP----------DVCPLCKKSIR   48 (233)
T ss_pred             EeccccccCC--CCceeeeechhhhhhhhcccCCc----------cccccccceee
Confidence            6777765322  34444458999999999866311          28999987643


No 59 
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H)
Probab=71.41  E-value=1.1  Score=25.29  Aligned_cols=31  Identities=32%  Similarity=0.724  Sum_probs=21.2

Q ss_pred             CccccCccccccccccccccccceecCCCCCCcc
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKST   64 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~   64 (158)
                      .|.+|...|   .....-..||+.||..|...+.
T Consensus         1 ~C~iC~~~~---~~~~~~~~C~H~~c~~C~~~~~   31 (45)
T cd00162           1 ECPICLEEF---REPVVLLPCGHVFCRSCIDKWL   31 (45)
T ss_pred             CCCcCchhh---hCceEecCCCChhcHHHHHHHH
Confidence            367777766   3334445699999999987653


No 60 
>PF12760 Zn_Tnp_IS1595:  Transposase zinc-ribbon domain;  InterPro: IPR024442 This zinc binding domain is found in a range of transposase proteins such as ISSPO8, ISSOD11, ISRSSP2 etc. It may be a zinc-binding beta ribbon domain that could bind DNA.
Probab=71.14  E-value=3  Score=25.09  Aligned_cols=30  Identities=33%  Similarity=0.881  Sum_probs=19.9

Q ss_pred             CCcccCCCccccCcc--cccc-ccccccccccc
Q psy509           24 PEWMDGDTCHRCRTT--FSLV-QRKHHCRACGQ   53 (158)
Q Consensus        24 p~W~~~~~C~~C~~~--F~~~-~RkhhCr~CG~   53 (158)
                      -.|-++-.|..|+..  +.+- ..++.|+.|++
T Consensus        13 ~RW~~g~~CP~Cg~~~~~~~~~~~~~~C~~C~~   45 (46)
T PF12760_consen   13 IRWPDGFVCPHCGSTKHYRLKTRGRYRCKACRK   45 (46)
T ss_pred             hcCCCCCCCCCCCCeeeEEeCCCCeEECCCCCC
Confidence            468788889999852  2222 25677888764


No 61 
>PF13901 DUF4206:  Domain of unknown function (DUF4206)
Probab=71.05  E-value=3.1  Score=32.94  Aligned_cols=46  Identities=15%  Similarity=0.354  Sum_probs=35.5

Q ss_pred             ccccccceecCCCCCC-ccccCCC----CCCCceeeChhhHHHHhcccCCC
Q psy509           47 HCRACGQVFCQLCSSK-STSLPKF----GIEKEVRVCEDCHEKFTNYYRSP   92 (158)
Q Consensus        47 hCr~CG~vfC~~Cs~~-~~~lp~~----~~~~~~RVC~~C~~~l~~~~~~~   92 (158)
                      .|...|+.||..|-.. ...||..    .--++..||+..+..|......|
T Consensus         2 ~C~Y~G~yyC~~CH~~~~~vIParil~~WDf~~~pVs~~a~~~L~~~~~~P   52 (202)
T PF13901_consen    2 FCDYTGKYYCSSCHWNDTSVIPARILHNWDFRPYPVSRFAKQFLDQIWSKP   52 (202)
T ss_pred             ccCCCCCcCCCCCCCCCceeccHHHHHhcCCCccHHHHHHHHHHHHhccCC
Confidence            5889999999999877 4556631    11378899999999998866555


No 62 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=70.66  E-value=2  Score=26.20  Aligned_cols=23  Identities=30%  Similarity=0.904  Sum_probs=13.8

Q ss_pred             CccccCcccccccccc-----ccccccc
Q psy509           31 TCHRCRTTFSLVQRKH-----HCRACGQ   53 (158)
Q Consensus        31 ~C~~C~~~F~~~~Rkh-----hCr~CG~   53 (158)
                      .|..|+..|..+..-+     .|..||.
T Consensus         7 ~C~~Cg~~fe~~~~~~~~~~~~CP~Cg~   34 (52)
T TIGR02605         7 RCTACGHRFEVLQKMSDDPLATCPECGG   34 (52)
T ss_pred             EeCCCCCEeEEEEecCCCCCCCCCCCCC
Confidence            5777888787664322     3555554


No 63 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=70.40  E-value=2.6  Score=29.37  Aligned_cols=30  Identities=23%  Similarity=0.568  Sum_probs=20.0

Q ss_pred             CcccCCCccccCcccc---------ccccccccccccce
Q psy509           25 EWMDGDTCHRCRTTFS---------LVQRKHHCRACGQV   54 (158)
Q Consensus        25 ~W~~~~~C~~C~~~F~---------~~~RkhhCr~CG~v   54 (158)
                      -|.+...|..|+++..         ++.-|.+||.|+.-
T Consensus        29 i~~~rS~C~~C~~~L~~~~lIPi~S~l~lrGrCr~C~~~   67 (92)
T PF06750_consen   29 IIFPRSHCPHCGHPLSWWDLIPILSYLLLRGRCRYCGAP   67 (92)
T ss_pred             ccCCCCcCcCCCCcCcccccchHHHHHHhCCCCcccCCC
Confidence            3445677888887654         44567778888763


No 64 
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=69.93  E-value=2.8  Score=24.24  Aligned_cols=30  Identities=30%  Similarity=0.720  Sum_probs=19.0

Q ss_pred             CcccCCC--ccccCcccc-ccccccccccccce
Q psy509           25 EWMDGDT--CHRCRTTFS-LVQRKHHCRACGQV   54 (158)
Q Consensus        25 ~W~~~~~--C~~C~~~F~-~~~RkhhCr~CG~v   54 (158)
                      .|.....  |..|+..|. .-..+.-|..||.+
T Consensus         2 e~~~~~~~~C~~C~~~~~~~~dG~~yC~~cG~~   34 (36)
T PF11781_consen    2 EWMRGPNEPCPVCGSRWFYSDDGFYYCDRCGHQ   34 (36)
T ss_pred             cccccCCCcCCCCCCeEeEccCCEEEhhhCceE
Confidence            3555444  888886643 34567777777765


No 65 
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=69.70  E-value=1.3  Score=26.63  Aligned_cols=31  Identities=35%  Similarity=0.802  Sum_probs=14.1

Q ss_pred             ccccCccccccccccccccccceecCCCCCCc
Q psy509           32 CHRCRTTFSLVQRKHHCRACGQVFCQLCSSKS   63 (158)
Q Consensus        32 C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~   63 (158)
                      |.+|.. |+--...--=-.||++||..|..+.
T Consensus         1 CpIc~e-~~~~~n~P~~L~CGH~~c~~cl~~l   31 (43)
T PF13445_consen    1 CPICKE-FSTEENPPMVLPCGHVFCKDCLQKL   31 (43)
T ss_dssp             -TTT-----TTSS-EEE-SSS-EEEHHHHHHH
T ss_pred             CCcccc-ccCCCCCCEEEeCccHHHHHHHHHH
Confidence            556666 6543333333458998888887653


No 66 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=69.49  E-value=4.3  Score=22.22  Aligned_cols=29  Identities=24%  Similarity=0.533  Sum_probs=23.0

Q ss_pred             CccccCccccccccccccccccceecCCCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVFCQLCS   60 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs   60 (158)
                      .|..|++..+-+. -++|..|+-.+-..|.
T Consensus         2 ~C~~C~~~~~~~~-~Y~C~~c~f~lh~~Ca   30 (30)
T PF03107_consen    2 WCDVCRRKIDGFY-FYHCSECCFTLHVRCA   30 (30)
T ss_pred             CCCCCCCCcCCCE-eEEeCCCCCeEcCccC
Confidence            5888998887776 8999999877766663


No 67 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=68.95  E-value=2.4  Score=30.67  Aligned_cols=24  Identities=21%  Similarity=0.430  Sum_probs=17.3

Q ss_pred             CCccccCccccccccccccccccc
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQ   53 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~   53 (158)
                      -.|..|+..|........|..||.
T Consensus        71 ~~C~~Cg~~~~~~~~~~~CP~Cgs   94 (115)
T TIGR00100        71 CECEDCSEEVSPEIDLYRCPKCHG   94 (115)
T ss_pred             EEcccCCCEEecCCcCccCcCCcC
Confidence            378889988877655556777764


No 68 
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=67.77  E-value=3.4  Score=24.45  Aligned_cols=25  Identities=24%  Similarity=0.574  Sum_probs=11.2

Q ss_pred             CccccCcccc---cccccccccccccee
Q psy509           31 TCHRCRTTFS---LVQRKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~---~~~RkhhCr~CG~vf   55 (158)
                      .|..|+....   ..+....|..||.|+
T Consensus         2 ~Cp~Cg~~~~~~D~~~g~~vC~~CG~Vl   29 (43)
T PF08271_consen    2 KCPNCGSKEIVFDPERGELVCPNCGLVL   29 (43)
T ss_dssp             SBTTTSSSEEEEETTTTEEEETTT-BBE
T ss_pred             CCcCCcCCceEEcCCCCeEECCCCCCEe
Confidence            3666665442   223334455555443


No 69 
>KOG1829|consensus
Probab=66.84  E-value=3.6  Score=37.82  Aligned_cols=63  Identities=25%  Similarity=0.471  Sum_probs=45.6

Q ss_pred             CCccccCcccc--ccccccccccccceecCCCCCCccc-cCCCCC----CCceeeChhhHHHHhcccCCC
Q psy509           30 DTCHRCRTTFS--LVQRKHHCRACGQVFCQLCSSKSTS-LPKFGI----EKEVRVCEDCHEKFTNYYRSP   92 (158)
Q Consensus        30 ~~C~~C~~~F~--~~~RkhhCr~CG~vfC~~Cs~~~~~-lp~~~~----~~~~RVC~~C~~~l~~~~~~~   92 (158)
                      -.|.+|++.++  ++.|-.-|+.+|..||..|-..-.. ||.-.+    -.+..||+.=+..|......|
T Consensus       341 ~~CAgC~~~i~~~~~~~~R~C~y~G~y~C~~Ch~~~~svIPARVl~~WDf~~y~Vs~~a~~~L~~ir~~P  410 (580)
T KOG1829|consen  341 FRCAGCGHTIGPDLEQRPRLCRYLGKYFCDCCHQNDKSVIPARVLHNWDFTKYPVSNFAKQFLDEIREQP  410 (580)
T ss_pred             ceecccCCCcccccccchhHhhhhhhhhCchhcccCcccccccceecccCcccccchhHHHHHHHHhccc
Confidence            37999999998  5678889999999999999876433 342211    256778887777776544433


No 70 
>TIGR01562 FdhE formate dehydrogenase accessory protein FdhE. The only sequence scoring between trusted and noise is that from Aquifex aeolicus, which shows certain structural differences from the proteobacterial forms in the alignment. However it is notable that A. aeolicus also has a sequence scoring above trusted to the alpha subunit of formate dehydrogenase (TIGR01553).
Probab=66.28  E-value=6.1  Score=33.52  Aligned_cols=66  Identities=20%  Similarity=0.509  Sum_probs=41.4

Q ss_pred             cccCCCccccCccc--cc--------cccccccccccc------eecCCCCCCccccCCCCC-----CCcee--eChhhH
Q psy509           26 WMDGDTCHRCRTTF--SL--------VQRKHHCRACGQ------VFCQLCSSKSTSLPKFGI-----EKEVR--VCEDCH   82 (158)
Q Consensus        26 W~~~~~C~~C~~~F--~~--------~~RkhhCr~CG~------vfC~~Cs~~~~~lp~~~~-----~~~~R--VC~~C~   82 (158)
                      |.....|..||..=  ++        -.|..||..|+.      +-|..|.+.. .+-.+.+     ...+|  +|..|.
T Consensus       181 ~~~~~~CPvCGs~P~~s~~~~~~~~~G~RyL~CslC~teW~~~R~~C~~Cg~~~-~l~y~~~e~~~~~~~~r~e~C~~C~  259 (305)
T TIGR01562       181 RESRTLCPACGSPPVASMVRQGGKETGLRYLSCSLCATEWHYVRVKCSHCEESK-HLAYLSLEHDAEKAVLKAETCDSCQ  259 (305)
T ss_pred             cCCCCcCCCCCChhhhhhhcccCCCCCceEEEcCCCCCcccccCccCCCCCCCC-ceeeEeecCCCCCcceEEeeccccc
Confidence            34456899998642  22        247789999985      5788887653 2221111     22344  999999


Q ss_pred             HHHhcccCCC
Q psy509           83 EKFTNYYRSP   92 (158)
Q Consensus        83 ~~l~~~~~~~   92 (158)
                      ..+.-.+...
T Consensus       260 ~YlK~~~~~~  269 (305)
T TIGR01562       260 GYLKILYQEK  269 (305)
T ss_pred             cchhhhcccc
Confidence            9887754433


No 71 
>KOG0317|consensus
Probab=65.71  E-value=1.3  Score=37.20  Aligned_cols=46  Identities=30%  Similarity=0.659  Sum_probs=30.9

Q ss_pred             CCCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHh
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~   86 (158)
                      ...|..|=.    .++---|--||++||+.|..-|..-      ++  -|.-|....+
T Consensus       239 ~~kC~LCLe----~~~~pSaTpCGHiFCWsCI~~w~~e------k~--eCPlCR~~~~  284 (293)
T KOG0317|consen  239 TRKCSLCLE----NRSNPSATPCGHIFCWSCILEWCSE------KA--ECPLCREKFQ  284 (293)
T ss_pred             CCceEEEec----CCCCCCcCcCcchHHHHHHHHHHcc------cc--CCCcccccCC
Confidence            467888854    2234568899999999998766422      11  1777776654


No 72 
>PF02591 DUF164:  Putative zinc ribbon domain;  InterPro: IPR003743 This entry describes proteins of unknown function.
Probab=65.18  E-value=3.9  Score=25.53  Aligned_cols=28  Identities=25%  Similarity=0.809  Sum_probs=19.6

Q ss_pred             ccCCCccccCcccc-----cc---ccccccccccce
Q psy509           27 MDGDTCHRCRTTFS-----LV---QRKHHCRACGQV   54 (158)
Q Consensus        27 ~~~~~C~~C~~~F~-----~~---~RkhhCr~CG~v   54 (158)
                      +++..|.+|+...+     .+   ..-.+|.+||++
T Consensus        20 v~~~~C~gC~~~l~~~~~~~i~~~~~i~~Cp~CgRi   55 (56)
T PF02591_consen   20 VEGGTCSGCHMELPPQELNEIRKGDEIVFCPNCGRI   55 (56)
T ss_pred             eeCCccCCCCEEcCHHHHHHHHcCCCeEECcCCCcc
Confidence            34679999998765     12   235788888876


No 73 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=64.36  E-value=2.2  Score=30.69  Aligned_cols=24  Identities=25%  Similarity=0.700  Sum_probs=16.9

Q ss_pred             CCccccCccccccccccccccccc
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQ   53 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~   53 (158)
                      -.|..|+..|..-.....|..||.
T Consensus        71 ~~C~~Cg~~~~~~~~~~~CP~Cgs   94 (113)
T PF01155_consen   71 ARCRDCGHEFEPDEFDFSCPRCGS   94 (113)
T ss_dssp             EEETTTS-EEECHHCCHH-SSSSS
T ss_pred             EECCCCCCEEecCCCCCCCcCCcC
Confidence            379999999987666677777776


No 74 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=64.30  E-value=3.9  Score=24.71  Aligned_cols=23  Identities=26%  Similarity=0.710  Sum_probs=14.0

Q ss_pred             CccccCcccccc-ccccccccccc
Q psy509           31 TCHRCRTTFSLV-QRKHHCRACGQ   53 (158)
Q Consensus        31 ~C~~C~~~F~~~-~RkhhCr~CG~   53 (158)
                      .|..|+..|.+- .-.-.|+.||.
T Consensus         4 ~C~~Cg~~~~~~~~~~irC~~CG~   27 (44)
T smart00659        4 ICGECGRENEIKSKDVVRCRECGY   27 (44)
T ss_pred             ECCCCCCEeecCCCCceECCCCCc
Confidence            488888888765 23344555544


No 75 
>KOG2462|consensus
Probab=64.18  E-value=3  Score=34.86  Aligned_cols=12  Identities=25%  Similarity=0.753  Sum_probs=7.1

Q ss_pred             eeeChhhHHHHh
Q psy509           75 VRVCEDCHEKFT   86 (158)
Q Consensus        75 ~RVC~~C~~~l~   86 (158)
                      .--|..|...+.
T Consensus       243 ~~qC~~C~KsFs  254 (279)
T KOG2462|consen  243 KHQCPRCGKSFA  254 (279)
T ss_pred             cccCcchhhHHH
Confidence            456777766543


No 76 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=64.17  E-value=4.2  Score=37.91  Aligned_cols=30  Identities=27%  Similarity=0.865  Sum_probs=22.5

Q ss_pred             CCCccccCccccccccccccccccce------ecCCCCCC
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQV------FCQLCSSK   62 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~v------fC~~Cs~~   62 (158)
                      +..|..|+.++..    ..|..||..      ||..|...
T Consensus        15 akFC~~CG~~l~~----~~Cp~CG~~~~~~~~fC~~CG~~   50 (645)
T PRK14559         15 NRFCQKCGTSLTH----KPCPQCGTEVPVDEAHCPNCGAE   50 (645)
T ss_pred             CccccccCCCCCC----CcCCCCCCCCCcccccccccCCc
Confidence            4578888888753    368888887      78888765


No 77 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=64.04  E-value=4.6  Score=25.05  Aligned_cols=26  Identities=31%  Similarity=0.689  Sum_probs=16.8

Q ss_pred             CCccccCcccc-cccccccccccccee
Q psy509           30 DTCHRCRTTFS-LVQRKHHCRACGQVF   55 (158)
Q Consensus        30 ~~C~~C~~~F~-~~~RkhhCr~CG~vf   55 (158)
                      ..|..|+..|- .-..+.+|..||..+
T Consensus        21 ~fCP~Cg~~~m~~~~~r~~C~~Cgyt~   47 (50)
T PRK00432         21 KFCPRCGSGFMAEHLDRWHCGKCGYTE   47 (50)
T ss_pred             CcCcCCCcchheccCCcEECCCcCCEE
Confidence            47888887432 224577888888754


No 78 
>PF06221 zf-C2HC5:  Putative zinc finger motif, C2HC5-type;  InterPro: IPR009349 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This zinc finger appears to be common in activating signal cointegrator 1/thyroid receptor interacting protein 4. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=63.57  E-value=2.6  Score=27.07  Aligned_cols=18  Identities=28%  Similarity=0.853  Sum_probs=13.1

Q ss_pred             ccccccccccccceecCC
Q psy509           41 LVQRKHHCRACGQVFCQL   58 (158)
Q Consensus        41 ~~~RkhhCr~CG~vfC~~   58 (158)
                      +|.---+|-+||+|+|..
T Consensus        14 L~~~~~NCl~CGkIiC~~   31 (57)
T PF06221_consen   14 LFPYAPNCLNCGKIICEQ   31 (57)
T ss_pred             CccccccccccChhhccc
Confidence            333356899999999873


No 79 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=63.49  E-value=3.6  Score=23.59  Aligned_cols=13  Identities=38%  Similarity=0.963  Sum_probs=8.8

Q ss_pred             CccccCccccccc
Q psy509           31 TCHRCRTTFSLVQ   43 (158)
Q Consensus        31 ~C~~C~~~F~~~~   43 (158)
                      .|..|+..|.++.
T Consensus         7 ~C~~Cg~~fe~~~   19 (41)
T smart00834        7 RCEDCGHTFEVLQ   19 (41)
T ss_pred             EcCCCCCEEEEEE
Confidence            5777888776543


No 80 
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=63.09  E-value=6.1  Score=27.09  Aligned_cols=31  Identities=19%  Similarity=0.436  Sum_probs=22.6

Q ss_pred             CCCccccCccccccccccccccccceecCCCCC
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSS   61 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~   61 (158)
                      +..|..|+++|+.  ....--.||.+|-..|..
T Consensus        78 ~~~C~vC~k~l~~--~~f~~~p~~~v~H~~C~~  108 (109)
T PF10367_consen   78 STKCSVCGKPLGN--SVFVVFPCGHVVHYSCIK  108 (109)
T ss_pred             CCCccCcCCcCCC--ceEEEeCCCeEEeccccc
Confidence            5689999998863  334445778888888864


No 81 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=62.97  E-value=3.5  Score=25.67  Aligned_cols=23  Identities=35%  Similarity=0.808  Sum_probs=15.7

Q ss_pred             CccccCcccccc--ccccccccccc
Q psy509           31 TCHRCRTTFSLV--QRKHHCRACGQ   53 (158)
Q Consensus        31 ~C~~C~~~F~~~--~RkhhCr~CG~   53 (158)
                      .|..|++.|.+.  .+-..|..||.
T Consensus         8 ~C~~Cg~~~~~~~~~~~irCp~Cg~   32 (49)
T COG1996           8 KCARCGREVELDQETRGIRCPYCGS   32 (49)
T ss_pred             EhhhcCCeeehhhccCceeCCCCCc
Confidence            588999999744  34455666665


No 82 
>COG1439 Predicted nucleic acid-binding protein, consists of a PIN domain and a Zn-ribbon module [General function prediction only]
Probab=61.47  E-value=3.8  Score=32.15  Aligned_cols=21  Identities=38%  Similarity=1.102  Sum_probs=10.9

Q ss_pred             CccccCccccccccccccccccc
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQ   53 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~   53 (158)
                      .|.+|.+.|.  .-++.|..||.
T Consensus       141 rC~GC~~~f~--~~~~~Cp~CG~  161 (177)
T COG1439         141 RCHGCKRIFP--EPKDFCPICGS  161 (177)
T ss_pred             EEecCceecC--CCCCcCCCCCC
Confidence            4555555555  34445555544


No 83 
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=60.64  E-value=3.5  Score=35.37  Aligned_cols=34  Identities=24%  Similarity=0.698  Sum_probs=28.0

Q ss_pred             CCCccccCcccc----------ccccccccccccceecCCCCCC
Q psy509           29 GDTCHRCRTTFS----------LVQRKHHCRACGQVFCQLCSSK   62 (158)
Q Consensus        29 ~~~C~~C~~~F~----------~~~RkhhCr~CG~vfC~~Cs~~   62 (158)
                      +..|..|+-+|-          +...++.|..|..-||..|-..
T Consensus       362 s~~Cf~CQ~~fp~~~~~~~~~~~ss~rY~Ce~CK~~FC~dCdvf  405 (421)
T COG5151         362 STHCFVCQGPFPKPPVSPFDESTSSGRYQCELCKSTFCSDCDVF  405 (421)
T ss_pred             CccceeccCCCCCCCCCcccccccccceechhhhhhhhhhhHHH
Confidence            467999999883          3467899999999999999654


No 84 
>PF00097 zf-C3HC4:  Zinc finger, C3HC4 type (RING finger);  InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C3HC4 type zinc-finger (RING finger) is a cysteine-rich domain of 40 to 60 residues that coordinates two zinc ions, and has the consensus sequence: C-X2-C-X(9-39)-C-X(1-3)-H-X(2-3)-C-X2-C-X(4-48)-C-X2-C where X is any amino acid []. Many proteins containing a RING finger play a key role in the ubiquitination pathway []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1CHC_A 2ECW_A 2Y43_B 1V87_A 2DJB_A 2H0D_B 3RPG_C 3KNV_A 2CKL_B 1JM7_A ....
Probab=60.21  E-value=2.7  Score=24.07  Aligned_cols=30  Identities=30%  Similarity=0.597  Sum_probs=18.5

Q ss_pred             ccccCccccccccccccccccceecCCCCCCcc
Q psy509           32 CHRCRTTFSLVQRKHHCRACGQVFCQLCSSKST   64 (158)
Q Consensus        32 C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~   64 (158)
                      |.+|...|....   .=..||+.||..|.....
T Consensus         1 C~iC~~~~~~~~---~~~~C~H~fC~~C~~~~~   30 (41)
T PF00097_consen    1 CPICLEPFEDPV---ILLPCGHSFCRDCLRKWL   30 (41)
T ss_dssp             ETTTSSBCSSEE---EETTTSEEEEHHHHHHHH
T ss_pred             CCcCCccccCCC---EEecCCCcchHHHHHHHH
Confidence            455655554332   345788888888876653


No 85 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=59.75  E-value=4.5  Score=29.34  Aligned_cols=24  Identities=21%  Similarity=0.515  Sum_probs=16.3

Q ss_pred             CCccccCcccccccccc-ccccccc
Q psy509           30 DTCHRCRTTFSLVQRKH-HCRACGQ   53 (158)
Q Consensus        30 ~~C~~C~~~F~~~~Rkh-hCr~CG~   53 (158)
                      -.|..|+..|....... +|..||.
T Consensus        72 ~~C~~Cg~~~~~~~~~~~~CP~Cgs   96 (117)
T PRK00564         72 LECKDCSHVFKPNALDYGVCEKCHS   96 (117)
T ss_pred             EEhhhCCCccccCCccCCcCcCCCC
Confidence            36889998887754333 4777765


No 86 
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=59.47  E-value=5.5  Score=32.39  Aligned_cols=24  Identities=38%  Similarity=0.773  Sum_probs=19.0

Q ss_pred             CCCccccCcccccccccccccccccee
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVF   55 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vf   55 (158)
                      +..|..|+.   +..|.+.|..||..+
T Consensus       309 S~~C~~cg~---~~~r~~~C~~cg~~~  332 (364)
T COG0675         309 SKTCPCCGH---LSGRLFKCPRCGFVH  332 (364)
T ss_pred             cccccccCC---ccceeEECCCCCCee
Confidence            478999999   446778888888765


No 87 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=59.40  E-value=4.5  Score=29.14  Aligned_cols=24  Identities=21%  Similarity=0.585  Sum_probs=16.8

Q ss_pred             CCccccCccccccccccccccccc
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQ   53 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~   53 (158)
                      -.|..|+..|..-.+..-|..||.
T Consensus        71 ~~C~~Cg~~~~~~~~~~~CP~Cgs   94 (113)
T PRK12380         71 AWCWDCSQVVEIHQHDAQCPHCHG   94 (113)
T ss_pred             EEcccCCCEEecCCcCccCcCCCC
Confidence            368888888876555555777774


No 88 
>PF14353 CpXC:  CpXC protein
Probab=59.38  E-value=4.8  Score=29.16  Aligned_cols=11  Identities=36%  Similarity=1.090  Sum_probs=8.5

Q ss_pred             cccccccccee
Q psy509           45 KHHCRACGQVF   55 (158)
Q Consensus        45 khhCr~CG~vf   55 (158)
                      .+.|..||..|
T Consensus        38 ~~~CP~Cg~~~   48 (128)
T PF14353_consen   38 SFTCPSCGHKF   48 (128)
T ss_pred             EEECCCCCCce
Confidence            57888888865


No 89 
>KOG1356|consensus
Probab=59.31  E-value=4.8  Score=38.51  Aligned_cols=46  Identities=30%  Similarity=0.644  Sum_probs=36.3

Q ss_pred             cccCCCCCCccc-----CCCccccCccccccccccccccccceecCCCCCCcc
Q psy509           17 MFSADTAPEWMD-----GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKST   64 (158)
Q Consensus        17 ~~~~~~~p~W~~-----~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~   64 (158)
                      |....+.+.|..     ...|..|.+  ++|+-.-.|+.||..||-.|...+-
T Consensus       212 ~~~~~~~~a~k~a~~g~~~mC~~C~~--tlfn~hw~C~~C~~~~Cl~C~r~~~  262 (889)
T KOG1356|consen  212 MQRPDQKVAWKRAVKGIREMCDRCET--TLFNIHWRCPRCGFGVCLDCYRKWY  262 (889)
T ss_pred             ccCcccccchhhcccCcchhhhhhcc--cccceeEEccccCCeeeecchhhcc
Confidence            566667788874     357999998  4566567799999999999998874


No 90 
>PF01529 zf-DHHC:  DHHC palmitoyltransferase;  InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the DHHC-type zinc finger domain, which is also known as NEW1 []. The DHHC Zn-finger was first isolated in the Drosophila putative transcription factor DNZ1 and was named after a conserved sequence motif []. This domain has palmitoyltransferase activity; this post-translational modification attaches the C16 saturated fatty acid palmitate via a thioester linkage, predominantly to cysteine residues []. This domain is found in the DHHC proteins which are palmitoyl transferases []; the DHHC motif is found within a cysteine-rich domain which is thought to contain the catalytic site. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=59.11  E-value=4.7  Score=30.18  Aligned_cols=24  Identities=33%  Similarity=0.905  Sum_probs=18.4

Q ss_pred             CCccccCcccccccccccccccccee
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVF   55 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vf   55 (158)
                      ..|..|...  .-.|-|||+.||+.+
T Consensus        49 ~~C~~C~~~--kp~Rs~HC~~C~~CV   72 (174)
T PF01529_consen   49 KYCSTCKII--KPPRSHHCRVCNRCV   72 (174)
T ss_pred             EECcccCCc--CCCcceecccccccc
Confidence            578888753  556899999998764


No 91 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=58.82  E-value=5.7  Score=25.63  Aligned_cols=27  Identities=30%  Similarity=0.968  Sum_probs=18.4

Q ss_pred             ccccccccceecCCCCCCccccCCCCCCCceeeC-hhhHHHHhc
Q psy509           45 KHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVC-EDCHEKFTN   87 (158)
Q Consensus        45 khhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC-~~C~~~l~~   87 (158)
                      ..||.+||..+           |     ...+.| ..|.+.+.+
T Consensus         3 HkHC~~CG~~I-----------p-----~~~~fCS~~C~~~~~k   30 (59)
T PF09889_consen    3 HKHCPVCGKPI-----------P-----PDESFCSPKCREEYRK   30 (59)
T ss_pred             CCcCCcCCCcC-----------C-----cchhhhCHHHHHHHHH
Confidence            46999998742           2     246788 588877654


No 92 
>PRK12496 hypothetical protein; Provisional
Probab=58.57  E-value=5.8  Score=30.47  Aligned_cols=13  Identities=15%  Similarity=0.800  Sum_probs=8.0

Q ss_pred             cccccccccccee
Q psy509           43 QRKHHCRACGQVF   55 (158)
Q Consensus        43 ~RkhhCr~CG~vf   55 (158)
                      +.++.|..||+.|
T Consensus       125 ~w~~~C~gC~~~~  137 (164)
T PRK12496        125 KWRKVCKGCKKKY  137 (164)
T ss_pred             eeeEECCCCCccc
Confidence            3456677777665


No 93 
>cd02341 ZZ_ZZZ3 Zinc finger, ZZ type. Zinc finger present in ZZZ3 (ZZ finger containing 3) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=58.24  E-value=4.4  Score=24.96  Aligned_cols=31  Identities=29%  Similarity=0.759  Sum_probs=21.0

Q ss_pred             CccccCcccccccccccccccc---ceecCCCCCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRACG---QVFCQLCSSK   62 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG---~vfC~~Cs~~   62 (158)
                      .|..|+.. .+...|+||..|.   .-+|..|-..
T Consensus         2 ~Cd~C~~~-pI~G~R~~C~~C~~~d~DlC~~C~~~   35 (48)
T cd02341           2 KCDSCGIE-PIPGTRYHCSECDDGDFDLCQDCVVK   35 (48)
T ss_pred             CCCCCCCC-ccccceEECCCCCCCCCccCHHHHhC
Confidence            47788872 2457889999997   4466666443


No 94 
>PHA02926 zinc finger-like protein; Provisional
Probab=57.78  E-value=1.6  Score=35.58  Aligned_cols=57  Identities=19%  Similarity=0.416  Sum_probs=33.9

Q ss_pred             CCCccccCccc-cc---c-ccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           29 GDTCHRCRTTF-SL---V-QRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        29 ~~~C~~C~~~F-~~---~-~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      ...|.+|-... .-   - +|-..=..|+++||..|-..|..... + ..-.+.|..|...+..
T Consensus       170 E~eCgICmE~I~eK~~~~eRrFGIL~~CnHsFCl~CIr~Wr~~r~-~-~~~~rsCPiCR~~f~~  231 (242)
T PHA02926        170 EKECGICYEVVYSKRLENDRYFGLLDSCNHIFCITCINIWHRTRR-E-TGASDNCPICRTRFRN  231 (242)
T ss_pred             CCCCccCccccccccccccccccccCCCCchHHHHHHHHHHHhcc-c-cCcCCcCCCCcceeee
Confidence            46899997432 10   0 01112248999999999988754321 1 2345778888765543


No 95 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=57.55  E-value=5.3  Score=28.79  Aligned_cols=32  Identities=31%  Similarity=0.862  Sum_probs=18.7

Q ss_pred             cccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHh
Q psy509           42 VQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        42 ~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~   86 (158)
                      +..|+.|..||.-|             |.+++.--||-.|-..+.
T Consensus         6 lGtKR~Cp~CG~kF-------------YDLnk~PivCP~CG~~~~   37 (108)
T PF09538_consen    6 LGTKRTCPSCGAKF-------------YDLNKDPIVCPKCGTEFP   37 (108)
T ss_pred             cCCcccCCCCcchh-------------ccCCCCCccCCCCCCccC
Confidence            34567777777765             333444456777755443


No 96 
>PF04438 zf-HIT:  HIT zinc finger;  InterPro: IPR007529 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the HIT-type zinc finger, which contains 7 conserved cysteines and one histidine that can potentially coordinate two zinc atoms. It has been named after the first protein that originally defined the domain: the yeast HIT1 protein (P46973 from SWISSPROT) []. The HIT-type zinc finger displays some sequence similarities to the MYND-type zinc finger. The function of this domain is unknown but it is mainly found in nuclear proteins involved in gene regulation and chromatin remodeling. This domain is also found in the thyroid receptor interacting protein 3 (TRIP-3) Q15649 from SWISSPROT, that specifically interacts with the ligand binding domain of the thyroid receptor. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2YQP_A 2YQQ_A 1X4S_A.
Probab=57.49  E-value=6.1  Score=21.89  Aligned_cols=22  Identities=32%  Similarity=0.946  Sum_probs=14.6

Q ss_pred             CccccCccccccccccccccccceecC
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVFCQ   57 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vfC~   57 (158)
                      .|.+|+.     ..++.|..||..+|+
T Consensus         4 ~C~vC~~-----~~kY~Cp~C~~~~CS   25 (30)
T PF04438_consen    4 LCSVCGN-----PAKYRCPRCGARYCS   25 (30)
T ss_dssp             EETSSSS-----EESEE-TTT--EESS
T ss_pred             CCccCcC-----CCEEECCCcCCceeC
Confidence            5777776     467889999999886


No 97 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=57.17  E-value=5  Score=23.72  Aligned_cols=12  Identities=25%  Similarity=0.916  Sum_probs=6.6

Q ss_pred             CccccCcccccc
Q psy509           31 TCHRCRTTFSLV   42 (158)
Q Consensus        31 ~C~~C~~~F~~~   42 (158)
                      .|..|+..|..+
T Consensus         7 ~C~~Cg~~fe~~   18 (42)
T PF09723_consen    7 RCEECGHEFEVL   18 (42)
T ss_pred             EeCCCCCEEEEE
Confidence            455666666543


No 98 
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones]
Probab=57.04  E-value=2.5  Score=35.13  Aligned_cols=48  Identities=27%  Similarity=0.595  Sum_probs=30.7

Q ss_pred             CCCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHh
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~   86 (158)
                      +-.|..|-..-    -.--|..||++||..|.-...      ..+..-.|..|.++..
T Consensus       215 d~kC~lC~e~~----~~ps~t~CgHlFC~~Cl~~~~------t~~k~~~CplCRak~~  262 (271)
T COG5574         215 DYKCFLCLEEP----EVPSCTPCGHLFCLSCLLISW------TKKKYEFCPLCRAKVY  262 (271)
T ss_pred             ccceeeeeccc----CCcccccccchhhHHHHHHHH------HhhccccCchhhhhcc
Confidence            45788886533    234688999999999975510      1233345777776643


No 99 
>KOG2884|consensus
Probab=56.44  E-value=6.7  Score=32.05  Aligned_cols=22  Identities=36%  Similarity=0.524  Sum_probs=16.6

Q ss_pred             hhcchHHHHHHHHhcHHHHhhc
Q psy509          133 ELKEEEELQLALALSQSEAESN  154 (158)
Q Consensus       133 ~~~eeedl~~aia~Sl~e~e~~  154 (158)
                      +..+|.||.+||++|+.|..++
T Consensus       212 dp~~DPELAlALRlSMEEer~r  233 (259)
T KOG2884|consen  212 DPEDDPELALALRLSMEEERAR  233 (259)
T ss_pred             CcccCHHHHHHHHhhHHHHHHH
Confidence            4456888999999998876554


No 100
>PF09947 DUF2180:  Uncharacterized protein conserved in archaea (DUF2180);  InterPro: IPR017211 This group represents a predicted zinc finger protein, AF1427 type.
Probab=55.92  E-value=6.6  Score=26.11  Aligned_cols=41  Identities=24%  Similarity=0.588  Sum_probs=26.1

Q ss_pred             cccccccceecCCCCCCcc-cc-------C--CCCCCCceeeChhhHHHHh
Q psy509           46 HHCRACGQVFCQLCSSKST-SL-------P--KFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        46 hhCr~CG~vfC~~Cs~~~~-~l-------p--~~~~~~~~RVC~~C~~~l~   86 (158)
                      --|..||.-+|...+.... ++       |  .....-|.-+|..|+..+.
T Consensus        17 avCivCG~GlC~~H~~~e~~~~~~g~yp~~~~~~~~~l~RilC~~C~~a~~   67 (68)
T PF09947_consen   17 AVCIVCGAGLCMDHSKREEIPVWEGGYPFPSKKLKKPLPRILCPECHAALK   67 (68)
T ss_pred             ehHHhcCchhhHHHHhhhheeeeccCCCCccccccCCCCeeecHHHHHHhh
Confidence            4588999999998877521 11       1  1111235568999998653


No 101
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=54.89  E-value=6.1  Score=23.60  Aligned_cols=30  Identities=27%  Similarity=0.804  Sum_probs=22.5

Q ss_pred             CccccCccccccccccccccc-cceecCCCCCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRAC-GQVFCQLCSSK   62 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~C-G~vfC~~Cs~~   62 (158)
                      .|.+|++  .++..|++|..| ..-+|..|-..
T Consensus         2 ~Cd~C~~--~i~G~ry~C~~C~d~dLC~~C~~~   32 (43)
T cd02340           2 ICDGCQG--PIVGVRYKCLVCPDYDLCESCEAK   32 (43)
T ss_pred             CCCCCCC--cCcCCeEECCCCCCccchHHhhCc
Confidence            5888988  456778999999 45677777554


No 102
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=54.88  E-value=7.5  Score=32.26  Aligned_cols=30  Identities=23%  Similarity=0.670  Sum_probs=23.5

Q ss_pred             cCCCccccCcccc-------ccccccccccccceecC
Q psy509           28 DGDTCHRCRTTFS-------LVQRKHHCRACGQVFCQ   57 (158)
Q Consensus        28 ~~~~C~~C~~~F~-------~~~RkhhCr~CG~vfC~   57 (158)
                      +...|..|.++|.       +-.-..||..||+.|=+
T Consensus       131 eVSRCr~C~~rYDPVP~dkmwG~aef~C~~C~h~F~G  167 (278)
T PF15135_consen  131 EVSRCRKCRKRYDPVPCDKMWGIAEFHCPKCRHNFRG  167 (278)
T ss_pred             ccccccccccccCCCccccccceeeeecccccccchh
Confidence            4678999999986       34567999999998743


No 103
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=54.55  E-value=7.8  Score=21.86  Aligned_cols=23  Identities=26%  Similarity=0.735  Sum_probs=13.7

Q ss_pred             CccccCccccccc-cccccccccc
Q psy509           31 TCHRCRTTFSLVQ-RKHHCRACGQ   53 (158)
Q Consensus        31 ~C~~C~~~F~~~~-RkhhCr~CG~   53 (158)
                      .|..|+..|.+-. -...|+.||.
T Consensus         2 ~C~~Cg~~~~~~~~~~irC~~CG~   25 (32)
T PF03604_consen    2 ICGECGAEVELKPGDPIRCPECGH   25 (32)
T ss_dssp             BESSSSSSE-BSTSSTSSBSSSS-
T ss_pred             CCCcCCCeeEcCCCCcEECCcCCC
Confidence            4778888877432 2457777775


No 104
>COG1773 Rubredoxin [Energy production and conversion]
Probab=54.05  E-value=5.8  Score=25.27  Aligned_cols=13  Identities=31%  Similarity=0.981  Sum_probs=11.0

Q ss_pred             cccccccccceec
Q psy509           44 RKHHCRACGQVFC   56 (158)
Q Consensus        44 RkhhCr~CG~vfC   56 (158)
                      +++.|+.||.||=
T Consensus         2 ~~~~C~~CG~vYd   14 (55)
T COG1773           2 KRWRCSVCGYVYD   14 (55)
T ss_pred             CceEecCCceEec
Confidence            5789999999973


No 105
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=54.05  E-value=6.4  Score=29.28  Aligned_cols=12  Identities=33%  Similarity=0.875  Sum_probs=7.2

Q ss_pred             CccccCcccccc
Q psy509           31 TCHRCRTTFSLV   42 (158)
Q Consensus        31 ~C~~C~~~F~~~   42 (158)
                      .|..|+..|.+-
T Consensus        72 ~C~~CG~~~~~~   83 (135)
T PRK03824         72 KCRNCGNEWSLK   83 (135)
T ss_pred             ECCCCCCEEecc
Confidence            466666666543


No 106
>COG4855 Uncharacterized protein conserved in archaea [Function unknown]
Probab=53.60  E-value=2.7  Score=28.02  Aligned_cols=64  Identities=22%  Similarity=0.458  Sum_probs=38.9

Q ss_pred             CCcccCCCccccCccccccccccccccccceecCCCCCCc-ccc-------C--CCCCCCceeeChhhHHHHhc
Q psy509           24 PEWMDGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKS-TSL-------P--KFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        24 p~W~~~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~-~~l-------p--~~~~~~~~RVC~~C~~~l~~   87 (158)
                      +.|-+--.|..|...=.-..----|-.||.-+|....-+. .++       |  ...-.-|.-+|..|++.+..
T Consensus         2 ~~~~~~mKCY~C~eeGKDtdAV~iCIVCG~GlC~EHli~eE~p~w~G~YP~p~k~~K~~lpRilC~~C~~a~~e   75 (76)
T COG4855           2 LRWSNMMKCYDCAEEGKDTDAVGICIVCGMGLCMEHLIREETPMWGGGYPFPAKKLKKTLPRILCVECHEAIKE   75 (76)
T ss_pred             cchhhhhHHHHHHHhCCCcccEEEEEEeCchHHHHHHHhhhcccccCCCCCcchhhhccCCceeeHHHHHHhhc
Confidence            4566666677775432233334568899999988776542 111       1  11223567899999998753


No 107
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=53.15  E-value=6.4  Score=21.76  Aligned_cols=25  Identities=28%  Similarity=0.698  Sum_probs=12.5

Q ss_pred             eecCCCCCCccccCCCCCCCceeeChhhH
Q psy509           54 VFCQLCSSKSTSLPKFGIEKEVRVCEDCH   82 (158)
Q Consensus        54 vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~   82 (158)
                      -||..|.......+    ..-.|+|..|-
T Consensus         4 rfC~~CG~~t~~~~----~g~~r~C~~Cg   28 (32)
T PF09297_consen    4 RFCGRCGAPTKPAP----GGWARRCPSCG   28 (32)
T ss_dssp             SB-TTT--BEEE-S----SSS-EEESSSS
T ss_pred             cccCcCCccccCCC----CcCEeECCCCc
Confidence            36777766654443    24578888874


No 108
>KOG3576|consensus
Probab=52.96  E-value=3.8  Score=33.23  Aligned_cols=53  Identities=30%  Similarity=0.630  Sum_probs=35.3

Q ss_pred             CCccccCccccc------------cccccccccccceecCCCCCCc--cccCC----CC---CCCceeeChhhH
Q psy509           30 DTCHRCRTTFSL------------VQRKHHCRACGQVFCQLCSSKS--TSLPK----FG---IEKEVRVCEDCH   82 (158)
Q Consensus        30 ~~C~~C~~~F~~------------~~RkhhCr~CG~vfC~~Cs~~~--~~lp~----~~---~~~~~RVC~~C~   82 (158)
                      ..|..|++.|+-            -.|-+.|..|++.|-..|+-..  ..+-+    +.   ....+-||..|-
T Consensus       146 ~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg  219 (267)
T KOG3576|consen  146 HLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCG  219 (267)
T ss_pred             HHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccC
Confidence            469999999962            2456789999999999998531  01111    11   134578999984


No 109
>PRK14873 primosome assembly protein PriA; Provisional
Probab=51.83  E-value=8.6  Score=35.96  Aligned_cols=40  Identities=28%  Similarity=0.651  Sum_probs=25.6

Q ss_pred             CccccCcccccc--ccccccccccce----ecCCCCCCccccCCCC
Q psy509           31 TCHRCRTTFSLV--QRKHHCRACGQV----FCQLCSSKSTSLPKFG   70 (158)
Q Consensus        31 ~C~~C~~~F~~~--~RkhhCr~CG~v----fC~~Cs~~~~~lp~~~   70 (158)
                      .|..|+...++-  .+.-.|++||..    .|..|.+..+..-++|
T Consensus       394 ~C~~C~~~L~~h~~~~~l~Ch~CG~~~~p~~Cp~Cgs~~l~~~g~G  439 (665)
T PRK14873        394 RCRHCTGPLGLPSAGGTPRCRWCGRAAPDWRCPRCGSDRLRAVVVG  439 (665)
T ss_pred             ECCCCCCceeEecCCCeeECCCCcCCCcCccCCCCcCCcceeeecc
Confidence            455666655553  335779999985    6889988754443433


No 110
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=51.81  E-value=7.7  Score=28.90  Aligned_cols=31  Identities=23%  Similarity=0.475  Sum_probs=19.9

Q ss_pred             cccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHH
Q psy509           42 VQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKF   85 (158)
Q Consensus        42 ~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l   85 (158)
                      +..|+.|..||.-|             |.+++.-.||..|-...
T Consensus         6 lGtKr~Cp~cg~kF-------------YDLnk~p~vcP~cg~~~   36 (129)
T TIGR02300         6 LGTKRICPNTGSKF-------------YDLNRRPAVSPYTGEQF   36 (129)
T ss_pred             hCccccCCCcCccc-------------cccCCCCccCCCcCCcc
Confidence            34577888888765             33455566777776554


No 111
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=51.44  E-value=7.9  Score=28.97  Aligned_cols=25  Identities=20%  Similarity=0.870  Sum_probs=15.4

Q ss_pred             CccccCcccccc--------cccccccccccee
Q psy509           31 TCHRCRTTFSLV--------QRKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~~--------~RkhhCr~CG~vf   55 (158)
                      .|..|+..|++.        .++..|..||..+
T Consensus       101 ~Cp~C~~~y~~~ea~~~~d~~~~f~Cp~Cg~~l  133 (147)
T smart00531      101 KCPNCQSKYTFLEANQLLDMDGTFTCPRCGEEL  133 (147)
T ss_pred             ECcCCCCEeeHHHHHHhcCCCCcEECCCCCCEE
Confidence            588888888742        2235666666554


No 112
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=51.24  E-value=7.7  Score=27.34  Aligned_cols=15  Identities=40%  Similarity=0.946  Sum_probs=10.4

Q ss_pred             cccccccccccccee
Q psy509           41 LVQRKHHCRACGQVF   55 (158)
Q Consensus        41 ~~~RkhhCr~CG~vf   55 (158)
                      ++.+--.|+.||..|
T Consensus        54 Llv~Pa~CkkCGfef   68 (97)
T COG3357          54 LLVRPARCKKCGFEF   68 (97)
T ss_pred             EEecChhhcccCccc
Confidence            455666777777776


No 113
>smart00291 ZnF_ZZ Zinc-binding domain, present in Dystrophin, CREB-binding protein. Putative zinc-binding domain present in dystrophin-like proteins,  and CREB-binding protein/p300 homologues. The ZZ in dystrophin appears to bind calmodulin. A missense mutation of one of the conserved cysteines in dystrophin results in a patient with Duchenne muscular dystrophy [3].
Probab=51.10  E-value=7.2  Score=23.20  Aligned_cols=21  Identities=29%  Similarity=0.795  Sum_probs=14.6

Q ss_pred             CCccccCcccccccccccccccc
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACG   52 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG   52 (158)
                      ..|..|++.  +...+++|..|.
T Consensus         5 ~~C~~C~~~--i~g~ry~C~~C~   25 (44)
T smart00291        5 YSCDTCGKP--IVGVRYHCLVCP   25 (44)
T ss_pred             cCCCCCCCC--CcCCEEECCCCC
Confidence            368888883  456677888773


No 114
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=50.73  E-value=8.5  Score=22.78  Aligned_cols=16  Identities=31%  Similarity=0.941  Sum_probs=10.2

Q ss_pred             ccccccccceecCCCC
Q psy509           45 KHHCRACGQVFCQLCS   60 (158)
Q Consensus        45 khhCr~CG~vfC~~Cs   60 (158)
                      ...|+.||..||...-
T Consensus        13 ~~~C~~C~~~FC~~Hr   28 (43)
T PF01428_consen   13 PFKCKHCGKSFCLKHR   28 (43)
T ss_dssp             HEE-TTTS-EE-TTTH
T ss_pred             CeECCCCCcccCcccc
Confidence            4679999999998653


No 115
>KOG3362|consensus
Probab=50.48  E-value=8  Score=29.50  Aligned_cols=31  Identities=26%  Similarity=0.753  Sum_probs=21.9

Q ss_pred             CCCccc-CCCccccCccccccccccccccccceecCC
Q psy509           23 APEWMD-GDTCHRCRTTFSLVQRKHHCRACGQVFCQL   58 (158)
Q Consensus        23 ~p~W~~-~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~   58 (158)
                      +|...| ...|.+||     +-.++-|-+||.-+|.-
T Consensus       111 ~p~~KP~r~fCaVCG-----~~S~ysC~~CG~kyCsv  142 (156)
T KOG3362|consen  111 KPSFKPLRKFCAVCG-----YDSKYSCVNCGTKYCSV  142 (156)
T ss_pred             CCCCCCcchhhhhcC-----CCchhHHHhcCCceeec
Confidence            344444 46899998     23567899999988863


No 116
>cd02249 ZZ Zinc finger, ZZ type. Zinc finger present in dystrophin, CBP/p300 and many other proteins. The ZZ motif coordinates one or two zinc ions and most likely participates in ligand binding or molecular scaffolding. Many proteins containing ZZ motifs have other zinc-binding motifs as well, and the majority serve as scaffolds in pathways involving acetyltransferase, protein kinase, or ubiqitin-related activity. ZZ proteins can be grouped into the following functional classes: chromatin modifying, cytoskeletal scaffolding, ubiquitin binding or conjugating, and membrane receptor or ion-channel modifying proteins.
Probab=50.27  E-value=6.9  Score=23.42  Aligned_cols=30  Identities=30%  Similarity=0.800  Sum_probs=19.9

Q ss_pred             CccccCcccccccccccccccc-ceecCCCCCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRACG-QVFCQLCSSK   62 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG-~vfC~~Cs~~   62 (158)
                      .|..|++  .+...+.+|..|. ..+|..|-..
T Consensus         2 ~C~~C~~--~i~g~r~~C~~C~d~dLC~~Cf~~   32 (46)
T cd02249           2 SCDGCLK--PIVGVRYHCLVCEDFDLCSSCYAK   32 (46)
T ss_pred             CCcCCCC--CCcCCEEECCCCCCCcCHHHHHCc
Confidence            4888888  3455788888886 3355555443


No 117
>KOG2462|consensus
Probab=50.24  E-value=6  Score=33.14  Aligned_cols=26  Identities=35%  Similarity=0.904  Sum_probs=18.7

Q ss_pred             CCccccCcccc---cc---------cccccccccccee
Q psy509           30 DTCHRCRTTFS---LV---------QRKHHCRACGQVF   55 (158)
Q Consensus        30 ~~C~~C~~~F~---~~---------~RkhhCr~CG~vf   55 (158)
                      -.|.+|++.|+   ++         .+-.-|..||+.|
T Consensus       188 c~C~iCGKaFSRPWLLQGHiRTHTGEKPF~C~hC~kAF  225 (279)
T KOG2462|consen  188 CECGICGKAFSRPWLLQGHIRTHTGEKPFSCPHCGKAF  225 (279)
T ss_pred             cccccccccccchHHhhcccccccCCCCccCCcccchh
Confidence            37889999998   22         3446688888877


No 118
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=50.00  E-value=8.6  Score=28.76  Aligned_cols=25  Identities=32%  Similarity=0.915  Sum_probs=16.8

Q ss_pred             CCCccccCccccccccccccccccceecCCCCC
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSS   61 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~   61 (158)
                      +.+|..|+.+.  |.      .=|.|||..|-.
T Consensus        28 ~~hCp~Cg~PL--F~------KdG~v~CPvC~~   52 (131)
T COG1645          28 AKHCPKCGTPL--FR------KDGEVFCPVCGY   52 (131)
T ss_pred             HhhCcccCCcc--ee------eCCeEECCCCCc
Confidence            46899999863  32      347777777764


No 119
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=49.76  E-value=9.4  Score=26.62  Aligned_cols=24  Identities=21%  Similarity=0.566  Sum_probs=14.8

Q ss_pred             CccccCccccccccccccccccce
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV   54 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v   54 (158)
                      .|..|+..+....-...|+.||..
T Consensus         2 fC~~Cg~~l~~~~~~~~C~~C~~~   25 (104)
T TIGR01384         2 FCPKCGSLMTPKNGVYVCPSCGYE   25 (104)
T ss_pred             CCcccCcccccCCCeEECcCCCCc
Confidence            477788776544445566666654


No 120
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=49.69  E-value=7.7  Score=31.29  Aligned_cols=28  Identities=21%  Similarity=0.634  Sum_probs=15.3

Q ss_pred             CCccccC-ccccccc-----cccccccccceecC
Q psy509           30 DTCHRCR-TTFSLVQ-----RKHHCRACGQVFCQ   57 (158)
Q Consensus        30 ~~C~~C~-~~F~~~~-----RkhhCr~CG~vfC~   57 (158)
                      ..|..|- +.|.++.     .-.+|+.||..+..
T Consensus        14 ~lC~~C~~~~~~i~ei~~~i~v~~C~~Cg~~~~~   47 (236)
T PF04981_consen   14 GLCPDCYLKRFDIIEIPDRIEVTICPKCGRYRIG   47 (236)
T ss_pred             ccChHHhcccCCeeecCCccCceECCCCCCEECC
Confidence            4566664 2333332     33567777777655


No 121
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=49.63  E-value=6.9  Score=23.57  Aligned_cols=16  Identities=19%  Similarity=0.536  Sum_probs=12.8

Q ss_pred             cCCCccccCccccccc
Q psy509           28 DGDTCHRCRTTFSLVQ   43 (158)
Q Consensus        28 ~~~~C~~C~~~F~~~~   43 (158)
                      +...|..|+++|++-.
T Consensus         7 p~K~C~~C~rpf~WRK   22 (42)
T PF10013_consen    7 PSKICPVCGRPFTWRK   22 (42)
T ss_pred             CCCcCcccCCcchHHH
Confidence            4678999999998653


No 122
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=49.58  E-value=7.6  Score=29.05  Aligned_cols=24  Identities=25%  Similarity=0.664  Sum_probs=12.3

Q ss_pred             CCccccCcccccc--ccccccccccc
Q psy509           30 DTCHRCRTTFSLV--QRKHHCRACGQ   53 (158)
Q Consensus        30 ~~C~~C~~~F~~~--~RkhhCr~CG~   53 (158)
                      +.|..|++.|---  .=...|..||.
T Consensus         2 H~Ct~Cg~~f~dgs~eil~GCP~CGg   27 (131)
T PF09845_consen    2 HQCTKCGRVFEDGSKEILSGCPECGG   27 (131)
T ss_pred             cccCcCCCCcCCCcHHHHccCcccCC
Confidence            3566666666421  22345666654


No 123
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=49.53  E-value=8.2  Score=27.84  Aligned_cols=24  Identities=21%  Similarity=0.672  Sum_probs=15.0

Q ss_pred             CCccccCccccccccc-cccccccc
Q psy509           30 DTCHRCRTTFSLVQRK-HHCRACGQ   53 (158)
Q Consensus        30 ~~C~~C~~~F~~~~Rk-hhCr~CG~   53 (158)
                      -.|..|+..|....+. ..|..||.
T Consensus        71 ~~C~~Cg~~~~~~~~~~~~CP~Cgs   95 (114)
T PRK03681         71 CWCETCQQYVTLLTQRVRRCPQCHG   95 (114)
T ss_pred             EEcccCCCeeecCCccCCcCcCcCC
Confidence            3688888777654332 44776664


No 124
>KOG1311|consensus
Probab=49.34  E-value=8  Score=32.03  Aligned_cols=24  Identities=25%  Similarity=0.703  Sum_probs=18.4

Q ss_pred             CCccccCcccccccccccccccccee
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVF   55 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vf   55 (158)
                      ..|..|..-  .-.|-|||+.|+.-+
T Consensus       114 ~~C~~C~~~--rPpRs~HCsvC~~CV  137 (299)
T KOG1311|consen  114 KYCDTCQLY--RPPRSSHCSVCNNCV  137 (299)
T ss_pred             EEcCcCccc--CCCCcccchhhcccc
Confidence            578888763  567889999998754


No 125
>PF10170 C6_DPF:  Cysteine-rich domain;  InterPro: IPR018785  This entry represents the N-terminal approximately 100 amino acids of a family of proteins found in a range of organisms, including human, chicken and Drosophila [, , ]. It contains between six and eight highly conserved cysteine residues and a characteristic DPF sequence motif. One member is putatively named as receptor for egg jelly protein but this could not confirmed. 
Probab=49.11  E-value=9.7  Score=27.05  Aligned_cols=35  Identities=26%  Similarity=0.529  Sum_probs=25.9

Q ss_pred             cccccccccccceecCC--CCCCccccCCCCCCCceeeChhhHHHHh
Q psy509           42 VQRKHHCRACGQVFCQL--CSSKSTSLPKFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        42 ~~RkhhCr~CG~vfC~~--Cs~~~~~lp~~~~~~~~RVC~~C~~~l~   86 (158)
                      +.---+|..||+.+|..  ||-+.          ..|.|..|...-.
T Consensus        46 LvLGa~CS~C~~~VC~~~~CSlFY----------tkrFC~pC~~~~~   82 (97)
T PF10170_consen   46 LVLGAPCSICGKPVCVGQDCSLFY----------TKRFCLPCVKRNL   82 (97)
T ss_pred             EEECccccccCCceEcCCCccEEe----------eCceeHHHHHHHH
Confidence            33346899999999964  88664          3589999987643


No 126
>PF13920 zf-C3HC4_3:  Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A ....
Probab=48.36  E-value=1  Score=27.33  Aligned_cols=44  Identities=20%  Similarity=0.608  Sum_probs=26.7

Q ss_pred             CCccccCccccccccccccccccce-ecCCCCCCccccCCCCCCCceeeChhhHHHH
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQV-FCQLCSSKSTSLPKFGIEKEVRVCEDCHEKF   85 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~v-fC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l   85 (158)
                      ..|.+|...+.    ...-..||+. ||..|......        ..+.|..|...+
T Consensus         3 ~~C~iC~~~~~----~~~~~pCgH~~~C~~C~~~~~~--------~~~~CP~Cr~~i   47 (50)
T PF13920_consen    3 EECPICFENPR----DVVLLPCGHLCFCEECAERLLK--------RKKKCPICRQPI   47 (50)
T ss_dssp             SB-TTTSSSBS----SEEEETTCEEEEEHHHHHHHHH--------TTSBBTTTTBB-
T ss_pred             CCCccCCccCC----ceEEeCCCChHHHHHHhHHhcc--------cCCCCCcCChhh
Confidence            46888877653    2344569999 99999876532        234555555433


No 127
>PRK11595 DNA utilization protein GntX; Provisional
Probab=48.19  E-value=4.6  Score=32.30  Aligned_cols=31  Identities=29%  Similarity=0.718  Sum_probs=23.2

Q ss_pred             CCccccCccccccccccccccccce------ecCCCCCC
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQV------FCQLCSSK   62 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~v------fC~~Cs~~   62 (158)
                      ..|..|...|.++  .++|..||..      +|..|...
T Consensus        21 ~lC~~C~~~l~~~--~~~C~~Cg~~~~~~~~~C~~C~~~   57 (227)
T PRK11595         21 GICSVCSRALRTL--KTCCPQCGLPATHPHLPCGRCLQK   57 (227)
T ss_pred             cccHHHHhhCCcc--cCcCccCCCcCCCCCCCcHHHHcC
Confidence            3688888888765  5789999974      48888654


No 128
>PF15227 zf-C3HC4_4:  zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A.
Probab=47.89  E-value=4.4  Score=23.95  Aligned_cols=16  Identities=31%  Similarity=0.854  Sum_probs=12.5

Q ss_pred             ccccceecCCCCCCcc
Q psy509           49 RACGQVFCQLCSSKST   64 (158)
Q Consensus        49 r~CG~vfC~~Cs~~~~   64 (158)
                      -.||++||..|.....
T Consensus        14 l~CGH~FC~~Cl~~~~   29 (42)
T PF15227_consen   14 LPCGHSFCRSCLERLW   29 (42)
T ss_dssp             -SSSSEEEHHHHHHHH
T ss_pred             cCCcCHHHHHHHHHHH
Confidence            4799999999977653


No 129
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=47.63  E-value=13  Score=33.54  Aligned_cols=39  Identities=23%  Similarity=0.654  Sum_probs=24.6

Q ss_pred             CccccCccccc--cccccccccccce-----ecCCCCCCccccCCC
Q psy509           31 TCHRCRTTFSL--VQRKHHCRACGQV-----FCQLCSSKSTSLPKF   69 (158)
Q Consensus        31 ~C~~C~~~F~~--~~RkhhCr~CG~v-----fC~~Cs~~~~~lp~~   69 (158)
                      .|..|+...++  -.++-.|..||..     .|..|.+..+...++
T Consensus       224 ~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~C~s~~l~~~g~  269 (505)
T TIGR00595       224 CCPNCDVSLTYHKKEGKLRCHYCGYQEPIPKTCPQCGSEDLVYKGY  269 (505)
T ss_pred             CCCCCCCceEEecCCCeEEcCCCcCcCCCCCCCCCCCCCeeEeecc
Confidence            35566654443  3456788888887     688888765443333


No 130
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=47.58  E-value=9.8  Score=28.42  Aligned_cols=23  Identities=30%  Similarity=1.107  Sum_probs=18.7

Q ss_pred             CCccccCccccccccccccccccceecC
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVFCQ   57 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vfC~   57 (158)
                      ..|..|+..|.|.    -| .||+++|.
T Consensus        78 PgCP~CGn~~~fa----~C-~CGkl~Ci  100 (131)
T PF15616_consen   78 PGCPHCGNQYAFA----VC-GCGKLFCI  100 (131)
T ss_pred             CCCCCCcChhcEE----Ee-cCCCEEEe
Confidence            5799999988775    35 79999985


No 131
>PRK04023 DNA polymerase II large subunit; Validated
Probab=47.42  E-value=12  Score=36.67  Aligned_cols=30  Identities=23%  Similarity=0.609  Sum_probs=22.5

Q ss_pred             CCCccccCccccccccccccccccce-----ecCCCCCC
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQV-----FCQLCSSK   62 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~v-----fC~~Cs~~   62 (158)
                      ...|..|++..    -...|..||..     ||..|-..
T Consensus       626 ~RfCpsCG~~t----~~frCP~CG~~Te~i~fCP~CG~~  660 (1121)
T PRK04023        626 RRKCPSCGKET----FYRRCPFCGTHTEPVYRCPRCGIE  660 (1121)
T ss_pred             CccCCCCCCcC----CcccCCCCCCCCCcceeCccccCc
Confidence            46899999974    23589999964     89998443


No 132
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=47.39  E-value=8.1  Score=30.09  Aligned_cols=25  Identities=24%  Similarity=0.866  Sum_probs=19.0

Q ss_pred             CccccCccccc---ccccccccccccee
Q psy509           31 TCHRCRTTFSL---VQRKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~---~~RkhhCr~CG~vf   55 (158)
                      .|..|+..|++   +.--.+|..||...
T Consensus       119 ~Cp~C~~rytf~eA~~~~F~Cp~Cg~~L  146 (178)
T PRK06266        119 FCPNCHIRFTFDEAMEYGFRCPQCGEML  146 (178)
T ss_pred             ECCCCCcEEeHHHHhhcCCcCCCCCCCC
Confidence            69999999985   35567888888753


No 133
>PF04277 OAD_gamma:  Oxaloacetate decarboxylase, gamma chain ;  InterPro: IPR005899  This family comprises distantly related, low complexity, hydrophobic small subunits of several related sodium ion-pumping decarboxylases. These include oxaloacetate decarboxylase gamma subunit and methylmalonyl-CoA decarboxylase delta subunit [].; GO: 0008948 oxaloacetate decarboxylase activity, 0015081 sodium ion transmembrane transporter activity, 0071436 sodium ion export, 0016020 membrane
Probab=47.12  E-value=29  Score=22.75  Aligned_cols=19  Identities=21%  Similarity=0.268  Sum_probs=16.9

Q ss_pred             chHHHHHHHHhcHHHHhhc
Q psy509          136 EEEELQLALALSQSEAESN  154 (158)
Q Consensus       136 eeedl~~aia~Sl~e~e~~  154 (158)
                      +|+++-+||+++++.++.|
T Consensus        61 ~~~~~vAaI~AAi~~~~~~   79 (79)
T PF04277_consen   61 DDPELVAAIAAAIAAYRRQ   79 (79)
T ss_pred             CChHHHHHHHHHHHHHHhC
Confidence            6899999999999988765


No 134
>PHA02942 putative transposase; Provisional
Probab=47.08  E-value=15  Score=31.89  Aligned_cols=28  Identities=25%  Similarity=0.719  Sum_probs=19.7

Q ss_pred             cCCCccccCccc-ccccccccccccccee
Q psy509           28 DGDTCHRCRTTF-SLVQRKHHCRACGQVF   55 (158)
Q Consensus        28 ~~~~C~~C~~~F-~~~~RkhhCr~CG~vf   55 (158)
                      .+..|..|+..= .+-.|.+.|..||...
T Consensus       324 TSq~Cs~CG~~~~~l~~r~f~C~~CG~~~  352 (383)
T PHA02942        324 SSVSCPKCGHKMVEIAHRYFHCPSCGYEN  352 (383)
T ss_pred             CCccCCCCCCccCcCCCCEEECCCCCCEe
Confidence            467899998532 2345778899998864


No 135
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=47.04  E-value=8.2  Score=22.16  Aligned_cols=8  Identities=38%  Similarity=1.294  Sum_probs=2.7

Q ss_pred             eeeChhhH
Q psy509           75 VRVCEDCH   82 (158)
Q Consensus        75 ~RVC~~C~   82 (158)
                      .+||+.|.
T Consensus        24 ~~VCD~CR   31 (34)
T PF01286_consen   24 LPVCDKCR   31 (34)
T ss_dssp             -S--TTT-
T ss_pred             cccccccc
Confidence            46777664


No 136
>KOG2935|consensus
Probab=46.97  E-value=16  Score=30.54  Aligned_cols=17  Identities=53%  Similarity=0.718  Sum_probs=10.6

Q ss_pred             cchHHHHHHHHhcHHHH
Q psy509          135 KEEEELQLALALSQSEA  151 (158)
Q Consensus       135 ~eeedl~~aia~Sl~e~  151 (158)
                      ++|+||++|+|+|..|.
T Consensus       217 q~e~d~a~a~a~s~~et  233 (315)
T KOG2935|consen  217 QDEEDLARALALSRQET  233 (315)
T ss_pred             cchHHHHHHHHHHHhhh
Confidence            56666666666665443


No 137
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=46.77  E-value=10  Score=28.03  Aligned_cols=25  Identities=24%  Similarity=0.743  Sum_probs=14.8

Q ss_pred             CccccCcccccccc----cccccccccee
Q psy509           31 TCHRCRTTFSLVQR----KHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~~~R----khhCr~CG~vf   55 (158)
                      .|..|+..+...+|    ++.|+.||..+
T Consensus       125 ~C~~C~~~~~r~~~~~~~~~~C~~C~~~l  153 (157)
T PF10263_consen  125 RCPSCGREYKRHRRSKRKRYRCGRCGGPL  153 (157)
T ss_pred             EcCCCCCEeeeecccchhhEECCCCCCEE
Confidence            57777766543322    45677777654


No 138
>KOG3795|consensus
Probab=46.39  E-value=8.8  Score=30.39  Aligned_cols=24  Identities=25%  Similarity=0.784  Sum_probs=19.1

Q ss_pred             cccccccccccccccce---ecCCCCC
Q psy509           38 TFSLVQRKHHCRACGQV---FCQLCSS   61 (158)
Q Consensus        38 ~F~~~~RkhhCr~CG~v---fC~~Cs~   61 (158)
                      .|.....||.|+.||..   ||-.|.-
T Consensus         8 ~~d~ieGRs~C~~C~~SRkFfCY~C~V   34 (230)
T KOG3795|consen    8 SFDPIEGRSTCPGCKSSRKFFCYDCRV   34 (230)
T ss_pred             ccCcccccccCCCCCCcceEEEEeecc
Confidence            45667889999999875   9998864


No 139
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=45.96  E-value=10  Score=21.62  Aligned_cols=7  Identities=43%  Similarity=1.345  Sum_probs=3.1

Q ss_pred             ecCCCCC
Q psy509           55 FCQLCSS   61 (158)
Q Consensus        55 fC~~Cs~   61 (158)
                      ||..|.+
T Consensus         3 FCp~C~n    9 (35)
T PF02150_consen    3 FCPECGN    9 (35)
T ss_dssp             BETTTTS
T ss_pred             eCCCCCc
Confidence            4444443


No 140
>PHA02929 N1R/p28-like protein; Provisional
Probab=45.65  E-value=2.7  Score=34.39  Aligned_cols=51  Identities=22%  Similarity=0.436  Sum_probs=32.0

Q ss_pred             CCCccccCccccccc---c-ccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           29 GDTCHRCRTTFSLVQ---R-KHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~---R-khhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      +..|.+|...|.--.   + -..=..||++||..|...+..        ....|..|...+..
T Consensus       174 ~~eC~ICle~~~~~~~~~~~~~vl~~C~H~FC~~CI~~Wl~--------~~~tCPlCR~~~~~  228 (238)
T PHA02929        174 DKECAICMEKVYDKEIKNMYFGILSNCNHVFCIECIDIWKK--------EKNTCPVCRTPFIS  228 (238)
T ss_pred             CCCCccCCcccccCccccccceecCCCCCcccHHHHHHHHh--------cCCCCCCCCCEeeE
Confidence            468999988764211   0 112237999999999987642        12357777655443


No 141
>PRK04179 rpl37e 50S ribosomal protein L37e; Reviewed
Probab=45.62  E-value=10  Score=24.76  Aligned_cols=22  Identities=45%  Similarity=0.911  Sum_probs=10.5

Q ss_pred             CccccCccccccccccccccccc
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQ   53 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~   53 (158)
                      .|..|++. ++-.+++.|..||.
T Consensus        19 ~CrRCG~~-syh~qK~~CasCGy   40 (62)
T PRK04179         19 RCRRCGRH-SYNVRKKYCAACGF   40 (62)
T ss_pred             hhcccCcc-cccccccchhhcCC
Confidence            35555543 34444555555544


No 142
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=44.93  E-value=11  Score=28.78  Aligned_cols=25  Identities=20%  Similarity=0.671  Sum_probs=19.8

Q ss_pred             CccccCccccc---ccccccccccccee
Q psy509           31 TCHRCRTTFSL---VQRKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~---~~RkhhCr~CG~vf   55 (158)
                      .|..|+..|++   +.--.+|..||...
T Consensus       111 ~Cp~c~~r~tf~eA~~~~F~Cp~Cg~~L  138 (158)
T TIGR00373       111 ICPNMCVRFTFNEAMELNFTCPRCGAML  138 (158)
T ss_pred             ECCCCCcEeeHHHHHHcCCcCCCCCCEe
Confidence            69999999985   45568899998763


No 143
>cd02342 ZZ_UBA_plant Zinc finger, ZZ type. Zinc finger present in plant ubiquitin-associated (UBA) proteins. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=44.72  E-value=10  Score=22.97  Aligned_cols=29  Identities=14%  Similarity=0.574  Sum_probs=17.2

Q ss_pred             CccccCccccccccccccccccce-ecCCCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV-FCQLCS   60 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v-fC~~Cs   60 (158)
                      .|-+|+. +.+...|++|..|... +|..|-
T Consensus         2 ~CDgCg~-~PI~G~RykC~~C~dyDLC~~C~   31 (43)
T cd02342           2 QCDGCGV-LPITGPRYKSKVKEDYDLCTICF   31 (43)
T ss_pred             CCCCCCC-CcccccceEeCCCCCCccHHHHh
Confidence            4667775 3456677777777443 444443


No 144
>PF14835 zf-RING_6:  zf-RING of BARD1-type protein; PDB: 1JM7_B.
Probab=44.13  E-value=15  Score=24.24  Aligned_cols=29  Identities=24%  Similarity=0.829  Sum_probs=13.4

Q ss_pred             CccccCcccccccccccc-ccccceecCCCCCCc
Q psy509           31 TCHRCRTTFSLVQRKHHC-RACGQVFCQLCSSKS   63 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhC-r~CG~vfC~~Cs~~~   63 (158)
                      .|..|.   ++ .|.-+| -.|.++||+.|.+..
T Consensus         9 rCs~C~---~~-l~~pv~l~~CeH~fCs~Ci~~~   38 (65)
T PF14835_consen    9 RCSICF---DI-LKEPVCLGGCEHIFCSSCIRDC   38 (65)
T ss_dssp             S-SSS----S---SS-B---SSS--B-TTTGGGG
T ss_pred             CCcHHH---HH-hcCCceeccCccHHHHHHhHHh
Confidence            344444   34 355666 799999999998664


No 145
>smart00184 RING Ring finger. E3 ubiquitin-protein ligase activity is intrinsic to the RING domain of c-Cbl and is likely to be a general function of this domain; Various RING fingers exhibit binding activity towards E2 ubiquitin-conjugating enzymes (Ubc' s)
Probab=44.12  E-value=5.6  Score=21.28  Aligned_cols=15  Identities=40%  Similarity=0.992  Sum_probs=11.3

Q ss_pred             ccccceecCCCCCCc
Q psy509           49 RACGQVFCQLCSSKS   63 (158)
Q Consensus        49 r~CG~vfC~~Cs~~~   63 (158)
                      ..||++||..|...+
T Consensus        14 ~~C~H~~c~~C~~~~   28 (39)
T smart00184       14 LPCGHTFCRSCIRKW   28 (39)
T ss_pred             ecCCChHHHHHHHHH
Confidence            458888888887654


No 146
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=43.97  E-value=13  Score=19.63  Aligned_cols=6  Identities=33%  Similarity=1.210  Sum_probs=2.2

Q ss_pred             ccccCc
Q psy509           32 CHRCRT   37 (158)
Q Consensus        32 C~~C~~   37 (158)
                      |..|++
T Consensus         5 Cp~Cg~   10 (26)
T PF13248_consen    5 CPNCGA   10 (26)
T ss_pred             CcccCC
Confidence            333333


No 147
>PF09332 Mcm10:  Mcm10 replication factor;  InterPro: IPR015411 Mcm10 is a eukaryotic DNA replication factor that regulates the stability and chromatin association of DNA polymerase alpha []. ; PDB: 2KWQ_A.
Probab=43.88  E-value=9.3  Score=33.00  Aligned_cols=10  Identities=20%  Similarity=0.757  Sum_probs=2.9

Q ss_pred             ceeeChhhHH
Q psy509           74 EVRVCEDCHE   83 (158)
Q Consensus        74 ~~RVC~~C~~   83 (158)
                      |...|..|-.
T Consensus       302 P~~~C~~Cg~  311 (344)
T PF09332_consen  302 PKKHCSNCGS  311 (344)
T ss_dssp             --S--TTT-S
T ss_pred             CCCCCCcCCc
Confidence            4456666654


No 148
>PHA00732 hypothetical protein
Probab=42.53  E-value=18  Score=24.40  Aligned_cols=10  Identities=30%  Similarity=0.524  Sum_probs=8.1

Q ss_pred             CccccCcccc
Q psy509           31 TCHRCRTTFS   40 (158)
Q Consensus        31 ~C~~C~~~F~   40 (158)
                      .|..|++.|.
T Consensus         3 ~C~~Cgk~F~   12 (79)
T PHA00732          3 KCPICGFTTV   12 (79)
T ss_pred             cCCCCCCccC
Confidence            5888888886


No 149
>PF02148 zf-UBP:  Zn-finger in ubiquitin-hydrolases and other protein;  InterPro: IPR001607 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents UBP-type zinc finger domains, which display some similarity with the Zn-binding domain of the insulinase family. The UBP-type zinc finger domain is found only in a small subfamily of ubiquitin C-terminal hydrolases (deubiquitinases or UBP) [, ], All members of this subfamily are isopeptidase-T, which are known to cleave isopeptide bonds between ubiquitin moieties. Some of the proteins containing an UBP zinc finger include:    Homo sapiens (Human) deubiquitinating enzyme 13 (UBPD) Human deubiquitinating enzyme 5 (UBP5)  Dictyostelium discoideum (Slime mold) deubiquitinating enzyme A (UBPA)  Saccharomyces cerevisiae (Baker's yeast) deubiquitinating enzyme 8 (UBP8) Yeast deubiquitinating enzyme 14 (UBP14)   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3GV4_A 3PHD_B 3C5K_A 2UZG_A 3IHP_B 2G43_B 2G45_D 2I50_A 3MHH_A 3MHS_A ....
Probab=41.77  E-value=14  Score=23.45  Aligned_cols=24  Identities=33%  Similarity=0.696  Sum_probs=15.1

Q ss_pred             ccccCccccccccccccccccceecCC
Q psy509           32 CHRCRTTFSLVQRKHHCRACGQVFCQL   58 (158)
Q Consensus        32 C~~C~~~F~~~~RkhhCr~CG~vfC~~   58 (158)
                      |..|+..   -.+..-|-.||.++|+.
T Consensus         1 C~~C~~~---~~~lw~CL~Cg~~~C~~   24 (63)
T PF02148_consen    1 CSVCGST---NSNLWLCLTCGYVGCGR   24 (63)
T ss_dssp             -SSSHTC---SSSEEEETTTS-EEETT
T ss_pred             CCCCCCc---CCceEEeCCCCcccccC
Confidence            4455532   34566799999999985


No 150
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=41.75  E-value=7.1  Score=23.49  Aligned_cols=22  Identities=32%  Similarity=0.798  Sum_probs=12.3

Q ss_pred             CCccccCcccccccccccccccc
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACG   52 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG   52 (158)
                      ..|..|+.. .+...|++|..|.
T Consensus         5 ~~C~~C~~~-~i~g~Ry~C~~C~   26 (46)
T PF00569_consen    5 YTCDGCGTD-PIIGVRYHCLVCP   26 (46)
T ss_dssp             CE-SSS-SS-SEESSEEEESSSS
T ss_pred             eECcCCCCC-cCcCCeEECCCCC
Confidence            357788773 3345667777773


No 151
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=41.26  E-value=17  Score=34.56  Aligned_cols=34  Identities=26%  Similarity=0.730  Sum_probs=24.2

Q ss_pred             CccccCccccc--cccccccccccce-----ecCCCCCCcc
Q psy509           31 TCHRCRTTFSL--VQRKHHCRACGQV-----FCQLCSSKST   64 (158)
Q Consensus        31 ~C~~C~~~F~~--~~RkhhCr~CG~v-----fC~~Cs~~~~   64 (158)
                      .|..|...+++  ..+.-.|+.||+.     .|..|.+..+
T Consensus       446 ~Cp~Cd~~lt~H~~~~~L~CH~Cg~~~~~p~~Cp~Cgs~~L  486 (730)
T COG1198         446 ECPNCDSPLTLHKATGQLRCHYCGYQEPIPQSCPECGSEHL  486 (730)
T ss_pred             cCCCCCcceEEecCCCeeEeCCCCCCCCCCCCCCCCCCCee
Confidence            56667666553  4567788888887     8888887743


No 152
>PTZ00218 40S ribosomal protein S29; Provisional
Probab=41.20  E-value=20  Score=22.76  Aligned_cols=22  Identities=23%  Similarity=0.694  Sum_probs=13.6

Q ss_pred             CccccCCCCCCCceeeChhhHHHHhc
Q psy509           62 KSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        62 ~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      ....+..+|    ..+|..|+..+..
T Consensus        25 ~~gliRkyg----L~~CRqCFRe~A~   46 (54)
T PTZ00218         25 RHGLIRKYG----LNVCRQCFRENAE   46 (54)
T ss_pred             cchhhhhcC----cchhhHHHHHhhH
Confidence            444555554    3578888877654


No 153
>PF06677 Auto_anti-p27:  Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27);  InterPro: IPR009563 The proteins in this entry are functionally uncharacterised and include several proteins that characterise Sjogren's syndrome/scleroderma autoantigen 1 (Autoantigen p27). It is thought that the potential association of anti-p27 with anti-centromere antibodies suggests that autoantigen p27 might play a role in mitosis [].
Probab=41.18  E-value=16  Score=21.76  Aligned_cols=11  Identities=27%  Similarity=0.839  Sum_probs=7.7

Q ss_pred             CCCccccCccc
Q psy509           29 GDTCHRCRTTF   39 (158)
Q Consensus        29 ~~~C~~C~~~F   39 (158)
                      +..|..|+.+.
T Consensus        17 ~~~Cp~C~~PL   27 (41)
T PF06677_consen   17 DEHCPDCGTPL   27 (41)
T ss_pred             cCccCCCCCee
Confidence            56788887654


No 154
>cd02345 ZZ_dah Zinc finger, ZZ type. Zinc finger present in Drosophila dah and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Dah (discontinuous actin hexagon) is a membrane associated protein essential for cortical furrow formation in Drosophila.
Probab=41.04  E-value=12  Score=22.88  Aligned_cols=21  Identities=29%  Similarity=0.861  Sum_probs=13.8

Q ss_pred             CccccCc-cccccccccccccccc
Q psy509           31 TCHRCRT-TFSLVQRKHHCRACGQ   53 (158)
Q Consensus        31 ~C~~C~~-~F~~~~RkhhCr~CG~   53 (158)
                      .|..|.+ .+.  ..|.+|-.|..
T Consensus         2 ~C~~C~~~~i~--g~R~~C~~C~d   23 (49)
T cd02345           2 SCSACRKQDIS--GIRFPCQVCRD   23 (49)
T ss_pred             cCCCCCCCCce--EeeEECCCCCC
Confidence            5778877 554  45667777754


No 155
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=40.75  E-value=23  Score=21.19  Aligned_cols=10  Identities=30%  Similarity=0.614  Sum_probs=6.9

Q ss_pred             ceeeChhhHH
Q psy509           74 EVRVCEDCHE   83 (158)
Q Consensus        74 ~~RVC~~C~~   83 (158)
                      ...||..|--
T Consensus        19 ~~~vC~~Cg~   28 (52)
T smart00661       19 RRFVCRKCGY   28 (52)
T ss_pred             CEEECCcCCC
Confidence            4677888853


No 156
>KOG1818|consensus
Probab=40.49  E-value=5.7  Score=36.90  Aligned_cols=55  Identities=24%  Similarity=0.383  Sum_probs=38.6

Q ss_pred             CCccccCcccccccccccccccc-ceecCCCCCCccccCCCCCCCceeeChhhHHHH
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACG-QVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKF   85 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG-~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l   85 (158)
                      +.|..|-..|++..+.|+|++|| .++|.-|+.-.+-.-... ...+|+|..=..++
T Consensus        55 ~h~np~~~~~~~~~~d~cvkn~G~gv~~ei~tre~m~~~~~~-l~~~~~~e~v~~~~  110 (634)
T KOG1818|consen   55 DHENPNVQLFTLKLTDHCVKNCGHGVHCEIATREFMDLLKSL-LESQRIHEEVKNKI  110 (634)
T ss_pred             hccCCCcccchhhhHHHHHhcCCcchhHHHHHHHHHHHHHhh-hccccccchHHHHH
Confidence            47889999999999999999999 888888887654432222 23344555444443


No 157
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=40.47  E-value=14  Score=19.37  Aligned_cols=13  Identities=31%  Similarity=0.927  Sum_probs=9.0

Q ss_pred             cccccccccccee
Q psy509           43 QRKHHCRACGQVF   55 (158)
Q Consensus        43 ~RkhhCr~CG~vf   55 (158)
                      .|.+.|..||+.|
T Consensus        12 ~k~~~C~~C~k~F   24 (26)
T PF13465_consen   12 EKPYKCPYCGKSF   24 (26)
T ss_dssp             SSSEEESSSSEEE
T ss_pred             CCCCCCCCCcCee
Confidence            3567777777766


No 158
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=40.18  E-value=6.9  Score=20.24  Aligned_cols=11  Identities=45%  Similarity=0.981  Sum_probs=8.1

Q ss_pred             CccccCccccc
Q psy509           31 TCHRCRTTFSL   41 (158)
Q Consensus        31 ~C~~C~~~F~~   41 (158)
                      .|..|++.|+.
T Consensus         3 ~C~~C~~~F~~   13 (27)
T PF13912_consen    3 ECDECGKTFSS   13 (27)
T ss_dssp             EETTTTEEESS
T ss_pred             CCCccCCccCC
Confidence            47788888863


No 159
>KOG2593|consensus
Probab=40.06  E-value=13  Score=33.02  Aligned_cols=33  Identities=18%  Similarity=0.565  Sum_probs=27.5

Q ss_pred             CCccccCccccc------c---ccccccccccceecCCCCCC
Q psy509           30 DTCHRCRTTFSL------V---QRKHHCRACGQVFCQLCSSK   62 (158)
Q Consensus        30 ~~C~~C~~~F~~------~---~RkhhCr~CG~vfC~~Cs~~   62 (158)
                      -.|..|+++|+.      |   ....||-+||.-+=..|+..
T Consensus       129 Y~Cp~C~kkyt~Lea~~L~~~~~~~F~C~~C~gelveDe~~~  170 (436)
T KOG2593|consen  129 YVCPNCQKKYTSLEALQLLDNETGEFHCENCGGELVEDENKL  170 (436)
T ss_pred             ccCCccccchhhhHHHHhhcccCceEEEecCCCchhcccccC
Confidence            479999999973      2   46899999999988888765


No 160
>PRK12496 hypothetical protein; Provisional
Probab=39.96  E-value=14  Score=28.27  Aligned_cols=25  Identities=20%  Similarity=0.663  Sum_probs=18.4

Q ss_pred             CCccccCccccccccccccccccce
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQV   54 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~v   54 (158)
                      ..|.+|++.|..-.-.-.|..||.-
T Consensus       128 ~~C~gC~~~~~~~~~~~~C~~CG~~  152 (164)
T PRK12496        128 KVCKGCKKKYPEDYPDDVCEICGSP  152 (164)
T ss_pred             EECCCCCccccCCCCCCcCCCCCCh
Confidence            3599999998755455678888864


No 161
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=39.71  E-value=14  Score=22.66  Aligned_cols=13  Identities=38%  Similarity=0.881  Sum_probs=10.0

Q ss_pred             ccccccccceecC
Q psy509           45 KHHCRACGQVFCQ   57 (158)
Q Consensus        45 khhCr~CG~vfC~   57 (158)
                      |+.|+.||.|+=.
T Consensus         1 ky~C~~CgyvYd~   13 (47)
T PF00301_consen    1 KYQCPVCGYVYDP   13 (47)
T ss_dssp             EEEETTTSBEEET
T ss_pred             CcCCCCCCEEEcC
Confidence            5789999988743


No 162
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=39.64  E-value=11  Score=31.33  Aligned_cols=64  Identities=28%  Similarity=0.607  Sum_probs=32.6

Q ss_pred             CcccCCCccccCccc--cc-------cccccccccccce------ecCCCCCCccc-cCCC----CCCCceeeChhhHHH
Q psy509           25 EWMDGDTCHRCRTTF--SL-------VQRKHHCRACGQV------FCQLCSSKSTS-LPKF----GIEKEVRVCEDCHEK   84 (158)
Q Consensus        25 ~W~~~~~C~~C~~~F--~~-------~~RkhhCr~CG~v------fC~~Cs~~~~~-lp~~----~~~~~~RVC~~C~~~   84 (158)
                      .|.. ..|..||..=  +.       -.|..||..||.-      -|..|.+.... +..+    .....+-||+.|...
T Consensus       169 ~w~~-g~CPvCGs~P~~s~l~~~~~~G~R~L~Cs~C~t~W~~~R~~Cp~Cg~~~~~~l~~~~~e~~~~~rve~C~~C~~Y  247 (290)
T PF04216_consen  169 GWQR-GYCPVCGSPPVLSVLRGGEREGKRYLHCSLCGTEWRFVRIKCPYCGNTDHEKLEYFTVEGEPAYRVEVCESCGSY  247 (290)
T ss_dssp             -TT--SS-TTT---EEEEEEE------EEEEEETTT--EEE--TTS-TTT---SS-EEE--------SEEEEEETTTTEE
T ss_pred             CccC-CcCCCCCCcCceEEEecCCCCccEEEEcCCCCCeeeecCCCCcCCCCCCCcceeeEecCCCCcEEEEECCcccch
Confidence            3443 5899998742  21       2488899999864      78999775321 1111    113457899999998


Q ss_pred             Hhccc
Q psy509           85 FTNYY   89 (158)
Q Consensus        85 l~~~~   89 (158)
                      +.-..
T Consensus       248 lK~vd  252 (290)
T PF04216_consen  248 LKTVD  252 (290)
T ss_dssp             EEEEE
T ss_pred             HHHHh
Confidence            87755


No 163
>PF05458 Siva:  Cd27 binding protein (Siva);  InterPro: IPR022773  Siva binds to the CD27 cytoplasmic tail. It has a DD homology region, a box-B-like ring finger, and a zinc finger-like domain. Overexpression of Siva in various cell lines induces apoptosis, suggesting an important role for Siva in the CD27-transduced apoptotic pathway []. Siva-1 binds to and inhibits BCL-X(L)-mediated protection against UV radiation-induced apoptosis. Indeed, the unique amphipathic helical region (SAH) present in Siva-1 is required for its binding to BCL-X(L) and sensitising cells to UV radiation. Natural complexes of Siva-1/BCL-X(L) are detected in HUT78 and murine thymocyte, suggesting a potential role for Siva-1 in regulating T cell homeostasis []. This family contains both Siva-1 and the shorter Siva-2 lacking the sequence coded by exon 2. It has been suggested that Siva-2 could regulate the function of Siva-1 []. 
Probab=39.33  E-value=13  Score=28.99  Aligned_cols=29  Identities=38%  Similarity=1.032  Sum_probs=15.7

Q ss_pred             cccccceecCCCCCCccccCCCCCCCceeeChhh
Q psy509           48 CRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDC   81 (158)
Q Consensus        48 Cr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C   81 (158)
                      |..|+.+||..|+...     ++.....-.|..|
T Consensus       142 C~~C~~~~Cs~Cs~~~-----y~~~~e~~lC~~C  170 (175)
T PF05458_consen  142 CSSCSEVFCSLCSTVN-----YSDQYERVLCLSC  170 (175)
T ss_pred             hhchhhhhhcCccccc-----cCCcccccccCCC
Confidence            6666777777776432     2223344456555


No 164
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=39.21  E-value=12  Score=30.75  Aligned_cols=28  Identities=25%  Similarity=0.757  Sum_probs=17.4

Q ss_pred             cCCCccccCccccc-----c---cccccccccccee
Q psy509           28 DGDTCHRCRTTFSL-----V---QRKHHCRACGQVF   55 (158)
Q Consensus        28 ~~~~C~~C~~~F~~-----~---~RkhhCr~CG~vf   55 (158)
                      .+..|.+|+...+.     +   ..-.+|.+||+|.
T Consensus       196 ~g~~C~GC~m~l~~~~~~~V~~~d~iv~CP~CgRIL  231 (239)
T COG1579         196 EGRVCGGCHMKLPSQTLSKVRKKDEIVFCPYCGRIL  231 (239)
T ss_pred             cCCcccCCeeeecHHHHHHHhcCCCCccCCccchHH
Confidence            46788888876641     1   2235677777764


No 165
>KOG1813|consensus
Probab=39.03  E-value=24  Score=29.93  Aligned_cols=30  Identities=33%  Similarity=0.805  Sum_probs=22.7

Q ss_pred             CCccccCccccccccccccccccceecCCCCCCc
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKS   63 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~   63 (158)
                      ..|.+|++.|-.    -.=-.||+.||..|+...
T Consensus       242 f~c~icr~~f~~----pVvt~c~h~fc~~ca~~~  271 (313)
T KOG1813|consen  242 FKCFICRKYFYR----PVVTKCGHYFCEVCALKP  271 (313)
T ss_pred             cccccccccccc----chhhcCCceeehhhhccc
Confidence            369999998842    222479999999998764


No 166
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=38.71  E-value=18  Score=26.98  Aligned_cols=10  Identities=20%  Similarity=0.873  Sum_probs=6.7

Q ss_pred             CCccccCccc
Q psy509           30 DTCHRCRTTF   39 (158)
Q Consensus        30 ~~C~~C~~~F   39 (158)
                      ..|..|+..+
T Consensus        92 sRC~~CN~~L  101 (147)
T PF01927_consen   92 SRCPKCNGPL  101 (147)
T ss_pred             CccCCCCcEe
Confidence            4677777655


No 167
>TIGR00599 rad18 DNA repair protein rad18. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=38.48  E-value=11  Score=33.19  Aligned_cols=31  Identities=29%  Similarity=0.828  Sum_probs=23.0

Q ss_pred             CCCccccCccccccccccccccccceecCCCCCCc
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKS   63 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~   63 (158)
                      .-.|.+|...|.-    ..--.||+.||..|....
T Consensus        26 ~l~C~IC~d~~~~----PvitpCgH~FCs~CI~~~   56 (397)
T TIGR00599        26 SLRCHICKDFFDV----PVLTSCSHTFCSLCIRRC   56 (397)
T ss_pred             ccCCCcCchhhhC----ccCCCCCCchhHHHHHHH
Confidence            4589999887742    223589999999998754


No 168
>PF13453 zf-TFIIB:  Transcription factor zinc-finger
Probab=37.86  E-value=20  Score=20.79  Aligned_cols=9  Identities=33%  Similarity=1.121  Sum_probs=4.2

Q ss_pred             cccccccce
Q psy509           46 HHCRACGQV   54 (158)
Q Consensus        46 hhCr~CG~v   54 (158)
                      ++|..||.+
T Consensus        20 d~C~~C~G~   28 (41)
T PF13453_consen   20 DVCPSCGGI   28 (41)
T ss_pred             EECCCCCeE
Confidence            344555444


No 169
>COG1998 RPS31 Ribosomal protein S27AE [Translation, ribosomal structure and biogenesis]
Probab=37.77  E-value=18  Score=22.66  Aligned_cols=24  Identities=29%  Similarity=0.717  Sum_probs=11.1

Q ss_pred             CCccccCc-ccc-ccccccccccccc
Q psy509           30 DTCHRCRT-TFS-LVQRKHHCRACGQ   53 (158)
Q Consensus        30 ~~C~~C~~-~F~-~~~RkhhCr~CG~   53 (158)
                      ..|..|+- .|- .-.-|.+|-.||.
T Consensus        20 ~~CPrCG~gvfmA~H~dR~~CGkCgy   45 (51)
T COG1998          20 RFCPRCGPGVFMADHKDRWACGKCGY   45 (51)
T ss_pred             ccCCCCCCcchhhhcCceeEeccccc
Confidence            35666663 232 1223455555554


No 170
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=37.68  E-value=18  Score=20.40  Aligned_cols=8  Identities=63%  Similarity=1.643  Sum_probs=2.6

Q ss_pred             ccccccce
Q psy509           47 HCRACGQV   54 (158)
Q Consensus        47 hCr~CG~v   54 (158)
                      +|+.||.+
T Consensus        13 rC~~Cg~~   20 (37)
T PF12172_consen   13 RCRDCGRV   20 (37)
T ss_dssp             E-TTT--E
T ss_pred             EcCCCCCE
Confidence            45555554


No 171
>COG1545 Predicted nucleic-acid-binding protein containing a Zn-ribbon [General function prediction only]
Probab=36.58  E-value=13  Score=27.78  Aligned_cols=10  Identities=40%  Similarity=1.404  Sum_probs=6.0

Q ss_pred             ccccccccee
Q psy509           46 HHCRACGQVF   55 (158)
Q Consensus        46 hhCr~CG~vf   55 (158)
                      .-|..||++|
T Consensus        30 ~kC~~CG~v~   39 (140)
T COG1545          30 TKCKKCGRVY   39 (140)
T ss_pred             EEcCCCCeEE
Confidence            3466666664


