BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy5097
(246 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1JII|A Chain A, Crystal Structure Of S. Aureus Tyrrs In Complex With
Sb-219383
pdb|1JIJ|A Chain A, Crystal Structure Of S. Aureus Tyrrs In Complex With
Sb-239629
pdb|1JIK|A Chain A, Crystal Structure Of S. Aureus Tyrrs In Complex With
Sb-243545
pdb|1JIL|A Chain A, Crystal Structure Of S. Aureus Tyrrs In Complex With
Sb284485
Length = 420
Score = 28.1 bits (61), Expect = 4.4, Method: Compositional matrix adjust.
Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 12/60 (20%)
Query: 22 WMNDSSKFGEKLLRKM-GWSDGQGLGVNQQGIKEHIKVKVKQDGKGLGFKENDQVWVEVE 80
W N +S G +L+R+M G +D GL I + K DGK G E+ VW++ E
Sbjct: 197 WGNITS--GIELMRRMYGQTDAYGLT---------IPLVTKSDGKKFGKSESGAVWLDAE 245
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.304 0.125 0.350
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,055,890
Number of Sequences: 62578
Number of extensions: 279079
Number of successful extensions: 410
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 4
Number of HSP's that attempted gapping in prelim test: 407
Number of HSP's gapped (non-prelim): 7
length of query: 246
length of database: 14,973,337
effective HSP length: 96
effective length of query: 150
effective length of database: 8,965,849
effective search space: 1344877350
effective search space used: 1344877350
T: 11
A: 40
X1: 16 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.9 bits)
S2: 50 (23.9 bits)