BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy5097
         (246 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1JII|A Chain A, Crystal Structure Of S. Aureus Tyrrs In Complex With
           Sb-219383
 pdb|1JIJ|A Chain A, Crystal Structure Of S. Aureus Tyrrs In Complex With
           Sb-239629
 pdb|1JIK|A Chain A, Crystal Structure Of S. Aureus Tyrrs In Complex With
           Sb-243545
 pdb|1JIL|A Chain A, Crystal Structure Of S. Aureus Tyrrs In Complex With
           Sb284485
          Length = 420

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 12/60 (20%)

Query: 22  WMNDSSKFGEKLLRKM-GWSDGQGLGVNQQGIKEHIKVKVKQDGKGLGFKENDQVWVEVE 80
           W N +S  G +L+R+M G +D  GL          I +  K DGK  G  E+  VW++ E
Sbjct: 197 WGNITS--GIELMRRMYGQTDAYGLT---------IPLVTKSDGKKFGKSESGAVWLDAE 245


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.304    0.125    0.350 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,055,890
Number of Sequences: 62578
Number of extensions: 279079
Number of successful extensions: 410
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 407
Number of HSP's gapped (non-prelim): 7
length of query: 246
length of database: 14,973,337
effective HSP length: 96
effective length of query: 150
effective length of database: 8,965,849
effective search space: 1344877350
effective search space used: 1344877350
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 50 (23.9 bits)