No 172
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=36.40  E-value=20  Score=22.20  Aligned_cols=22  Identities=36%  Similarity=0.851  Sum_probs=14.7

Q ss_pred             CCccccCccccccccccccccccc
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQ   53 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~   53 (158)
                      ..|..|+..-  --|-..||.||.
T Consensus        15 ~ICrkC~ARn--p~~A~~CRKCg~   36 (48)
T PRK04136         15 KICMRCNARN--PWRATKCRKCGY   36 (48)
T ss_pred             cchhcccCCC--CccccccccCCC
Confidence            4677777643  335678888875


No 173
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=36.31  E-value=32  Score=27.56  Aligned_cols=46  Identities=22%  Similarity=0.377  Sum_probs=21.3

Q ss_pred             CccccCccccccccccccccccce-----ecCCCCCCccccCCCCCCCcee
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV-----FCQLCSSKSTSLPKFGIEKEVR   76 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v-----fC~~Cs~~~~~lp~~~~~~~~R   76 (158)
                      .|..|+..|-...+.+.=.+=|.|     +|..|.-+...+-..+-..|.|
T Consensus        16 ~CPvCg~~l~~~~~~~~IPyFG~V~i~t~~C~~CgYR~~DV~~~e~~eP~r   66 (201)
T COG1779          16 DCPVCGGTLKAHMYLYDIPYFGEVLISTGVCERCGYRSTDVKTLEEREPRR   66 (201)
T ss_pred             cCCcccceeeEEEeeecCCccceEEEEEEEccccCCcccceeecccCCCeE
Confidence            566666655544444444444444     4555544433333333333433


No 174
>PRK05580 primosome assembly protein PriA; Validated
Probab=36.15  E-value=22  Score=33.18  Aligned_cols=34  Identities=32%  Similarity=0.847  Sum_probs=22.6

Q ss_pred             CccccCccccc--cccccccccccce-----ecCCCCCCcc
Q psy509           31 TCHRCRTTFSL--VQRKHHCRACGQV-----FCQLCSSKST   64 (158)
Q Consensus        31 ~C~~C~~~F~~--~~RkhhCr~CG~v-----fC~~Cs~~~~   64 (158)
                      .|..|+..+++  ..+.-.|+.||..     .|..|.+..+
T Consensus       392 ~C~~C~~~l~~h~~~~~l~Ch~Cg~~~~~~~~Cp~Cg~~~l  432 (679)
T PRK05580        392 ECPHCDASLTLHRFQRRLRCHHCGYQEPIPKACPECGSTDL  432 (679)
T ss_pred             CCCCCCCceeEECCCCeEECCCCcCCCCCCCCCCCCcCCee
Confidence            45566665543  3455679999987     6888877643


No 175
>KOG1314|consensus
Probab=36.05  E-value=8.8  Score=33.43  Aligned_cols=33  Identities=27%  Similarity=0.796  Sum_probs=22.6

Q ss_pred             CCCCCCcccC--------CCccccCccccccccccccccccce
Q psy509           20 ADTAPEWMDG--------DTCHRCRTTFSLVQRKHHCRACGQV   54 (158)
Q Consensus        20 ~~~~p~W~~~--------~~C~~C~~~F~~~~RkhhCr~CG~v   54 (158)
                      .-.++.|.|-        .-|..|+. | ---|.||||.|.+.
T Consensus        74 G~vp~~wkPe~~~D~~~lqfCk~Cqg-Y-KapRSHHCrkCnrC  114 (414)
T KOG1314|consen   74 GFVPLGWKPENPKDEMFLQFCKKCQG-Y-KAPRSHHCRKCNRC  114 (414)
T ss_pred             CCCCCCCCCCCChhHHHHHHHhhccC-c-CCCccccchHHHHH
Confidence            4457788861        25888864 1 23589999999875


No 176
>KOG2932|consensus
Probab=35.55  E-value=14  Score=31.69  Aligned_cols=45  Identities=24%  Similarity=0.716  Sum_probs=30.6

Q ss_pred             CCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      +.|..|+.+.-++.|-.-   |.+|||-+|....          +.++|-.|-+.+++
T Consensus        91 HfCd~Cd~PI~IYGRmIP---CkHvFCl~CAr~~----------~dK~Cp~C~d~Vqr  135 (389)
T KOG2932|consen   91 HFCDRCDFPIAIYGRMIP---CKHVFCLECARSD----------SDKICPLCDDRVQR  135 (389)
T ss_pred             EeecccCCcceeeecccc---cchhhhhhhhhcC----------ccccCcCcccHHHH
Confidence            468899988877766644   5678999997543          24566666655554


No 177
>PRK04351 hypothetical protein; Provisional
Probab=35.07  E-value=21  Score=27.07  Aligned_cols=9  Identities=22%  Similarity=1.036  Sum_probs=4.5

Q ss_pred             CccccCccc
Q psy509           31 TCHRCRTTF   39 (158)
Q Consensus        31 ~C~~C~~~F   39 (158)
                      .|..|+..+
T Consensus       114 ~C~~Cg~~~  122 (149)
T PRK04351        114 ECQSCGQQY  122 (149)
T ss_pred             ECCCCCCEe
Confidence            455555444


No 178
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=34.84  E-value=20  Score=20.66  Aligned_cols=9  Identities=33%  Similarity=1.324  Sum_probs=4.8

Q ss_pred             cccccccee
Q psy509           47 HCRACGQVF   55 (158)
Q Consensus        47 hCr~CG~vf   55 (158)
                      -|..||.+|
T Consensus         3 ~C~~Cg~~Y   11 (36)
T PF05191_consen    3 ICPKCGRIY   11 (36)
T ss_dssp             EETTTTEEE
T ss_pred             CcCCCCCcc
Confidence            355555554


No 179
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative.
Probab=34.81  E-value=20  Score=26.77  Aligned_cols=24  Identities=25%  Similarity=0.686  Sum_probs=17.7

Q ss_pred             CccccCcccccccc-----ccccccccce
Q psy509           31 TCHRCRTTFSLVQR-----KHHCRACGQV   54 (158)
Q Consensus        31 ~C~~C~~~F~~~~R-----khhCr~CG~v   54 (158)
                      .|..|+.+-+.+.+     -.+|..||..
T Consensus        99 lC~~C~sPdT~l~k~~r~~~l~C~ACGa~  127 (133)
T TIGR00311        99 ICRECNRPDTRIIKEGRVSLLKCEACGAK  127 (133)
T ss_pred             ECCCCCCCCcEEEEeCCeEEEecccCCCC
Confidence            69999998886655     2477777764


No 180
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=34.65  E-value=18  Score=17.80  Aligned_cols=9  Identities=44%  Similarity=1.331  Sum_probs=5.4

Q ss_pred             cccccccee
Q psy509           47 HCRACGQVF   55 (158)
Q Consensus        47 hCr~CG~vf   55 (158)
                      .|..||+.|
T Consensus         2 ~C~~C~~~f   10 (23)
T PF00096_consen    2 KCPICGKSF   10 (23)
T ss_dssp             EETTTTEEE
T ss_pred             CCCCCCCcc
Confidence            466666655


No 181
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=34.62  E-value=9  Score=20.77  Aligned_cols=27  Identities=15%  Similarity=0.352  Sum_probs=8.6

Q ss_pred             CccccCccccccccccccccccceecCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVFCQL   58 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vfC~~   58 (158)
                      .|..|+++... ..-++|..|...+...
T Consensus         2 ~C~~C~~~~~~-~~~Y~C~~Cdf~lH~~   28 (30)
T PF07649_consen    2 RCDACGKPIDG-GWFYRCSECDFDLHEE   28 (30)
T ss_dssp             --TTTS----S---EEE-TTT-----HH
T ss_pred             cCCcCCCcCCC-CceEECccCCCccChh
Confidence            47777776654 4557777776665433


No 182
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=34.54  E-value=8.9  Score=20.15  Aligned_cols=11  Identities=27%  Similarity=0.730  Sum_probs=7.9

Q ss_pred             CccccCccccc
Q psy509           31 TCHRCRTTFSL   41 (158)
Q Consensus        31 ~C~~C~~~F~~   41 (158)
                      .|..|++.|..
T Consensus         4 ~C~~CgR~F~~   14 (25)
T PF13913_consen    4 PCPICGRKFNP   14 (25)
T ss_pred             cCCCCCCEECH
Confidence            57778887764


No 183
>KOG3896|consensus
Probab=34.52  E-value=19  Score=31.33  Aligned_cols=28  Identities=25%  Similarity=0.598  Sum_probs=23.6

Q ss_pred             cCccccccccccccccccceecCCCCCCc
Q psy509           35 CRTTFSLVQRKHHCRACGQVFCQLCSSKS   63 (158)
Q Consensus        35 C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~   63 (158)
                      |+ .|..+.--..||+|-++-|..|+.+.
T Consensus        15 cg-~~~pl~~L~FCRyC~klrc~~Cv~hE   42 (449)
T KOG3896|consen   15 CG-KFRPLPDLVFCRYCFKLRCDDCVLHE   42 (449)
T ss_pred             cc-ccccccceeeeecccccccccccccc
Confidence            55 68888888999999999888888774


No 184
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=34.20  E-value=26  Score=20.60  Aligned_cols=11  Identities=18%  Similarity=0.661  Sum_probs=6.0

Q ss_pred             CCccccCcccc
Q psy509           30 DTCHRCRTTFS   40 (158)
Q Consensus        30 ~~C~~C~~~F~   40 (158)
                      ..|..|+..+.
T Consensus         3 ~~C~~Cg~~l~   13 (47)
T PF13005_consen    3 RACPDCGGELK   13 (47)
T ss_pred             CcCCCCCceee
Confidence            35556665554


No 185
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=34.13  E-value=28  Score=18.39  Aligned_cols=9  Identities=33%  Similarity=0.888  Sum_probs=5.9

Q ss_pred             ccccccccc
Q psy509           45 KHHCRACGQ   53 (158)
Q Consensus        45 khhCr~CG~   53 (158)
                      .+.|.+||.
T Consensus        16 ~f~CPnCG~   24 (24)
T PF07754_consen   16 PFPCPNCGF   24 (24)
T ss_pred             eEeCCCCCC
Confidence            466777773


No 186
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger present in Drosophila Mind bomb (D-mib) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Mind bomb is an E3 ubiqitin ligase that has been shown to regulate signaling by the Notch ligand Delta in Drosophila melanogaster.
Probab=33.93  E-value=21  Score=21.57  Aligned_cols=30  Identities=23%  Similarity=0.806  Sum_probs=20.1

Q ss_pred             CccccCccccccccccccccc-cceecCCCCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRAC-GQVFCQLCSS   61 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~C-G~vfC~~Cs~   61 (158)
                      .|.+|++. .+...|++|..| ..-+|..|-.
T Consensus         2 ~Cd~C~~~-~i~G~RykC~~C~dyDLC~~C~~   32 (45)
T cd02339           2 ICDTCRKQ-GIIGIRWKCAECPNYDLCTTCYH   32 (45)
T ss_pred             CCCCCCCC-CcccCeEECCCCCCccchHHHhC
Confidence            47778753 455677888888 3557777754


No 187
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=33.90  E-value=17  Score=26.58  Aligned_cols=24  Identities=21%  Similarity=0.620  Sum_probs=20.3

Q ss_pred             CccccCccccccccccccccccce
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV   54 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v   54 (158)
                      .|..|++..-.+.|..-|-+|++.
T Consensus        71 ~CP~C~K~TKmLGr~D~CM~C~~p   94 (114)
T PF11023_consen   71 ECPNCGKQTKMLGRVDACMHCKEP   94 (114)
T ss_pred             ECCCCCChHhhhchhhccCcCCCc
Confidence            699999988888888888888774


No 188
>KOG2935|consensus
Probab=33.77  E-value=27  Score=29.20  Aligned_cols=19  Identities=37%  Similarity=0.438  Sum_probs=15.2

Q ss_pred             hhcchHHHHHHHHhcHHHH
Q psy509          133 ELKEEEELQLALALSQSEA  151 (158)
Q Consensus       133 ~~~eeedl~~aia~Sl~e~  151 (158)
                      .+.|||+|+.||++|+..+
T Consensus       233 t~~ede~lrsaie~s~~~~  251 (315)
T KOG2935|consen  233 TEMEDEDLRSAIELSMQSA  251 (315)
T ss_pred             hhcccHHHHHHHHhhhhhh
Confidence            3567999999999998543


No 189
>COG5148 RPN10 26S proteasome regulatory complex, subunit RPN10/PSMD4 [Posttranslational modification, protein turnover, chaperones]
Probab=33.67  E-value=24  Score=28.31  Aligned_cols=17  Identities=41%  Similarity=0.450  Sum_probs=13.3

Q ss_pred             hHHHHHHHHhcHHHHhh
Q psy509          137 EEELQLALALSQSEAES  153 (158)
Q Consensus       137 eedl~~aia~Sl~e~e~  153 (158)
                      |-||..||.||+.|-..
T Consensus       207 DpELA~AlrLSmeEek~  223 (243)
T COG5148         207 DPELAEALRLSMEEEKK  223 (243)
T ss_pred             CHHHHHHHHhhHHHHHH
Confidence            78899999999876543


No 190
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=33.51  E-value=27  Score=25.86  Aligned_cols=25  Identities=24%  Similarity=0.725  Sum_probs=14.9

Q ss_pred             CccccCccccccc-----ccccccccccee
Q psy509           31 TCHRCRTTFSLVQ-----RKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~~~-----RkhhCr~CG~vf   55 (158)
                      .|..|+..+...+     ++..|+.||..+
T Consensus       114 ~C~~C~~~~~~~rr~~~~~~y~C~~C~g~l  143 (146)
T smart00731      114 RCTGCGQRYLRVRRSNNVSRYRCGKCGGKL  143 (146)
T ss_pred             ECCCCCCCCceEccccCcceEEcCCCCCEE
Confidence            5777877664222     345677776654


No 191
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=33.05  E-value=34  Score=32.01  Aligned_cols=47  Identities=19%  Similarity=0.612  Sum_probs=30.8

Q ss_pred             CccccCccccccccccccccccce----ecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV----FCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v----fC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      .|..|+..-  -..-..|..||..    +|..|....        ....+.|..|-..+..
T Consensus         3 ~Cp~Cg~~n--~~~akFC~~CG~~l~~~~Cp~CG~~~--------~~~~~fC~~CG~~~~~   53 (645)
T PRK14559          3 ICPQCQFEN--PNNNRFCQKCGTSLTHKPCPQCGTEV--------PVDEAHCPNCGAETGT   53 (645)
T ss_pred             cCCCCCCcC--CCCCccccccCCCCCCCcCCCCCCCC--------CcccccccccCCcccc
Confidence            588887753  2333468888876    477776542        3456889999777654


No 192
>PRK06260 threonine synthase; Validated
Probab=32.58  E-value=25  Score=30.39  Aligned_cols=24  Identities=21%  Similarity=0.624  Sum_probs=19.1

Q ss_pred             CccccCccccccccccccccccce
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV   54 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v   54 (158)
                      .|..|++.|..-...+.|..||..
T Consensus         5 ~C~~cg~~~~~~~~~~~Cp~cg~~   28 (397)
T PRK06260          5 KCIECGKEYDPDEIIYTCPECGGL   28 (397)
T ss_pred             EECCCCCCCCCCCccccCCCCCCe
Confidence            689999999866566779889865


No 193
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=32.42  E-value=23  Score=27.24  Aligned_cols=15  Identities=33%  Similarity=1.019  Sum_probs=9.4

Q ss_pred             cccccccccccccee
Q psy509           41 LVQRKHHCRACGQVF   55 (158)
Q Consensus        41 ~~~RkhhCr~CG~vf   55 (158)
                      .++|+.+|..||.-|
T Consensus        24 aIRRRReC~~C~~RF   38 (156)
T COG1327          24 AIRRRRECLECGERF   38 (156)
T ss_pred             hhhhhhccccccccc
Confidence            356666666666655


No 194
>PRK11788 tetratricopeptide repeat protein; Provisional
Probab=32.36  E-value=32  Score=28.45  Aligned_cols=26  Identities=35%  Similarity=0.751  Sum_probs=16.3

Q ss_pred             cccccccce------ecCCCCCCccccCCCCC
Q psy509           46 HHCRACGQV------FCQLCSSKSTSLPKFGI   71 (158)
Q Consensus        46 hhCr~CG~v------fC~~Cs~~~~~lp~~~~   71 (158)
                      +.|.+||.+      .|..|.+.-...|..|.
T Consensus       355 ~~c~~cg~~~~~~~~~c~~c~~~~~~~~~~~~  386 (389)
T PRK11788        355 YRCRNCGFTARTLYWHCPSCKAWETIKPIRGL  386 (389)
T ss_pred             EECCCCCCCCccceeECcCCCCccCcCCcccC
Confidence            556667665      67777766555555443


No 195
>COG2126 RPL37A Ribosomal protein L37E [Translation, ribosomal structure and biogenesis]
Probab=32.19  E-value=19  Score=23.25  Aligned_cols=6  Identities=67%  Similarity=1.951  Sum_probs=3.0

Q ss_pred             cccccc
Q psy509           48 CRACGQ   53 (158)
Q Consensus        48 Cr~CG~   53 (158)
                      ||.||.
T Consensus        19 CRRCGr   24 (61)
T COG2126          19 CRRCGR   24 (61)
T ss_pred             hhhccc
Confidence            555554


No 196
>PHA00733 hypothetical protein
Probab=32.05  E-value=25  Score=25.83  Aligned_cols=10  Identities=40%  Similarity=0.873  Sum_probs=6.2

Q ss_pred             CccccCcccc
Q psy509           31 TCHRCRTTFS   40 (158)
Q Consensus        31 ~C~~C~~~F~   40 (158)
                      .|..|++.|.
T Consensus        75 ~C~~Cgk~Fs   84 (128)
T PHA00733         75 VCPLCLMPFS   84 (128)
T ss_pred             cCCCCCCcCC
Confidence            5666666664


No 197
>KOG3183|consensus
Probab=31.85  E-value=18  Score=29.74  Aligned_cols=19  Identities=16%  Similarity=0.094  Sum_probs=11.6

Q ss_pred             hhcchHHHHHHHHhcHHHH
Q psy509          133 ELKEEEELQLALALSQSEA  151 (158)
Q Consensus       133 ~~~eeedl~~aia~Sl~e~  151 (158)
                      ...+++-|.+++.++.-|+
T Consensus       200 ~n~~~~~l~Rs~~~~~~e~  218 (250)
T KOG3183|consen  200 LNVKSSTLTRSLSQDKGEL  218 (250)
T ss_pred             cccchHHHHHHhhhhhhhh
Confidence            3455677777766665554


No 198
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=31.61  E-value=31  Score=24.05  Aligned_cols=27  Identities=30%  Similarity=0.728  Sum_probs=14.6

Q ss_pred             CCccccCccccc---cccccccccccceecC
Q psy509           30 DTCHRCRTTFSL---VQRKHHCRACGQVFCQ   57 (158)
Q Consensus        30 ~~C~~C~~~F~~---~~RkhhCr~CG~vfC~   57 (158)
                      ..|..|++. ..   -...-.|+.||..|=+
T Consensus        36 ~~Cp~C~~~-~VkR~a~GIW~C~kCg~~fAG   65 (89)
T COG1997          36 HVCPFCGRT-TVKRIATGIWKCRKCGAKFAG   65 (89)
T ss_pred             CcCCCCCCc-ceeeeccCeEEcCCCCCeecc
Confidence            467777765 21   1223456666666633


No 199
>PF02945 Endonuclease_7:  Recombination endonuclease VII;  InterPro: IPR004211 This family of proteins which includes Bacteriophage T4 endonuclease VII, Mycobacteriophage D29 gene 59, and other as yet uncharacterised proteins. The T4 endonuclease VII (Endo VII) recognises a broad spectrum of DNA substrates ranging from branched DNAs to single base mismatches. The structure of this enzyme has been resolved and it was found that the monomers form an elongated, intertwined molecular dimer that exibits extreme domain swapping. Two pairs of antiparallel helices which form a novel 'four-helix cross' motif are the major dimerisation elements [].; PDB: 3GOX_A 3FC3_A 1EN7_B 1E7L_B 2QNF_A 2QNC_A 1E7D_A.
Probab=31.44  E-value=16  Score=24.98  Aligned_cols=26  Identities=31%  Similarity=0.566  Sum_probs=14.0

Q ss_pred             CCCccccCccccccccc---cccccccce
Q psy509           29 GDTCHRCRTTFSLVQRK---HHCRACGQV   54 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~Rk---hhCr~CG~v   54 (158)
                      +..|.+|+.++....++   -||..+|.|
T Consensus        22 ~~~C~iC~~~~~~~~~~~~vDHdH~tG~v   50 (81)
T PF02945_consen   22 GGRCAICGKPLPGESRKLVVDHDHKTGRV   50 (81)
T ss_dssp             TTE-TTT-SEEETTCGGCEEEE-TTTTBE
T ss_pred             CCcCcCCCCCcccCCCcceecCCCCCCCc
Confidence            45899999855433332   577777764


No 200
>cd00202 ZnF_GATA Zinc finger DNA binding domain; binds specifically to DNA consensus sequence [AT]GATA[AG] promoter elements; a subset of family members may also bind protein; zinc-finger consensus topology is C-X(2)-C-X(17)-C-X(2)-C
Probab=31.42  E-value=42  Score=20.93  Aligned_cols=33  Identities=21%  Similarity=0.482  Sum_probs=18.2

Q ss_pred             cCCCCCCccccCCCCCCCceeeChhhHHHHhcc
Q psy509           56 CQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTNY   88 (158)
Q Consensus        56 C~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~~   88 (158)
                      |..|.....++=..+......+|..|-.....+
T Consensus         2 C~~C~~~~Tp~WR~g~~~~~~LCNaCgl~~~k~   34 (54)
T cd00202           2 CSNCGTTTTPLWRRGPSGGSTLCNACGLYWKKH   34 (54)
T ss_pred             CCCCCCCCCcccccCCCCcchHHHHHHHHHHhc
Confidence            444444433332223245667888888777653


No 201
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=31.16  E-value=14  Score=27.60  Aligned_cols=16  Identities=25%  Similarity=0.735  Sum_probs=10.2

Q ss_pred             CCccccCcccccccccc
Q psy509           30 DTCHRCRTTFSLVQRKH   46 (158)
Q Consensus        30 ~~C~~C~~~F~~~~Rkh   46 (158)
                      -.|..||+.|..+ +||
T Consensus        73 i~clecGk~~k~L-krH   88 (132)
T PF05443_consen   73 IICLECGKKFKTL-KRH   88 (132)
T ss_dssp             EE-TBT--EESBH-HHH
T ss_pred             eEEccCCcccchH-HHH
Confidence            4799999999988 444


No 202
>KOG2807|consensus
Probab=30.91  E-value=31  Score=29.80  Aligned_cols=44  Identities=25%  Similarity=0.702  Sum_probs=30.2

Q ss_pred             CCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhH
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCH   82 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~   82 (158)
                      ..|..|+.. ..-.-++.|+.|..+||..|-...        ....-+|..|.
T Consensus       331 ~~Cf~C~~~-~~~~~~y~C~~Ck~~FCldCDv~i--------HesLh~CpgCe  374 (378)
T KOG2807|consen  331 RFCFACQGE-LLSSGRYRCESCKNVFCLDCDVFI--------HESLHNCPGCE  374 (378)
T ss_pred             cceeeeccc-cCCCCcEEchhccceeeccchHHH--------HhhhhcCCCcC
Confidence            459999321 134567899999999999996542        23455676664


No 203
>PRK05978 hypothetical protein; Provisional
Probab=30.88  E-value=27  Score=26.61  Aligned_cols=34  Identities=29%  Similarity=0.687  Sum_probs=23.4

Q ss_pred             CCCCccc-----CCCccccCc--ccc-cccccccccccccee
Q psy509           22 TAPEWMD-----GDTCHRCRT--TFS-LVQRKHHCRACGQVF   55 (158)
Q Consensus        22 ~~p~W~~-----~~~C~~C~~--~F~-~~~RkhhCr~CG~vf   55 (158)
                      .+|.|..     .-.|..|++  -|. ++.=+.+|..||.-|
T Consensus        21 ~r~~~~~~~rGl~grCP~CG~G~LF~g~Lkv~~~C~~CG~~~   62 (148)
T PRK05978         21 KRPVGRAMWRGFRGRCPACGEGKLFRAFLKPVDHCAACGEDF   62 (148)
T ss_pred             cCchHHHHHHHHcCcCCCCCCCcccccccccCCCccccCCcc
Confidence            3555654     358999974  554 566678899999866


