Diaphorina citri psyllid: psy5097

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MAMLAETKKKQKWSLNPRGSAWMNDSSKFGEKLLRKMGWSDGQGLGVNQQGIKEHIKVKVKQDGKGLGFKENDQVWVEVENEFSSLLSKLSSQSDKPISDSPTSVEGVNRSLEEQSKKSKARVHYQKFTRGKDLSRYSKKDLECIFGVSSKSTESKHEENENFVQSGNMSDYFKQKKLNIGSEVEGTNTKPNSEEEKSVDNEEQDPNDEEFIEGGAKKKKKRKKAKKRKCENNDVVELNVTEAEDT
cccccHHHHccccccccccccccccccHHHHHHHHHccccccccccccccccccccEEEEEccccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHccccccccccECccccccccHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHcccccccccccccccHHcccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccc
************************DSSKFGEKLLRKMGWSDGQGLGVNQQGIKEHIKVKVKQDGKGLGFKENDQVWVEVENEFSSLLS****************************************TR**********DLECIFG***************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAMLAETKKKQKWSLNPRGSAWMNDSSKFGEKLLRKMGWSDGQGLGVNQQGIKEHIKVKVKQDGKGLGFKENDQVWVEVENEFSSLLSKLSSQSDKPISDSPTSVEGVNRSLEEQSKKSKARVHYQKFTRGKDLSRYSKKDLECIFGVSSKSTESKHEENENFVQSGNMSDYFKQKKLNIGSEVEGTNTKPNSEEEKSVDNEEQDPNDEEFIEGGAKKKKKRKKAKKRKCENNDVVELNVTEAEDT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PIN2/TERF1-interacting telomerase inhibitor 1 Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor.confidentQ96BK5
PIN2/TERF1-interacting telomerase inhibitor 1 Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor.confidentA4L691
PIN2/TERF1-interacting telomerase inhibitor 1 Microtubule-binding protein essential for faithful chromosome segregation. Mediates TRF1 and TERT accumulation in nucleolus and enhances TRF1 binding to telomeres. Inhibits telomerase activity. May inhibit cell proliferation and act as tumor suppressor.confidentQ9CZX5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007004 [BP]telomere maintenance via telomeraseprobableGO:0044238, GO:0060249, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901360, GO:0000723, GO:0006139, GO:0044260, GO:0071840, GO:0016043, GO:0071704, GO:0006260, GO:0044699, GO:0065007, GO:0065008, GO:1901576, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0044763, GO:0010833, GO:0008152, GO:0046483, GO:0006996, GO:0042592, GO:0006278, GO:0051276, GO:0032200, GO:0044237, GO:0043170, GO:0006259, GO:0008150
GO:0070034 [MF]telomeric RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0000781 [CC]chromosome, telomeric regionprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0000228 [CC]nuclear chromosomeprobableGO:0005575, GO:0031981, GO:0043232, GO:0043233, GO:0043227, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0005694, GO:0043226, GO:0044422, GO:0043231
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005819 [CC]spindleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0000776 [CC]kinetochoreprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted