BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy5099
(50 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1IRU|H Chain H, Crystal Structure Of The Mammalian 20s Proteasome At
2.75 A Resolution
pdb|1IRU|V Chain V, Crystal Structure Of The Mammalian 20s Proteasome At
2.75 A Resolution
Length = 205
Score = 40.0 bits (92), Expect = 3e-04, Method: Composition-based stats.
Identities = 17/22 (77%), Positives = 22/22 (100%)
Query: 29 TTIIAVEFDGGVVIGADSRSST 50
TTI+AV+FDGGVV+GADSR++T
Sbjct: 1 TTIMAVQFDGGVVLGADSRTTT 22
>pdb|3UNB|N Chain N, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNB|BB Chain b, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNB|PP Chain p, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNB|4 Chain 4, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNE|N Chain N, Mouse Constitutive 20s Proteasome
pdb|3UNE|BB Chain b, Mouse Constitutive 20s Proteasome
pdb|3UNE|PP Chain p, Mouse Constitutive 20s Proteasome
pdb|3UNE|4 Chain 4, Mouse Constitutive 20s Proteasome
Length = 205
Score = 38.1 bits (87), Expect = 0.001, Method: Composition-based stats.
Identities = 16/22 (72%), Positives = 22/22 (100%)
Query: 29 TTIIAVEFDGGVVIGADSRSST 50
TTI+AV+F+GGVV+GADSR++T
Sbjct: 1 TTIMAVQFNGGVVLGADSRTTT 22
>pdb|3UNF|N Chain N, Mouse 20s Immunoproteasome In Complex With Pr-957
pdb|3UNF|BB Chain b, Mouse 20s Immunoproteasome In Complex With Pr-957
pdb|3UNH|N Chain N, Mouse 20s Immunoproteasome
pdb|3UNH|BB Chain b, Mouse 20s Immunoproteasome
Length = 199
Score = 37.7 bits (86), Expect = 0.001, Method: Compositional matrix adjust.
Identities = 17/21 (80%), Positives = 20/21 (95%)
Query: 29 TTIIAVEFDGGVVIGADSRSS 49
TTI+AVEFDGGVV+G+DSR S
Sbjct: 1 TTIMAVEFDGGVVVGSDSRVS 21
>pdb|3NZJ|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex
With Ligand 2a
pdb|3NZJ|2 Chain 2, Crystal Structure Of Yeast 20s Proteasome In Complex
With Ligand 2a
pdb|3NZW|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With 2b
pdb|3NZW|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With 2b
pdb|3NZX|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Ligand 2c
pdb|3NZX|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Ligand 2c
pdb|4B4T|1 Chain 1, Near-Atomic Resolution Structural Model Of The Yeast 26s
Proteasome
Length = 215
Score = 34.7 bits (78), Expect = 0.014, Method: Compositional matrix adjust.
Identities = 15/25 (60%), Positives = 21/25 (84%)
Query: 26 SCGTTIIAVEFDGGVVIGADSRSST 50
S GT+I+AV F GV++GADSR++T
Sbjct: 17 SLGTSIMAVTFKDGVILGADSRTTT 41
>pdb|3NZJ|H Chain H, Crystal Structure Of Yeast 20s Proteasome In Complex
With Ligand 2a
pdb|3NZJ|V Chain V, Crystal Structure Of Yeast 20s Proteasome In Complex
With Ligand 2a
pdb|3NZW|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
With 2b
pdb|3NZW|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
With 2b
pdb|3NZX|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Ligand 2c
pdb|3NZX|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Ligand 2c
pdb|4B4T|2 Chain 2, Near-Atomic Resolution Structural Model Of The Yeast 26s
Proteasome
Length = 261
Score = 34.3 bits (77), Expect = 0.017, Method: Compositional matrix adjust.