No 204
>cd02335 ZZ_ADA2 Zinc finger, ZZ type. Zinc finger present in ADA2, a putative transcriptional adaptor, and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=30.35  E-value=57  Score=19.70  Aligned_cols=31  Identities=23%  Similarity=0.599  Sum_probs=18.8

Q ss_pred             CccccCccccccccccccccc-cceecCCCCCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRAC-GQVFCQLCSSK   62 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~C-G~vfC~~Cs~~   62 (158)
                      .|..|.+... ...|.+|-.| ...+|..|-..
T Consensus         2 ~Cd~C~~~~~-~g~r~~C~~C~d~dLC~~Cf~~   33 (49)
T cd02335           2 HCDYCSKDIT-GTIRIKCAECPDFDLCLECFSA   33 (49)
T ss_pred             CCCCcCCCCC-CCcEEECCCCCCcchhHHhhhC
Confidence            4778887553 2267888888 33355555443


No 205
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only]
Probab=30.27  E-value=11  Score=30.42  Aligned_cols=29  Identities=28%  Similarity=0.889  Sum_probs=22.2

Q ss_pred             CccccCccccccccccccccccceecCCCCCCc
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKS   63 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~   63 (158)
                      .|.+|.+.|-    ...=-.||+.||+.|.-..
T Consensus       198 ~C~iCKkdy~----spvvt~CGH~FC~~Cai~~  226 (259)
T COG5152         198 LCGICKKDYE----SPVVTECGHSFCSLCAIRK  226 (259)
T ss_pred             eehhchhhcc----chhhhhcchhHHHHHHHHH
Confidence            7999998773    2333589999999997654


No 206
>PRK07591 threonine synthase; Validated
Probab=30.02  E-value=29  Score=30.37  Aligned_cols=25  Identities=24%  Similarity=0.595  Sum_probs=19.8

Q ss_pred             CCccccCcccccccccccccccccee
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVF   55 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vf   55 (158)
                      -.|..|++.|..-.. ..|..||..+
T Consensus        19 l~C~~Cg~~~~~~~~-~~C~~cg~~l   43 (421)
T PRK07591         19 LKCRECGAEYPLGPI-HVCEECFGPL   43 (421)
T ss_pred             EEeCCCCCcCCCCCC-ccCCCCCCeE
Confidence            479999999986545 8898898765


No 207
>PRK03988 translation initiation factor IF-2 subunit beta; Validated
Probab=29.99  E-value=26  Score=26.25  Aligned_cols=24  Identities=25%  Similarity=0.654  Sum_probs=17.6

Q ss_pred             CccccCcccccccc-----ccccccccce
Q psy509           31 TCHRCRTTFSLVQR-----KHHCRACGQV   54 (158)
Q Consensus        31 ~C~~C~~~F~~~~R-----khhCr~CG~v   54 (158)
                      .|..|+.+-+.+.+     -.+|..||..
T Consensus       104 lC~~C~spdT~l~k~~r~~~l~C~ACGa~  132 (138)
T PRK03988        104 ICPECGSPDTKLIKEGRIWVLKCEACGAE  132 (138)
T ss_pred             ECCCCCCCCcEEEEcCCeEEEEcccCCCC
Confidence            69999998886655     2567777763


No 208
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=29.98  E-value=22  Score=21.84  Aligned_cols=12  Identities=17%  Similarity=0.279  Sum_probs=5.7

Q ss_pred             cccceecCCCCC
Q psy509           50 ACGQVFCQLCSS   61 (158)
Q Consensus        50 ~CG~vfC~~Cs~   61 (158)
                      .||++||..|..
T Consensus        18 ~~G~v~~~~~i~   29 (63)
T smart00504       18 PSGQTYERRAIE   29 (63)
T ss_pred             CCCCEEeHHHHH
Confidence            445555444443


No 209
>PF10497 zf-4CXXC_R1:  Zinc-finger domain of monoamine-oxidase A repressor R1;  InterPro: IPR018866  R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression. This domain is a four-CXXC zinc finger putative DNA-binding domain found at the C-terminal end of R1. The domain carries 12 cysteines of which four pairs are of the CXXC type []. 
Probab=29.94  E-value=18  Score=25.81  Aligned_cols=55  Identities=27%  Similarity=0.551  Sum_probs=33.1

Q ss_pred             CCCccccCcccccccccccc------ccc---cceecCCCCCCcccc-CCCCCCCceeeChhhHHHH
Q psy509           29 GDTCHRCRTTFSLVQRKHHC------RAC---GQVFCQLCSSKSTSL-PKFGIEKEVRVCEDCHEKF   85 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhC------r~C---G~vfC~~Cs~~~~~l-p~~~~~~~~RVC~~C~~~l   85 (158)
                      +..|..|..+-.  ..+..|      ..|   ...||..|...+-.. +.-....+..+|..|..+-
T Consensus         7 g~~CHqCrqKt~--~~~~~C~~~~~~~~C~~~~~~fC~~CL~~ryge~~~ev~~~~~W~CP~CrgiC   71 (105)
T PF10497_consen    7 GKTCHQCRQKTL--DFKTICTGHWKNSSCRGCRGKFCGGCLRNRYGENVEEVLEDPNWKCPKCRGIC   71 (105)
T ss_pred             CCCchhhcCCCC--CCceEcCCCCCCCCCccCcceehHhHHHHHHhhhHHHHhcCCceECCCCCCee
Confidence            467999987433  222334      556   889999998875321 1001134567788777653


No 210
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=29.69  E-value=8.6  Score=23.98  Aligned_cols=18  Identities=22%  Similarity=0.632  Sum_probs=14.3

Q ss_pred             ccCCCccccCcccccccc
Q psy509           27 MDGDTCHRCRTTFSLVQR   44 (158)
Q Consensus        27 ~~~~~C~~C~~~F~~~~R   44 (158)
                      .++..|..|+++|++-++
T Consensus        10 lp~KICpvCqRPFsWRkK   27 (54)
T COG4338          10 LPDKICPVCQRPFSWRKK   27 (54)
T ss_pred             cchhhhhhhcCchHHHHH
Confidence            456789999999987644


No 211
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=28.96  E-value=33  Score=22.17  Aligned_cols=25  Identities=28%  Similarity=0.699  Sum_probs=18.6

Q ss_pred             CCccccCccccccc--cccccccccce
Q psy509           30 DTCHRCRTTFSLVQ--RKHHCRACGQV   54 (158)
Q Consensus        30 ~~C~~C~~~F~~~~--RkhhCr~CG~v   54 (158)
                      ..|..|+....-..  -+..|.+||.+
T Consensus         8 ~~CtSCg~~i~~~~~~~~F~CPnCG~~   34 (59)
T PRK14890          8 PKCTSCGIEIAPREKAVKFLCPNCGEV   34 (59)
T ss_pred             ccccCCCCcccCCCccCEeeCCCCCCe
Confidence            46888988765333  47889999987


No 212
>KOG4323|consensus
Probab=28.15  E-value=27  Score=31.36  Aligned_cols=58  Identities=19%  Similarity=0.275  Sum_probs=38.8

Q ss_pred             CCccccC-ccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           30 DTCHRCR-TTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        30 ~~C~~C~-~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      .+|..|+ -.++.++|-..|+.|+..|=..|..-.+.--.+|-..-+-.|..|......
T Consensus       169 ~qc~vC~~g~~~~~NrmlqC~~C~~~fHq~Chqp~i~~~l~~D~~~~w~C~~C~~~~~~  227 (464)
T KOG4323|consen  169 LQCSVCYCGGPGAGNRMLQCDKCRQWYHQACHQPLIKDELAGDPFYEWFCDVCNRGPKK  227 (464)
T ss_pred             ceeeeeecCCcCccceeeeecccccHHHHHhccCCCCHhhccCccceEeehhhccchhh
Confidence            4688888 678889999999999998744444332222223334556788888766543


No 213
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5.
Probab=28.04  E-value=30  Score=24.95  Aligned_cols=23  Identities=26%  Similarity=0.667  Sum_probs=17.4

Q ss_pred             CccccCcccccccc-----ccccccccc
Q psy509           31 TCHRCRTTFSLVQR-----KHHCRACGQ   53 (158)
Q Consensus        31 ~C~~C~~~F~~~~R-----khhCr~CG~   53 (158)
                      .|..|+.+-+.+.+     -.+|..||.
T Consensus        82 lC~~C~spdT~l~k~~r~~~l~C~aCGa  109 (110)
T smart00653       82 LCPECGSPDTELIKENRLFFLKCEACGA  109 (110)
T ss_pred             ECCCCCCCCcEEEEeCCeEEEEccccCC
Confidence            69999998886665     356888874


No 214
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=28.03  E-value=22  Score=25.58  Aligned_cols=11  Identities=55%  Similarity=1.437  Sum_probs=9.6

Q ss_pred             cccccccccee
Q psy509           45 KHHCRACGQVF   55 (158)
Q Consensus        45 khhCr~CG~vf   55 (158)
                      -|.|-+||.+|
T Consensus         2 pH~CtrCG~vf   12 (112)
T COG3364           2 PHQCTRCGEVF   12 (112)
T ss_pred             Cceeccccccc
Confidence            38899999998


No 215
>cd07153 Fur_like Ferric uptake regulator(Fur) and related metalloregulatory proteins; typically iron-dependent, DNA-binding repressors and activators. Ferric uptake regulator (Fur) and related metalloregulatory proteins are iron-dependent, DNA-binding repressors and activators mainly involved in iron metabolism.  A general model for Fur repression under iron-rich conditions is that activated Fur (a dimer having one Fe2+ coordinated per monomer) binds to specific DNA sequences (Fur boxes) in the promoter region of iron-responsive genes, hindering access of RNA polymerase, and repressing transcription. Positive regulation by Fur can be direct or indirect, as in the Fur repression of an anti-sense regulatory small RNA. Some members sense metal ions other than Fe2+.  For example, the zinc uptake regulator (Zur) responds to Zn2+, the manganese uptake regulator (Mur) responds to Mn2+, and the nickel uptake regulator (Nur) responds to Ni2+. Other members sense signals other than metal ions.  
Probab=27.96  E-value=27  Score=24.33  Aligned_cols=15  Identities=27%  Similarity=0.425  Sum_probs=11.2

Q ss_pred             cccccccceecCCCC
Q psy509           46 HHCRACGQVFCQLCS   60 (158)
Q Consensus        46 hhCr~CG~vfC~~Cs   60 (158)
                      -.|+.||++++-.+.
T Consensus        74 ~~C~~Cg~i~~~~~~   88 (116)
T cd07153          74 LICTKCGKVIDFEDC   88 (116)
T ss_pred             eEeCCCCCEEEecCc
Confidence            358899999886554


No 216
>PF14471 DUF4428:  Domain of unknown function (DUF4428)
Probab=27.92  E-value=44  Score=20.66  Aligned_cols=12  Identities=33%  Similarity=1.016  Sum_probs=9.9

Q ss_pred             eeChhhHHHHhc
Q psy509           76 RVCEDCHEKFTN   87 (158)
Q Consensus        76 RVC~~C~~~l~~   87 (158)
                      -||..|+.++..
T Consensus        21 ~iC~~C~~Kl~~   32 (51)
T PF14471_consen   21 YICKDCLKKLSG   32 (51)
T ss_pred             cchHHHHHHhcC
Confidence            599999999843


No 217
>PRK08359 transcription factor; Validated
Probab=27.91  E-value=2.2e+02  Score=22.24  Aligned_cols=15  Identities=40%  Similarity=0.899  Sum_probs=11.5

Q ss_pred             CceeeChhhHHHHhc
Q psy509           73 KEVRVCEDCHEKFTN   87 (158)
Q Consensus        73 ~~~RVC~~C~~~l~~   87 (158)
                      .-+.||+.|+..+-.
T Consensus        28 ael~VC~~Ca~k~G~   42 (176)
T PRK08359         28 AELLVCDRCYEKYGR   42 (176)
T ss_pred             eEEehHHHHHHHhCC
Confidence            458999999976643


No 218
>KOG1734|consensus
Probab=27.62  E-value=21  Score=30.07  Aligned_cols=54  Identities=19%  Similarity=0.433  Sum_probs=41.5

Q ss_pred             cCCCccccCccccccc------cccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           28 DGDTCHRCRTTFSLVQ------RKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        28 ~~~~C~~C~~~F~~~~------RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      ++..|+.|+++|....      -+-|=-.|+++|=..|-+.+..+-      ....|.-|.+++..
T Consensus       223 ~d~vCaVCg~~~~~s~~eegvienty~LsCnHvFHEfCIrGWcivG------KkqtCPYCKekVdl  282 (328)
T KOG1734|consen  223 SDSVCAVCGQQIDVSVDEEGVIENTYKLSCNHVFHEFCIRGWCIVG------KKQTCPYCKEKVDL  282 (328)
T ss_pred             CcchhHhhcchheeecchhhhhhhheeeecccchHHHhhhhheeec------CCCCCchHHHHhhH
Confidence            4679999999986443      355667899999999998887653      34579999998754


No 219
>TIGR01195 oadG_fam sodium pump decarboxylases, gamma subunit. Most sequences scoring between the noise and trusted cutoffs are eukaryotic sodium channel proteins.
Probab=27.08  E-value=91  Score=21.13  Aligned_cols=20  Identities=35%  Similarity=0.363  Sum_probs=15.7

Q ss_pred             cchHHHHHHHHhcHHHHhhc
Q psy509          135 KEEEELQLALALSQSEAESN  154 (158)
Q Consensus       135 ~eeedl~~aia~Sl~e~e~~  154 (158)
                      .+|+++-+||.+++.+...+
T Consensus        61 ~~~~elvAaIsAAI~~~r~~   80 (82)
T TIGR01195        61 DEDEELVAAIAAAVHEHLRK   80 (82)
T ss_pred             CCChhHHHHHHHHHHHHHHc
Confidence            34567889999999988655


No 220
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1  and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel modulatory factor 1 or FIGC has been shown to possess intrinsic E3 ubiquitin ligase activity and to promote ubiquitination.
Probab=26.98  E-value=61  Score=19.64  Aligned_cols=20  Identities=30%  Similarity=0.903  Sum_probs=11.8

Q ss_pred             CccccC-cccccccccccccccc
Q psy509           31 TCHRCR-TTFSLVQRKHHCRACG   52 (158)
Q Consensus        31 ~C~~C~-~~F~~~~RkhhCr~CG   52 (158)
                      .|..|+ ..+.  ..|.+|..|.
T Consensus         2 ~C~~C~~~~i~--g~R~~C~~C~   22 (49)
T cd02338           2 SCDGCGKSNFT--GRRYKCLICY   22 (49)
T ss_pred             CCCCCcCCCcE--EeeEEeCCCC
Confidence            467777 3433  4666666663


No 221
>KOG0006|consensus
Probab=26.98  E-value=17  Score=31.48  Aligned_cols=33  Identities=33%  Similarity=0.755  Sum_probs=24.7

Q ss_pred             CCcc--ccCcccc--cccccccccc-ccceecCCCCCC
Q psy509           30 DTCH--RCRTTFS--LVQRKHHCRA-CGQVFCQLCSSK   62 (158)
Q Consensus        30 ~~C~--~C~~~F~--~~~RkhhCr~-CG~vfC~~Cs~~   62 (158)
                      -.|.  +|+..|-  -=-||..|.. ||.+||.+|...
T Consensus       316 VlCP~pgCG~gll~EPD~rkvtC~~gCgf~FCR~C~e~  353 (446)
T KOG0006|consen  316 VLCPRPGCGAGLLPEPDQRKVTCEGGCGFAFCRECKEA  353 (446)
T ss_pred             EecCCCCCCcccccCCCCCcccCCCCchhHhHHHHHhh
Confidence            3565  6777553  2368999998 999999998763


No 222
>cd02336 ZZ_RSC8 Zinc finger, ZZ type. Zinc finger present in RSC8 and related proteins. RSC8 is a component of the RSC complex, which is closely related to the SWI/SNF complex and is involved in remodeling chromatin structure. The ZZ motif coordinates a zinc ion and most likely participates in ligand binding or molecular scaffolding.
Probab=26.87  E-value=29  Score=21.00  Aligned_cols=10  Identities=20%  Similarity=0.803  Sum_probs=7.2

Q ss_pred             eeeChhhHHH
Q psy509           75 VRVCEDCHEK   84 (158)
Q Consensus        75 ~RVC~~C~~~   84 (158)
                      .-+|..||..
T Consensus        23 ~dLC~~CF~~   32 (45)
T cd02336          23 YDLCPSCYQE   32 (45)
T ss_pred             cccChHHHhC
Confidence            5678888864


No 223
>PF09862 DUF2089:  Protein of unknown function (DUF2089);  InterPro: IPR018658  This family consists of various hypothetical prokaryotic proteins. 
Probab=26.77  E-value=37  Score=24.69  Aligned_cols=27  Identities=26%  Similarity=0.572  Sum_probs=20.3

Q ss_pred             ccccCccccccccccccccccceecCCCC
Q psy509           32 CHRCRTTFSLVQRKHHCRACGQVFCQLCS   60 (158)
Q Consensus        32 C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs   60 (158)
                      |..|+..  +...+.+|.+||-.+-+.-.
T Consensus         1 CPvCg~~--l~vt~l~C~~C~t~i~G~F~   27 (113)
T PF09862_consen    1 CPVCGGE--LVVTRLKCPSCGTEIEGEFE   27 (113)
T ss_pred             CCCCCCc--eEEEEEEcCCCCCEEEeeec
Confidence            7788875  45668899999988766543


No 224
>cd04476 RPA1_DBD_C RPA1_DBD_C: A subfamily of OB folds corresponding to the C-terminal OB fold, the ssDNA-binding domain (DBD)-C, of human RPA1 (also called RPA70). RPA1 is the large subunit of Replication protein A (RPA). RPA is a nuclear ssDNA-binding protein (SSB) which appears to be involved in all aspects of DNA metabolism including replication, recombination, and repair. RPA also mediates specific interactions of various nuclear proteins. In animals, plants, and fungi, RPA is a heterotrimer with subunits of 70KDa (RPA1), 32kDa (RPA2), and 14 KDa (RPA3). In addition to DBD-C, RPA1 contains three other OB folds: DBD-A, DBD-B, and RPA1N. The major DNA binding activity of RPA is associated with RPA1 DBD-A and DBD-B. RPA1 DBD-C is involved in DNA binding and trimerization. It contains two structural insertions not found to date in other OB-folds: a zinc ribbon and a three-helix bundle. RPA1 DBD-C also contains a Cys4-type zinc-binding motif, which plays a role in the ssDNA binding fun
Probab=26.62  E-value=32  Score=25.78  Aligned_cols=57  Identities=11%  Similarity=0.212  Sum_probs=33.9

Q ss_pred             CCccccCccccccc-cccccccccceecCCCCCCc---cccCCCCCCCceeeChhhHHHHhc
Q psy509           30 DTCHRCRTTFSLVQ-RKHHCRACGQVFCQLCSSKS---TSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        30 ~~C~~C~~~F~~~~-RkhhCr~CG~vfC~~Cs~~~---~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      ..|..|+++..... ....|..|+..+ ..+....   +.+-.......+.+-+.+.+.|..
T Consensus        35 ~aC~~C~kkv~~~~~~~~~C~~C~~~~-~~~~~ry~l~~~i~D~Tg~~~~~~F~~~ae~l~G   95 (166)
T cd04476          35 PACPGCNKKVVEEGNGTYRCEKCNKSV-PNPEYRYILSLNVADHTGEAWLTLFDEVAEQIFG   95 (166)
T ss_pred             ccccccCcccEeCCCCcEECCCCCCcC-CCccEEEEEEEEEEeCCCCEEEEEehHHHHHHhC
Confidence            46999999876555 778888888765 3332221   112222224556666677776655


No 225
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=26.61  E-value=29  Score=20.14  Aligned_cols=11  Identities=27%  Similarity=0.854  Sum_probs=6.2

Q ss_pred             cccccccccee
Q psy509           45 KHHCRACGQVF   55 (158)
Q Consensus        45 khhCr~CG~vf   55 (158)
                      -+.|..||.|+
T Consensus         6 ~YkC~~CGniV   16 (36)
T PF06397_consen    6 FYKCEHCGNIV   16 (36)
T ss_dssp             EEE-TTT--EE
T ss_pred             EEEccCCCCEE
Confidence            46799999886


No 226
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=26.53  E-value=40  Score=18.70  Aligned_cols=10  Identities=30%  Similarity=1.035  Sum_probs=5.7

Q ss_pred             ccccccccee
Q psy509           46 HHCRACGQVF   55 (158)
Q Consensus        46 hhCr~CG~vf   55 (158)
                      +.|..||.++
T Consensus         2 ~~C~~CGy~y   11 (33)
T cd00350           2 YVCPVCGYIY   11 (33)
T ss_pred             EECCCCCCEE
Confidence            4466666654


No 227
>PF11238 DUF3039:  Protein of unknown function (DUF3039);  InterPro: IPR021400  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=26.23  E-value=60  Score=20.87  Aligned_cols=15  Identities=33%  Similarity=0.855  Sum_probs=11.7

Q ss_pred             CceeeChhhHHHHhc
Q psy509           73 KEVRVCEDCHEKFTN   87 (158)
Q Consensus        73 ~~~RVC~~C~~~l~~   87 (158)
                      .+.-||..|.++...
T Consensus        42 ~~~PVCP~Ck~iye~   56 (58)
T PF11238_consen   42 KPFPVCPECKEIYES   56 (58)
T ss_pred             CCCCCCcCHHHHHHh
Confidence            447899999987654


No 228
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=26.16  E-value=54  Score=19.58  Aligned_cols=33  Identities=30%  Similarity=0.591  Sum_probs=24.4

Q ss_pred             CCccccCccc-cccccccccccccceecCCCCCC
Q psy509           30 DTCHRCRTTF-SLVQRKHHCRACGQVFCQLCSSK   62 (158)
Q Consensus        30 ~~C~~C~~~F-~~~~RkhhCr~CG~vfC~~Cs~~   62 (158)
                      ..|..|++.. ++...-..|..|+.++=.+|...
T Consensus        12 ~~C~~C~~~i~g~~~~g~~C~~C~~~~H~~C~~~   45 (53)
T PF00130_consen   12 TYCDVCGKFIWGLGKQGYRCSWCGLVCHKKCLSK   45 (53)
T ss_dssp             EB-TTSSSBECSSSSCEEEETTTT-EEETTGGCT
T ss_pred             CCCcccCcccCCCCCCeEEECCCCChHhhhhhhh
Confidence            5789998866 56677889999999887777765


No 229
>PF01873 eIF-5_eIF-2B:  Domain found in IF2B/IF5;  InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology []. Archaeal IF2beta contains two independent structural domains: an N-terminal mixed alpha/beta core domain (topological similarity to the common core of ribosomal proteins L23 and L15e), and a C-terminal domain consisting of a zinc-binding C4 finger []. Archaeal IF2beta is a ribosome-dependent GTPase that stimulates the binding of initiator Met-tRNA(i)(Met) to the ribosomes, even in the absence of other factors []. The C-terminal domain of eukaryotic IF5 is involved in the formation of the multi-factor complex (MFC), an important intermediate for the 43S pre-initiation complex assembly []. IF5 interacts directly with IF1, IF2beta and IF3c, which together with IF2-bound Met-tRNA(i)(Met) form the MFC. This entry represents both the N-terminal and zinc-binding domains of IF2, as well as a domain in IF5.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2DCU_B 2D74_B 2E9H_A 2G2K_A 1NEE_A 3CW2_L 2QMU_C 3V11_C 2NXU_A 2QN6_C ....
Probab=26.13  E-value=34  Score=25.14  Aligned_cols=24  Identities=25%  Similarity=0.719  Sum_probs=18.0

Q ss_pred             CccccCccccccccc-----cccccccce
Q psy509           31 TCHRCRTTFSLVQRK-----HHCRACGQV   54 (158)
Q Consensus        31 ~C~~C~~~F~~~~Rk-----hhCr~CG~v   54 (158)
                      .|..|+.+-+.+.++     .+|..||..
T Consensus        95 lC~~C~spdT~l~k~~r~~~l~C~aCGa~  123 (125)
T PF01873_consen   95 LCPECGSPDTELIKEGRLIFLKCKACGAS  123 (125)
T ss_dssp             SCTSTSSSSEEEEEETTCCEEEETTTSCE
T ss_pred             EcCCCCCCccEEEEcCCEEEEEecccCCc
Confidence            699999988866543     677788753


No 230
>COG0498 ThrC Threonine synthase [Amino acid transport and metabolism]
Probab=26.05  E-value=27  Score=30.88  Aligned_cols=26  Identities=27%  Similarity=0.632  Sum_probs=22.4

Q ss_pred             CCccccCcccccccccccccccccee
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVF   55 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vf   55 (158)
                      ..|..|++.|.--...+.|+.||..+
T Consensus         6 ~rc~~cg~~f~~a~~~~~c~~cGl~l   31 (411)
T COG0498           6 LRCLKCGREFSQALLQGLCPDCGLFL   31 (411)
T ss_pred             eecCCCCcchhhHHhhCcCCcCCccc
Confidence            47999999998777799999999865


No 231
>COG3791 Uncharacterized conserved protein [Function unknown]
Probab=25.88  E-value=30  Score=25.43  Aligned_cols=10  Identities=30%  Similarity=0.840  Sum_probs=6.5

Q ss_pred             CccccCcccc
Q psy509           31 TCHRCRTTFS   40 (158)
Q Consensus        31 ~C~~C~~~F~   40 (158)
                      +|..|++.++
T Consensus        28 hCs~Crk~~G   37 (133)
T COG3791          28 HCSDCRKASG   37 (133)
T ss_pred             CchHhhhhhC
Confidence            5667777643


No 232
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=25.84  E-value=40  Score=21.72  Aligned_cols=15  Identities=27%  Similarity=0.831  Sum_probs=8.3

Q ss_pred             cccccccccccccee
Q psy509           41 LVQRKHHCRACGQVF   55 (158)
Q Consensus        41 ~~~RkhhCr~CG~vf   55 (158)
                      .....-.|..||++|
T Consensus        49 i~eg~L~Cp~c~r~Y   63 (68)
T PF03966_consen   49 IVEGELICPECGREY   63 (68)
T ss_dssp             TTTTEEEETTTTEEE
T ss_pred             ccCCEEEcCCCCCEE
Confidence            344555566666654


No 233
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=25.79  E-value=34  Score=21.17  Aligned_cols=12  Identities=42%  Similarity=1.060  Sum_probs=9.3

Q ss_pred             ccccccccceec
Q psy509           45 KHHCRACGQVFC   56 (158)
Q Consensus        45 khhCr~CG~vfC   56 (158)
                      ++.|+.||.|+=
T Consensus         1 ~y~C~~CgyiYd   12 (50)
T cd00730           1 KYECRICGYIYD   12 (50)
T ss_pred             CcCCCCCCeEEC
Confidence            467889998874


No 234
>PF10164 DUF2367:  Uncharacterized conserved protein (DUF2367);  InterPro: IPR019317  This is a highly conserved set of proteins which contains three pairs of cysteine residues within a length of 42 amino acids and is rich in proline residues towards the N terminus. It includes a membrane protein that has been found to be highly expressed in the mouse brain and consequently, several members have been assigned as brain protein i3 (Bri3). Their function is unknown.
Probab=25.67  E-value=28  Score=24.73  Aligned_cols=14  Identities=36%  Similarity=1.001  Sum_probs=11.7

Q ss_pred             ccccccccccccee
Q psy509           42 VQRKHHCRACGQVF   55 (158)
Q Consensus        42 ~~RkhhCr~CG~vf   55 (158)
                      ..|+..|.+||..|
T Consensus        85 ~~r~~rC~nCG~~f   98 (98)
T PF10164_consen   85 AMRERRCSNCGATF   98 (98)
T ss_pred             hcCccccCCCCccC
Confidence            47889999999876


No 235
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=25.66  E-value=46  Score=22.26  Aligned_cols=14  Identities=36%  Similarity=0.980  Sum_probs=8.1

Q ss_pred             cccccccc--ccccee
Q psy509           42 VQRKHHCR--ACGQVF   55 (158)
Q Consensus        42 ~~RkhhCr--~CG~vf   55 (158)
                      ..|.+.|.  .||..|
T Consensus        24 ~~~Y~qC~N~eCg~tF   39 (72)
T PRK09678         24 KERYHQCQNVNCSATF   39 (72)
T ss_pred             heeeeecCCCCCCCEE
Confidence            34556666  666655


No 236
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=25.65  E-value=34  Score=16.30  Aligned_cols=9  Identities=44%  Similarity=1.353  Sum_probs=3.7

Q ss_pred             cccccccee
Q psy509           47 HCRACGQVF   55 (158)
Q Consensus        47 hCr~CG~vf   55 (158)
                      .|..||..|
T Consensus         2 ~C~~C~~~~   10 (24)
T PF13894_consen    2 QCPICGKSF   10 (24)
T ss_dssp             E-SSTS-EE
T ss_pred             CCcCCCCcC
Confidence            355565554


No 237
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=25.57  E-value=39  Score=25.75  Aligned_cols=14  Identities=29%  Similarity=0.930  Sum_probs=7.6

Q ss_pred             ccccccccccccee
Q psy509           42 VQRKHHCRACGQVF   55 (158)
Q Consensus        42 ~~RkhhCr~CG~vf   55 (158)
                      ++||..|..||+-|
T Consensus        25 IRRRReC~~C~~RF   38 (147)
T TIGR00244        25 IRRRRECLECHERF   38 (147)
T ss_pred             eeecccCCccCCcc
Confidence            45555555555544


No 238
>cd00021 BBOX B-Box-type zinc finger; zinc binding domain (CHC3H2); often present in combination with other motifs, like RING zinc finger, NHL motif, coiled-coil or RFP domain in functionally unrelated proteins, most likely mediating protein-protein interaction.
Probab=25.57  E-value=26  Score=19.39  Aligned_cols=18  Identities=17%  Similarity=0.482  Sum_probs=14.3

Q ss_pred             ccccccccceecCCCCCC
Q psy509           45 KHHCRACGQVFCQLCSSK   62 (158)
Q Consensus        45 khhCr~CG~vfC~~Cs~~   62 (158)
                      +..|..|+..+|..|...
T Consensus        12 ~~fC~~~~~~iC~~C~~~   29 (39)
T cd00021          12 SLFCETDRALLCVDCDLS   29 (39)
T ss_pred             EEEeCccChhhhhhcChh
Confidence            456889999999999744


No 239
>PRK08197 threonine synthase; Validated
Probab=25.13  E-value=41  Score=29.06  Aligned_cols=24  Identities=29%  Similarity=0.747  Sum_probs=18.2

Q ss_pred             CCccccCccccccccccccccccce
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQV   54 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~v   54 (158)
                      -.|..|++.|..-.....| .||..
T Consensus         8 ~~C~~Cg~~~~~~~~~~~C-~cg~~   31 (394)
T PRK08197          8 LECSKCGETYDADQVHNLC-KCGKP   31 (394)
T ss_pred             EEECCCCCCCCCCCcceec-CCCCe
Confidence            3699999999866566678 78755


No 240
>PF01667 Ribosomal_S27e:  Ribosomal protein S27;  InterPro: IPR000592 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaeal ribosomal proteins can be grouped on the basis of sequence similarities. One of these families include mammalian, yeast, Chlamydomonas reinhardtii and Entamoeba histolytica S27, and Methanocaldococcus jannaschii (Methanococcus jannaschii) MJ0250 []. These proteins have from 62 to 87 amino acids. They contain, in their central section, a putative zinc-finger region of the type C-x(2)-C-x(14)-C-x(2)-C.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1QXF_A 3IZ6_X 2XZN_6 2XZM_6 3U5G_b 3IZB_X 3U5C_b.
Probab=25.12  E-value=43  Score=21.28  Aligned_cols=27  Identities=37%  Similarity=0.775  Sum_probs=12.3

Q ss_pred             CccccCc---cccccccccccccccceecC
Q psy509           31 TCHRCRT---TFSLVQRKHHCRACGQVFCQ   57 (158)
Q Consensus        31 ~C~~C~~---~F~~~~RkhhCr~CG~vfC~   57 (158)
                      .|..|..   .|+--.....|..||.++|.
T Consensus         9 kCp~C~~~q~vFSha~t~V~C~~Cg~~L~~   38 (55)
T PF01667_consen    9 KCPGCYNIQTVFSHAQTVVKCVVCGTVLAQ   38 (55)
T ss_dssp             E-TTT-SEEEEETT-SS-EE-SSSTSEEEE
T ss_pred             ECCCCCCeeEEEecCCeEEEcccCCCEecC
Confidence            4555643   45544555566666666653


No 241
>PLN02400 cellulose synthase
Probab=24.88  E-value=42  Score=33.32  Aligned_cols=53  Identities=17%  Similarity=0.589  Sum_probs=38.0

Q ss_pred             CCCccccCccccccc---cccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhcc
Q psy509           29 GDTCHRCRTTFSLVQ---RKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTNY   88 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~---RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~~   88 (158)
                      +..|.+|+-.-++..   =-.-|..||.-+|..|-.+..       .....+|..|.....+.
T Consensus        36 gqiCqICGD~VG~t~dGe~FVAC~eCaFPVCRpCYEYER-------keGnq~CPQCkTrYkR~   91 (1085)
T PLN02400         36 GQICQICGDDVGVTETGDVFVACNECAFPVCRPCYEYER-------KDGTQCCPQCKTRYRRH   91 (1085)
T ss_pred             CceeeecccccCcCCCCCEEEEEccCCCccccchhheec-------ccCCccCcccCCccccc
Confidence            568999998665321   116799999999999987752       23456888887766653


No 242
>PRK12495 hypothetical protein; Provisional
Probab=24.87  E-value=39  Score=27.48  Aligned_cols=11  Identities=18%  Similarity=0.622  Sum_probs=6.1

Q ss_pred             CCccccCcccc
Q psy509           30 DTCHRCRTTFS   40 (158)
Q Consensus        30 ~~C~~C~~~F~   40 (158)
                      ..|..|+.+.-
T Consensus        43 ~hC~~CG~PIp   53 (226)
T PRK12495         43 AHCDECGDPIF   53 (226)
T ss_pred             hhcccccCccc
Confidence            45666666443


No 243
>PF12251 zf-SNAP50_C:  snRNA-activating protein of 50kDa MW C terminal;  InterPro: IPR022042  This domain family is found in eukaryotes, and is typically between 196 and 207 amino acids in length. There is a conserved CEH sequence motif. SNAP50 is part of the snRNA-activating protein complex which activates RNA polymerases II and III. There is a cysteine-histidine cluster which contains two possible zinc finger motifs. 
Probab=24.76  E-value=36  Score=26.88  Aligned_cols=39  Identities=21%  Similarity=0.507  Sum_probs=23.4

Q ss_pred             cccccccccceecCCCCCCccccC-CCCCCCceeeChhhHHHHhc
Q psy509           44 RKHHCRACGQVFCQLCSSKSTSLP-KFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        44 RkhhCr~CG~vfC~~Cs~~~~~lp-~~~~~~~~RVC~~C~~~l~~   87 (158)
                      |+..|..||...     ..++..- ......|.-.|+.||..+.-
T Consensus       138 ~~~~C~vC~~~~-----A~~v~~~d~~~p~~P~~~C~~Cf~~lhy  177 (196)
T PF12251_consen  138 RRRKCSVCGIYP-----AKWVTYNDELAPEDPCFFCDSCFRLLHY  177 (196)
T ss_pred             ccccCCCCCCCC-----CEEEEECCccCCCCCchhHHHHHHHhCC
Confidence            455666665543     2222221 12236789999999998875


No 244
>COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only]
Probab=24.73  E-value=26  Score=29.61  Aligned_cols=23  Identities=30%  Similarity=0.826  Sum_probs=17.0

Q ss_pred             CCccccCccccccccccccccccce
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQV   54 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~v   54 (158)
                      .-|..|..  =.--|-|||+.|++.
T Consensus       110 ~~C~~C~~--~KP~RS~HC~~Cn~C  132 (309)
T COG5273         110 NFCSTCNI--YKPPRSHHCSICNRC  132 (309)
T ss_pred             eecccccc--ccCCCCccchhhcch
Confidence            46777764  234688999999986


No 245
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional
Probab=24.65  E-value=36  Score=26.92  Aligned_cols=25  Identities=24%  Similarity=0.558  Sum_probs=18.6

Q ss_pred             CccccCcccccccc-----cccccccccee
Q psy509           31 TCHRCRTTFSLVQR-----KHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~~~R-----khhCr~CG~vf   55 (158)
                      .|..|+.+-+.+.+     -.+|..||..-
T Consensus       100 ~C~~C~~pdT~l~k~~~~~~l~C~aCGa~~  129 (201)
T PRK12336        100 ICSECGLPDTRLVKEDRVLMLRCDACGAHR  129 (201)
T ss_pred             ECCCCCCCCcEEEEcCCeEEEEcccCCCCc
Confidence            69999998887665     24777777754


No 246
>PRK08329 threonine synthase; Validated
Probab=24.59  E-value=45  Score=28.32  Aligned_cols=23  Identities=26%  Similarity=0.817  Sum_probs=16.5

Q ss_pred             CccccCcccccccccccccccccee
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vf   55 (158)
                      .|..|++.|..-.. +.| .||..+
T Consensus         3 ~C~~Cg~~~~~~~~-~~C-~c~~~l   25 (347)
T PRK08329          3 RCTKCGRTYEEKFK-LRC-DCGGTL   25 (347)
T ss_pred             CcCCCCCCcCCCCc-eec-CCCCcE
Confidence            69999999974333 788 687653


No 247
>KOG2272|consensus
Probab=24.15  E-value=35  Score=28.60  Aligned_cols=33  Identities=21%  Similarity=0.631  Sum_probs=21.2

Q ss_pred             Ccc-cCCCccccCcccc---cccc--------------ccccccccceecC
Q psy509           25 EWM-DGDTCHRCRTTFS---LVQR--------------KHHCRACGQVFCQ   57 (158)
Q Consensus        25 ~W~-~~~~C~~C~~~F~---~~~R--------------khhCr~CG~vfC~   57 (158)
                      .|- +--+|..|.++|-   -..|              -++|=.|++++++
T Consensus       216 hWHveHFvCa~CekPFlGHrHYEkkGlaYCe~h~~qLfG~~CF~C~~~i~G  266 (332)
T KOG2272|consen  216 HWHVEHFVCAKCEKPFLGHRHYEKKGLAYCETHYHQLFGNLCFICNRVIGG  266 (332)
T ss_pred             ccchhheeehhcCCcccchhhhhhcCchhHHHHHHHHhhhhheecCCccCc
Confidence            564 4558999999983   1111              2688888887543


No 248
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=24.14  E-value=41  Score=17.43  Aligned_cols=10  Identities=40%  Similarity=1.009  Sum_probs=5.0

Q ss_pred             ccccccccee
Q psy509           46 HHCRACGQVF   55 (158)
Q Consensus        46 hhCr~CG~vf   55 (158)
                      +.|..|+..|
T Consensus         2 ~~C~~C~k~f   11 (27)
T PF12171_consen    2 FYCDACDKYF   11 (27)
T ss_dssp             CBBTTTTBBB
T ss_pred             CCcccCCCCc
Confidence            3455555544


No 249
>COG1499 NMD3 NMD protein affecting ribosome stability and mRNA decay [Translation, ribosomal structure and biogenesis]
Probab=24.13  E-value=32  Score=29.84  Aligned_cols=30  Identities=30%  Similarity=0.556  Sum_probs=18.1

Q ss_pred             eecCCCCCCccccCCCCCCCceeeChhhHH
Q psy509           54 VFCQLCSSKSTSLPKFGIEKEVRVCEDCHE   83 (158)
Q Consensus        54 vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~   83 (158)
                      .+|..|--...++-..+..-.+++|..|-.
T Consensus        22 ~lC~dC~~~~~~~~~ip~~~~v~~C~~Cga   51 (355)
T COG1499          22 GLCGDCYVETTPLIEIPDEVNVEVCRHCGA   51 (355)
T ss_pred             cccHHHHhccCccccCCCceEEEECCcCCC
Confidence            357777655444444444456788888873


No 250
>KOG1315|consensus
Probab=24.05  E-value=25  Score=29.90  Aligned_cols=22  Identities=32%  Similarity=0.949  Sum_probs=15.1

Q ss_pred             CccccCccccccccccccccccce
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV   54 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v   54 (158)
                      -|..|..  -.--|-|||+.|++.
T Consensus       111 ~C~kC~~--iKPdRaHHCsvC~rC  132 (307)
T KOG1315|consen  111 YCDKCKC--IKPDRAHHCSVCNRC  132 (307)
T ss_pred             eeccccc--ccCCccccchhhhhh
Confidence            4666654  133589999999765


No 251
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=24.04  E-value=45  Score=18.73  Aligned_cols=10  Identities=30%  Similarity=0.909  Sum_probs=7.0

Q ss_pred             ccccccccee
Q psy509           46 HHCRACGQVF   55 (158)
Q Consensus        46 hhCr~CG~vf   55 (158)
                      +-|+.||.++
T Consensus         3 ~~C~~CG~i~   12 (34)
T cd00729           3 WVCPVCGYIH   12 (34)
T ss_pred             EECCCCCCEe
Confidence            5677777775


No 252
>PF03833 PolC_DP2:  DNA polymerase II large subunit DP2;  InterPro: IPR016033 DP2 is the large subunit of a two-subunit novel archaebacterial replicative DNA polymerase first characterised for Pyrococcus furiosus. The structure of DP2 appears to be organised as a ~950 residue component separated from a ~300 residue component by a ~150 residue intein. The other subunit, DP1, has sequence similarity to the eukaryotic DNA polymerase delta small subunit. This entry represents the N-terminal ~950 residue component of DP2.; GO: 0003887 DNA-directed DNA polymerase activity; PDB: 3O59_X.
Probab=23.99  E-value=26  Score=33.87  Aligned_cols=7  Identities=29%  Similarity=1.118  Sum_probs=0.0

Q ss_pred             CccccCc
Q psy509           31 TCHRCRT   37 (158)
Q Consensus        31 ~C~~C~~   37 (158)
                      .|..|++
T Consensus       657 ~Cp~Cg~  663 (900)
T PF03833_consen  657 RCPKCGK  663 (900)
T ss_dssp             -------
T ss_pred             cCcccCC
Confidence            4555544


No 253
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=23.69  E-value=34  Score=20.09  Aligned_cols=15  Identities=20%  Similarity=0.625  Sum_probs=11.8

Q ss_pred             ceeeChhhHHHHhcc
Q psy509           74 EVRVCEDCHEKFTNY   88 (158)
Q Consensus        74 ~~RVC~~C~~~l~~~   88 (158)
                      .+-+|+.|.......
T Consensus        23 ~~~IC~~Cv~~~~~i   37 (41)
T PF06689_consen   23 GAYICDECVEQAYEI   37 (41)
T ss_dssp             SEEEEHHHHHHHHHH
T ss_pred             CcEECHHHHHHHHHH
Confidence            489999999876543


No 254
>KOG2177|consensus
Probab=23.69  E-value=16  Score=28.36  Aligned_cols=34  Identities=29%  Similarity=0.598  Sum_probs=25.8

Q ss_pred             cCCCccccCccccccccccccccccceecCCCCCCccc
Q psy509           28 DGDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTS   65 (158)
Q Consensus        28 ~~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~   65 (158)
                      +--.|.+|-..|..-    ..-.||+.||..|......
T Consensus        12 ~~~~C~iC~~~~~~p----~~l~C~H~~c~~C~~~~~~   45 (386)
T KOG2177|consen   12 EELTCPICLEYFREP----VLLPCGHNFCRACLTRSWE   45 (386)
T ss_pred             ccccChhhHHHhhcC----ccccccchHhHHHHHHhcC
Confidence            345799998877654    6667999999999876543


No 255
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.55  E-value=41  Score=24.61  Aligned_cols=26  Identities=12%  Similarity=0.080  Sum_probs=18.5

Q ss_pred             CCccccCcccccccc-cccccccccee
Q psy509           30 DTCHRCRTTFSLVQR-KHHCRACGQVF   55 (158)
Q Consensus        30 ~~C~~C~~~F~~~~R-khhCr~CG~vf   55 (158)
                      ..|..|+++|--+|| ...|..||..|
T Consensus        10 ridPetg~KFYDLNrdPiVsPytG~s~   36 (129)
T COG4530          10 RIDPETGKKFYDLNRDPIVSPYTGKSY   36 (129)
T ss_pred             ccCccccchhhccCCCccccCcccccc
Confidence            368889999976665 45677777654


No 256
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=23.53  E-value=46  Score=21.06  Aligned_cols=25  Identities=24%  Similarity=0.494  Sum_probs=13.3

Q ss_pred             CCccccCccccccccccccccccce
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQV   54 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~v   54 (158)
                      ..|..|+.+|..-.=...|..||..
T Consensus         6 ~~C~~Cg~~~~~~dDiVvCp~Cgap   30 (54)
T PF14446_consen    6 CKCPVCGKKFKDGDDIVVCPECGAP   30 (54)
T ss_pred             ccChhhCCcccCCCCEEECCCCCCc
Confidence            4677777777433333344444443


No 257
>KOG4317|consensus
Probab=23.42  E-value=39  Score=29.11  Aligned_cols=23  Identities=26%  Similarity=0.837  Sum_probs=19.8

Q ss_pred             CccccCccccccccccccccccceecC
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVFCQ   57 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vfC~   57 (158)
                      .|.+|++.|    |++.|..|...+|+
T Consensus         9 ~C~ic~vq~----~~YtCPRCn~~YCs   31 (383)
T KOG4317|consen    9 ACGICGVQK----REYTCPRCNLLYCS   31 (383)
T ss_pred             ecccccccc----ccccCCCCCcccee
Confidence            588888877    56999999999998


No 258
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=23.39  E-value=40  Score=24.60  Aligned_cols=11  Identities=18%  Similarity=0.368  Sum_probs=8.0

Q ss_pred             CCccccCccccc
Q psy509           30 DTCHRCRTTFSL   41 (158)
Q Consensus        30 ~~C~~C~~~F~~   41 (158)
                      -.| .|+..|..
T Consensus        71 ~~C-~Cg~~~~~   81 (124)
T PRK00762         71 IEC-ECGYEGVV   81 (124)
T ss_pred             EEe-eCcCcccc
Confidence            368 88888764


No 259
>PF14445 Prok-RING_2:  Prokaryotic RING finger family 2
Probab=23.14  E-value=15  Score=23.19  Aligned_cols=45  Identities=20%  Similarity=0.661  Sum_probs=31.4

Q ss_pred             CCccccCccccccccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHh
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~   86 (158)
                      -+|-.|...|..- .-..|-.||+--|+.|-...           --.|+.|-..+.
T Consensus         8 y~CDLCn~~~p~~-~LRQCvlCGRWaC~sCW~de-----------YY~CksC~Gii~   52 (57)
T PF14445_consen    8 YSCDLCNSSHPIS-ELRQCVLCGRWACNSCWQDE-----------YYTCKSCNGIIN   52 (57)
T ss_pred             HhHHhhcccCcHH-HHHHHhhhchhhhhhhhhhh-----------HhHHHhhhchhh
Confidence            3688888888643 33579999999999886542           345777766553


No 260
>PF12647 RNHCP:  RNHCP domain;  InterPro: IPR024439 This domain is found in uncharacterised bacterial proteins. It is typically between 94 and 143 amino acids in length and has a conserved RNHCP sequence motif.
Probab=23.03  E-value=48  Score=23.30  Aligned_cols=24  Identities=33%  Similarity=0.668  Sum_probs=15.4

Q ss_pred             CCccccCccccc----cccccccccccc
Q psy509           30 DTCHRCRTTFSL----VQRKHHCRACGQ   53 (158)
Q Consensus        30 ~~C~~C~~~F~~----~~RkhhCr~CG~   53 (158)
                      -.|..|+.....    ...+.||.+|=.
T Consensus         5 F~C~~CG~~V~p~~~g~~~RNHCP~CL~   32 (92)
T PF12647_consen    5 FTCVHCGLTVSPLAAGSAHRNHCPSCLS   32 (92)
T ss_pred             cCccccCCCcccCCCCCCccCcCccccc
Confidence            367888876643    236778877743


No 261
>PF10892 DUF2688:  Protein of unknown function (DUF2688);  InterPro: IPR024392 Members of this protein family are annotated as KleB, and may play a role in the regulation of transcription in plasmids.
Probab=22.89  E-value=27  Score=22.41  Aligned_cols=11  Identities=36%  Similarity=1.060  Sum_probs=8.6

Q ss_pred             cccccccccee
Q psy509           45 KHHCRACGQVF   55 (158)
Q Consensus        45 khhCr~CG~vf   55 (158)
                      ..+||.||+.+
T Consensus        10 ~t~CrRCGk~i   20 (60)
T PF10892_consen   10 ETPCRRCGKSI   20 (60)
T ss_pred             eehhhhhCccH
Confidence            46899999864


No 262
>KOG0804|consensus
Probab=22.86  E-value=30  Score=31.04  Aligned_cols=28  Identities=32%  Similarity=0.630  Sum_probs=20.8

Q ss_pred             cCCCccccCccccccccccccccccceecCCC
Q psy509           28 DGDTCHRCRTTFSLVQRKHHCRACGQVFCQLC   59 (158)
Q Consensus        28 ~~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~C   59 (158)
                      +...|..|+..|+++    -|-.||.|.|+.=
T Consensus       227 e~~~c~~c~~~~~Lw----icliCg~vgcgrY  254 (493)
T KOG0804|consen  227 ESSLCLACGCTEDLW----ICLICGNVGCGRY  254 (493)
T ss_pred             hhhhhhhhcccccEE----EEEEccceecccc
Confidence            345677788777765    5889999998753


No 263
>PRK14892 putative transcription elongation factor Elf1; Provisional
Probab=22.56  E-value=60  Score=22.99  Aligned_cols=14  Identities=14%  Similarity=0.354  Sum_probs=7.6

Q ss_pred             cccceecCCCCCCc
Q psy509           50 ACGQVFCQLCSSKS   63 (158)
Q Consensus        50 ~CG~vfC~~Cs~~~   63 (158)
                      +=+++.|..|..+.
T Consensus        39 ~~~h~~C~~CG~y~   52 (99)
T PRK14892         39 NIAIITCGNCGLYT   52 (99)
T ss_pred             CcceEECCCCCCcc
Confidence            34555666665543


No 264
>PF00643 zf-B_box:  B-box zinc finger;  InterPro: IPR000315 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents B-box-type zinc finger domains, which are around 40 residues in length. B-box zinc fingers can be divided into two groups, where types 1 and 2 B-box domains differ in their consensus sequence and in the spacing of the 7-8 zinc-binding residues. Several proteins contain both types 1 and 2 B-boxes, suggesting some level of cooperativity between these two domains. B-box domains are found in over 1500 proteins from a variety of organisms. They are found in TRIM (tripartite motif) proteins that consist of an N-terminal RING finger (originally called an A-box), followed by 1-2 B-box domains and a coiled-coil domain (also called RBCC for Ring, B-box, Coiled-Coil). TRIM proteins contain a type 2 B-box domain, and may also contain a type 1 B-box. In proteins that do not contain RING or coiled-coil domains, the B-box domain is primarily type 2. Many type 2 B-box proteins are involved in ubiquitinylation. Proteins containing a B-box zinc finger domain include transcription factors, ribonucleoproteins and proto-oncoproteins; for example, MID1, MID2, TRIM9, TNL, TRIM36, TRIM63, TRIFIC, NCL1 and CONSTANS-like proteins []. The microtubule-associated E3 ligase MID1 (6.3.2 from EC) contains a type 1 B-box zinc finger domain. MID1 specifically binds Alpha-4, which in turn recruits the catalytic subunit of phosphatase 2A (PP2Ac). This complex is required for targeting of PP2Ac for proteasome-mediated degradation. The MID1 B-box coordinates two zinc ions and adopts a beta/beta/alpha cross-brace structure similar to that of ZZ, PHD, RING and FYVE zinc fingers [, ]. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 3DDT_B 2D8U_A 3Q1D_A 2EGM_A 2YVR_B 2DJA_A 2DQ5_A 2JUN_A 2YRG_A 2DID_A ....
Probab=22.48  E-value=19  Score=20.56  Aligned_cols=28  Identities=18%  Similarity=0.603  Sum_probs=17.8

Q ss_pred             CccccCccccccccccccccccceecCCCCCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVFCQLCSSK   62 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~   62 (158)
                      .|..+...    .-...|..|+..+|..|...
T Consensus         5 ~C~~H~~~----~~~~~C~~C~~~~C~~C~~~   32 (42)
T PF00643_consen    5 KCPEHPEE----PLSLFCEDCNEPLCSECTVS   32 (42)
T ss_dssp             B-SSTTTS----BEEEEETTTTEEEEHHHHHT
T ss_pred             cCccCCcc----ceEEEecCCCCccCccCCCC
Confidence            45555543    13456888999999888654


No 265
>PRK08351 DNA-directed RNA polymerase subunit E''; Validated
Probab=22.45  E-value=42  Score=21.79  Aligned_cols=9  Identities=33%  Similarity=0.884  Sum_probs=4.2

Q ss_pred             cccccccee
Q psy509           47 HCRACGQVF   55 (158)
Q Consensus        47 hCr~CG~vf   55 (158)
                      -||+|+.+.
T Consensus         5 AC~~C~~i~   13 (61)
T PRK08351          5 ACRHCHYIT   13 (61)
T ss_pred             hhhhCCccc
Confidence            344554443


No 266
>PRK06450 threonine synthase; Validated
Probab=22.26  E-value=51  Score=28.03  Aligned_cols=23  Identities=22%  Similarity=0.628  Sum_probs=17.6

Q ss_pred             CccccCccccccccccccccccce
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV   54 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v   54 (158)
                      .|..|++.|.. ...+.|..||..
T Consensus         5 ~C~~Cg~~~~~-~~~~~C~~cg~~   27 (338)
T PRK06450          5 VCMKCGKERES-IYEIRCKKCGGP   27 (338)
T ss_pred             EECCcCCcCCC-cccccCCcCCCE
Confidence            69999999876 434778888764


No 267
>KOG2463|consensus
Probab=22.02  E-value=35  Score=29.52  Aligned_cols=23  Identities=35%  Similarity=0.814  Sum_probs=13.7

Q ss_pred             CccccCccccccccccccccccce
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV   54 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v   54 (158)
                      .|.+|-+.|+-+ -|+.|..||.-
T Consensus       244 RCh~Cfsit~~m-~k~FCp~CG~~  266 (376)
T KOG2463|consen  244 RCHGCFSITSEM-PKDFCPSCGHK  266 (376)
T ss_pred             EeeeeeEecCcc-chhcccccCCC
Confidence            577777666544 34566666653


No 268
>COG0353 RecR Recombinational DNA repair protein (RecF pathway) [DNA replication, recombination, and repair]
Probab=22.00  E-value=56  Score=26.13  Aligned_cols=21  Identities=38%  Similarity=1.070  Sum_probs=16.0

Q ss_pred             ccccccccccce----ecCCCCCCc
Q psy509           43 QRKHHCRACGQV----FCQLCSSKS   63 (158)
Q Consensus        43 ~RkhhCr~CG~v----fC~~Cs~~~   63 (158)
                      ..-.||..||.+    .|.-|+..+
T Consensus        52 ~~i~~C~~C~~~te~d~C~ICsd~~   76 (198)
T COG0353          52 ENIKHCSVCGNLTESDPCDICSDES   76 (198)
T ss_pred             hcCccccccCCcCCCCcCcCcCCcc
Confidence            455889999987    788888653


No 269
>KOG1074|consensus
Probab=21.88  E-value=55  Score=31.75  Aligned_cols=52  Identities=23%  Similarity=0.478  Sum_probs=32.7

Q ss_pred             CCccccCcccc------------ccccccccccccceecCCCCCCccccCCCCCCCceeeChhhH
Q psy509           30 DTCHRCRTTFS------------LVQRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCH   82 (158)
Q Consensus        30 ~~C~~C~~~F~------------~~~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~   82 (158)
                      ..|.+|.+..+            .-.|-..|..||+.|-.+---+ ..+.......+.||+..|=
T Consensus       606 NqCiiC~rVlSC~saLqmHyrtHtGERPFkCKiCgRAFtTkGNLk-aH~~vHka~p~~R~q~ScP  669 (958)
T KOG1074|consen  606 NQCIICLRVLSCPSALQMHYRTHTGERPFKCKICGRAFTTKGNLK-AHMSVHKAKPPARVQFSCP  669 (958)
T ss_pred             cceeeeeecccchhhhhhhhhcccCcCccccccccchhccccchh-hcccccccCccccccccCC
Confidence            57999988775            2356678999999995543222 1111122345678887775


No 270
>smart00290 ZnF_UBP Ubiquitin Carboxyl-terminal Hydrolase-like zinc finger.
Probab=21.79  E-value=57  Score=19.23  Aligned_cols=24  Identities=38%  Similarity=0.703  Sum_probs=15.3

Q ss_pred             ccccCccccccccccccccccceecCCC
Q psy509           32 CHRCRTTFSLVQRKHHCRACGQVFCQLC   59 (158)
Q Consensus        32 C~~C~~~F~~~~RkhhCr~CG~vfC~~C   59 (158)
                      |..|+..=+    ..-|-.||+++|..-
T Consensus         2 C~~C~~~~~----l~~CL~C~~~~c~~~   25 (50)
T smart00290        2 CSVCGTIEN----LWLCLTCGQVGCGRY   25 (50)
T ss_pred             cccCCCcCC----eEEecCCCCcccCCC
Confidence            556664322    457888888888653


No 271
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=21.77  E-value=35  Score=25.63  Aligned_cols=26  Identities=31%  Similarity=0.801  Sum_probs=15.5

Q ss_pred             cccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHh
Q psy509           46 HHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        46 hhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~   86 (158)
                      .+|+.||++|=.               ....+|..|+....
T Consensus         4 ~nC~~CgklF~~---------------~~~~iCp~C~~~~e   29 (137)
T TIGR03826         4 ANCPKCGRLFVK---------------TGRDVCPSCYEEEE   29 (137)
T ss_pred             ccccccchhhhh---------------cCCccCHHHhHHHH
Confidence            367777777610               12257888876543


No 272
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=21.76  E-value=41  Score=22.04  Aligned_cols=16  Identities=19%  Similarity=0.800  Sum_probs=9.9

Q ss_pred             cccccccee----cCCCCCC
Q psy509           47 HCRACGQVF----CQLCSSK   62 (158)
Q Consensus        47 hCr~CG~vf----C~~Cs~~   62 (158)
                      -||.|+.++    |..|.+.
T Consensus         7 AC~~C~~i~~~~~Cp~Cgs~   26 (64)
T PRK06393          7 ACKKCKRLTPEKTCPVHGDE   26 (64)
T ss_pred             hHhhCCcccCCCcCCCCCCC
Confidence            477777765    6666543


No 273
>PF14279 HNH_5:  HNH endonuclease
Probab=21.66  E-value=83  Score=20.76  Aligned_cols=11  Identities=45%  Similarity=1.262  Sum_probs=9.7

Q ss_pred             eChhhHHHHhc
Q psy509           77 VCEDCHEKFTN   87 (158)
Q Consensus        77 VC~~C~~~l~~   87 (158)
                      ||+.|...+..
T Consensus        32 vC~~CN~~~g~   42 (71)
T PF14279_consen   32 VCDKCNNKFGS   42 (71)
T ss_pred             hhHHHhHHHhH
Confidence            99999998765


No 274
>KOG2879|consensus
Probab=21.44  E-value=50  Score=27.89  Aligned_cols=32  Identities=25%  Similarity=0.682  Sum_probs=24.7

Q ss_pred             CCCccccCccccccccccccccccceecCCCCCCc
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVFCQLCSSKS   63 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vfC~~Cs~~~   63 (158)
                      +.+|..|+..=+   =-|+=-.||+++|-.|....
T Consensus       239 ~~~C~~Cg~~Pt---iP~~~~~C~HiyCY~Ci~ts  270 (298)
T KOG2879|consen  239 DTECPVCGEPPT---IPHVIGKCGHIYCYYCIATS  270 (298)
T ss_pred             CceeeccCCCCC---CCeeeccccceeehhhhhhh
Confidence            568999998433   24677789999999998764


No 275
>PF05225 HTH_psq:  helix-turn-helix, Psq domain;  InterPro: IPR007889 This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster []. In pipsqueak this domain binds to GAGA sequence []. The pipsqueak family, which includes proteins from fungi, sea urchins, nematodes, insects, and vertebrates appear to be proteins essential for sequence-specific targeting of a polycomb group protein complex [].; GO: 0003677 DNA binding; PDB: 2COB_A.
Probab=21.39  E-value=71  Score=18.98  Aligned_cols=9  Identities=56%  Similarity=0.730  Sum_probs=8.0

Q ss_pred             hHHHHHHHH
Q psy509          137 EEELQLALA  145 (158)
Q Consensus       137 eedl~~aia  145 (158)
                      ||+|++||+
T Consensus         2 ee~l~~Ai~   10 (45)
T PF05225_consen    2 EEDLQKAIE   10 (45)
T ss_dssp             HHHHHHHHH
T ss_pred             HHHHHHHHH
Confidence            689999997


No 276
>KOG1812|consensus
Probab=21.36  E-value=42  Score=29.27  Aligned_cols=32  Identities=31%  Similarity=0.849  Sum_probs=21.2

Q ss_pred             CccccCccc--cccccccccccccceecCCCCCCc
Q psy509           31 TCHRCRTTF--SLVQRKHHCRACGQVFCQLCSSKS   63 (158)
Q Consensus        31 ~C~~C~~~F--~~~~RkhhCr~CG~vfC~~Cs~~~   63 (158)
                      .|..|+...  +-.--.-+|| ||+-||..|...+
T Consensus       308 ~CpkC~~~ie~~~GCnhm~Cr-C~~~fcy~C~~~~  341 (384)
T KOG1812|consen  308 QCPKCKFMIELSEGCNHMTCR-CGHQFCYMCGGDW  341 (384)
T ss_pred             cCcccceeeeecCCcceEEee-ccccchhhcCcch
Confidence            455555432  2223457899 9999999998554


No 277
>PRK14714 DNA polymerase II large subunit; Provisional
Probab=21.29  E-value=57  Score=33.01  Aligned_cols=48  Identities=23%  Similarity=0.596  Sum_probs=25.9

Q ss_pred             CCccccCccccccccccccccccce-----ecCCCCCCccccCCCCCCCceeeChhhHHHHh
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQV-----FCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFT   86 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~v-----fC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~   86 (158)
                      ..|..|+.. +..   ..|..||..     +|..|-.....   -. .. ...|..|-..+.
T Consensus       668 rkCPkCG~~-t~~---~fCP~CGs~te~vy~CPsCGaev~~---de-s~-a~~CP~CGtplv  720 (1337)
T PRK14714        668 RRCPSCGTE-TYE---NRCPDCGTHTEPVYVCPDCGAEVPP---DE-SG-RVECPRCDVELT  720 (1337)
T ss_pred             EECCCCCCc-ccc---ccCcccCCcCCCceeCccCCCccCC---Cc-cc-cccCCCCCCccc
Confidence            468888873 111   277777755     37777654211   10 11 345777765443


No 278
>PF11682 DUF3279:  Protein of unknown function (DUF3279);  InterPro: IPR021696  This family of proteins with unknown function appears to be restricted to Enterobacteriaceae. 
Probab=21.13  E-value=66  Score=23.93  Aligned_cols=46  Identities=20%  Similarity=0.349  Sum_probs=23.9

Q ss_pred             CCcCCCCCccc------ccccCCCCCCcccCCCccccCccccccccccccccccc
Q psy509            5 GFQFPVLKESD------AMFSADTAPEWMDGDTCHRCRTTFSLVQRKHHCRACGQ   53 (158)
Q Consensus         5 g~~fp~~~~s~------~~~~~~~~p~W~~~~~C~~C~~~F~~~~RkhhCr~CG~   53 (158)
                      .|.-|+.++.+      .|+....+..-+-.=.|..|+.-|.   .+.+|..||-
T Consensus        67 ~yl~pe~k~~~ri~~L~~~i~~~~pv~~~~~W~Cv~C~~~Y~---GeK~C~~C~t  118 (128)
T PF11682_consen   67 PYLDPEEKERRRIKRLRRMIADLDPVPRKTDWHCVMCGNHYH---GEKYCPKCGT  118 (128)
T ss_pred             ceECcccchHHHHHHHHHhccccCCCCcCceEEEecCCCccC---cCEecCCCCC
Confidence            46667766552      3344332322222336777877543   3566666664


No 279
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=20.98  E-value=51  Score=19.93  Aligned_cols=31  Identities=29%  Similarity=0.865  Sum_probs=18.0

Q ss_pred             CccccCccccccccccccccccce-ecCCCCCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV-FCQLCSSK   62 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v-fC~~Cs~~   62 (158)
                      .|..|+.. .+...|++|..|... +|..|-..
T Consensus         2 ~Cd~C~~~-pI~G~RykC~~C~dyDLC~~Cf~~   33 (45)
T cd02344           2 TCDGCQMF-PINGPRFKCRNCDDFDFCENCFKT   33 (45)
T ss_pred             CCCCCCCC-CCccCeEECCCCCCccchHHhhCC
Confidence            46667652 344577788877633 55555443


No 280
>PLN02569 threonine synthase
Probab=20.90  E-value=55  Score=29.44  Aligned_cols=26  Identities=15%  Similarity=0.148  Sum_probs=19.9

Q ss_pred             CCCccccCcccccccccccccccccee
Q psy509           29 GDTCHRCRTTFSLVQRKHHCRACGQVF   55 (158)
Q Consensus        29 ~~~C~~C~~~F~~~~RkhhCr~CG~vf   55 (158)
                      .-.|..|++.|..-.....| .||..+
T Consensus        49 ~l~C~~Cg~~y~~~~~~~~C-~cgg~l   74 (484)
T PLN02569         49 FLECPLTGEKYSLDEVVYRS-KSGGLL   74 (484)
T ss_pred             ccEeCCCCCcCCCccccccC-CCCCeE
Confidence            35799999988877677778 688665


No 281
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=20.81  E-value=74  Score=20.24  Aligned_cols=22  Identities=32%  Similarity=0.792  Sum_probs=14.3

Q ss_pred             CCccccCcccccccccccccccccee
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACGQVF   55 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG~vf   55 (158)
                      ..|..|+.- ++   +..|..||...
T Consensus         6 r~C~~CgvY-TL---k~~CP~CG~~t   27 (56)
T PRK13130          6 RKCPKCGVY-TL---KEICPVCGGKT   27 (56)
T ss_pred             eECCCCCCE-Ec---cccCcCCCCCC
Confidence            357777762 22   77888888754


No 282
>PLN02189 cellulose synthase
Probab=20.79  E-value=57  Score=32.27  Aligned_cols=53  Identities=23%  Similarity=0.669  Sum_probs=37.5

Q ss_pred             cCCCccccCcccccc---ccccccccccceecCCCCCCccccCCCCCCCceeeChhhHHHHhc
Q psy509           28 DGDTCHRCRTTFSLV---QRKHHCRACGQVFCQLCSSKSTSLPKFGIEKEVRVCEDCHEKFTN   87 (158)
Q Consensus        28 ~~~~C~~C~~~F~~~---~RkhhCr~CG~vfC~~Cs~~~~~lp~~~~~~~~RVC~~C~~~l~~   87 (158)
                      ....|.+|+-.-++.   .--.-|..||.-+|..|-.+..       ......|..|.....+
T Consensus        33 ~~~~C~iCgd~vg~~~~g~~fvaC~~C~fpvCr~Cyeyer-------~eg~q~CpqCkt~Y~r   88 (1040)
T PLN02189         33 DGQVCEICGDEIGLTVDGDLFVACNECGFPVCRPCYEYER-------REGTQNCPQCKTRYKR   88 (1040)
T ss_pred             cCccccccccccCcCCCCCEEEeeccCCCccccchhhhhh-------hcCCccCcccCCchhh
Confidence            356899999876521   1127899999999999987752       2345678888766654


No 283
>PRK12286 rpmF 50S ribosomal protein L32; Reviewed
Probab=20.67  E-value=54  Score=20.82  Aligned_cols=20  Identities=25%  Similarity=0.677  Sum_probs=10.1

Q ss_pred             CCccccCcccccccccccccccc
Q psy509           30 DTCHRCRTTFSLVQRKHHCRACG   52 (158)
Q Consensus        30 ~~C~~C~~~F~~~~RkhhCr~CG   52 (158)
                      ..|..|+.   +....|-|.+||
T Consensus        28 ~~C~~CG~---~~~~H~vC~~CG   47 (57)
T PRK12286         28 VECPNCGE---PKLPHRVCPSCG   47 (57)
T ss_pred             eECCCCCC---ccCCeEECCCCC
Confidence            35666665   233344455555


No 284
>cd02337 ZZ_CBP Zinc finger, ZZ type. Zinc finger present in CBP/p300 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. CREB-binding protein (CBP) is a large multidomain protein that provides binding sites for transcriptional coactivators, the role of the ZZ domain in CBP/p300 is unclear.
Probab=20.53  E-value=37  Score=19.98  Aligned_cols=28  Identities=32%  Similarity=1.007  Sum_probs=15.9

Q ss_pred             CccccCccccccccccccccccce-ecCCCCC
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQV-FCQLCSS   61 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~v-fC~~Cs~   61 (158)
                      .|..|...   ...+.||..|... .|..|-.
T Consensus         2 ~C~~C~~~---~~~r~~C~~C~dfDLC~~C~~   30 (41)
T cd02337           2 TCNECKHH---VETRWHCTVCEDYDLCITCYN   30 (41)
T ss_pred             cCCCCCCc---CCCceECCCCcchhhHHHHhC
Confidence            36677662   2377777777433 4555543


No 285
>PRK05638 threonine synthase; Validated
Probab=20.51  E-value=55  Score=28.77  Aligned_cols=23  Identities=22%  Similarity=0.816  Sum_probs=16.3

Q ss_pred             CccccCcccccccccccccccccee
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQVF   55 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~vf   55 (158)
                      .|..|++.|..- ....| .||..+
T Consensus         3 ~C~~Cg~~~~~~-~~~~C-~c~~~l   25 (442)
T PRK05638          3 KCPKCGREYNSY-IPPFC-ICGELL   25 (442)
T ss_pred             EeCCCCCCCCCC-Cceec-CCCCcE
Confidence            588999988733 33778 788654


No 286
>COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair]
Probab=20.32  E-value=41  Score=29.62  Aligned_cols=10  Identities=30%  Similarity=0.969  Sum_probs=6.0

Q ss_pred             cceecCCCCC
Q psy509           52 GQVFCQLCSS   61 (158)
Q Consensus        52 G~vfC~~Cs~   61 (158)
                      |..+|..|..
T Consensus        59 ~~~YCr~Cl~   68 (441)
T COG4098          59 GCLYCRNCLM   68 (441)
T ss_pred             ceEeehhhhh
Confidence            3557777754


No 287
>PF02132 RecR:  RecR protein;  InterPro: IPR023628 The bacterial protein RecR seems to play a role in a recombinational process of DNA repair []. It may act with RecF and RecO.  RecR's structure consists of a N-terminal helix-hairpin-helix (HhH) motif, followed by a Cys4 zinc-finger motif, a Toprim domain and a Walker B motif []. This entry represents the C4-type zinc finger.; PDB: 1VDD_D 2V1C_B.
Probab=20.29  E-value=17  Score=21.25  Aligned_cols=12  Identities=25%  Similarity=0.874  Sum_probs=5.7

Q ss_pred             ccccccccccce
Q psy509           43 QRKHHCRACGQV   54 (158)
Q Consensus        43 ~RkhhCr~CG~v   54 (158)
                      .+-++|..||.+
T Consensus        15 ~~i~~C~~C~nl   26 (41)
T PF02132_consen   15 ENIKFCSICGNL   26 (41)
T ss_dssp             HH-EE-SSS--E
T ss_pred             HcCCccCCCCCc
Confidence            345788888876


No 288
>PTZ00073 60S ribosomal protein L37; Provisional
Probab=20.26  E-value=50  Score=23.13  Aligned_cols=22  Identities=36%  Similarity=0.922  Sum_probs=10.7

Q ss_pred             CccccCccccccccccccccccc
Q psy509           31 TCHRCRTTFSLVQRKHHCRACGQ   53 (158)
Q Consensus        31 ~C~~C~~~F~~~~RkhhCr~CG~   53 (158)
                      .|..|++. ++-..|..|..||.
T Consensus        18 lCrRCG~~-syH~qK~~CasCGy   39 (91)
T PTZ00073         18 LCRRCGKR-SFHVQKKRCASCGY   39 (91)
T ss_pred             hhcccCcc-ccccccccchhcCC
Confidence            45555542 23344555555554


Done!