Identities = 15/24 (62%), Positives = 20/24 (83%)
Query: 26 SCGTTIIAVEFDGGVVIGADSRSS 49
S GTTI+ V+F+ GVVI AD+RS+
Sbjct: 27 STGTTIVGVKFNNGVVIAADTRST 50
>pdb|1RYP|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast At
2.4 Angstroms Resolution
pdb|1RYP|V Chain V, Crystal Structure Of The 20s Proteasome From Yeast At
2.4 Angstroms Resolution
Length = 205
Score = 32.7 bits (73), Expect = 0.051, Method: Compositional matrix adjust.
Identities = 14/25 (56%), Positives = 20/25 (80%)
Query: 26 SCGTTIIAVEFDGGVVIGADSRSST 50
S G +I+AV F GV++GADSR++T
Sbjct: 7 SLGASIMAVTFKDGVILGADSRTTT 31
>pdb|1G65|N Chain N, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
Molecular Basis For Selectivity Of
Alpha,Beta-Epoxyketone Proteasome Inhibitors
pdb|1G65|2 Chain 2, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
Molecular Basis For Selectivity Of
Alpha,Beta-Epoxyketone Proteasome Inhibitors
pdb|1G0U|N Chain N, A Gated Channel Into The Proteasome Core Particle
pdb|1G0U|2 Chain 2, A Gated Channel Into The Proteasome Core Particle
pdb|1FNT|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1FNT|V Chain V, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1JD2|N Chain N, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
Complex: A Non- Covalent Proteasome Inhibitor
pdb|1JD2|U Chain U, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
Complex: A Non- Covalent Proteasome Inhibitor
pdb|1Z7Q|H Chain H, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1Z7Q|V Chain V, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|2F16|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Bortezomib
pdb|2F16|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Bortezomib
pdb|2FAK|N Chain N, Crystal Structure Of Salinosporamide A In Complex With
The Yeast 20s Proteasome
pdb|2FAK|2 Chain 2, Crystal Structure Of Salinosporamide A In Complex With
The Yeast 20s Proteasome
pdb|2GPL|N Chain N, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
Proteasome Inhibitors
pdb|2GPL|2 Chain 2, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
Proteasome Inhibitors
pdb|2ZCY|N Chain N, Yeast 20s Proteasome:syringolin A-Complex
pdb|2ZCY|1 Chain 1, Yeast 20s Proteasome:syringolin A-Complex
pdb|3BDM|N Chain N, Yeast 20s Proteasome:glidobactin A-Complex
pdb|3BDM|1 Chain 1, Yeast 20s Proteasome:glidobactin A-Complex
pdb|3D29|N Chain N, Proteasome Inhibition By Fellutamide B
pdb|3D29|2 Chain 2, Proteasome Inhibition By Fellutamide B
pdb|3E47|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Homobelactosin C
pdb|3E47|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Homobelactosin C
pdb|3DY3|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex
With The Epimer Form Of Spirolactacystin
pdb|3DY3|2 Chain 2, Crystal Structure Of Yeast 20s Proteasome In Complex
With The Epimer Form Of Spirolactacystin
pdb|3DY4|N Chain N, Crystal Structure Of Yeast 20s Proteasome In Complex
With Spirolactacystin
pdb|3DY4|2 Chain 2, Crystal Structure Of Yeast 20s Proteasome In Complex
With Spirolactacystin
pdb|3GPJ|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Syringolin B
pdb|3GPJ|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Syringolin B
pdb|3GPT|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Slow Substrate Ligand
pdb|3GPT|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Slow Substrate Ligand
pdb|3GPW|N Chain N, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Irreversible
Inhibitor Ligand
pdb|3GPW|2 Chain 2, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Irreversible
Inhibitor Ligand
pdb|3HYE|N Chain N, Crystal Structure Of 20s Proteasome In Complex With
Hydroxylated Salinosporamide
pdb|3HYE|2 Chain 2, Crystal Structure Of 20s Proteasome In Complex With
Hydroxylated Salinosporamide
pdb|3MG4|N Chain N, Structure Of Yeast 20s Proteasome With Compound 1
pdb|3MG4|2 Chain 2, Structure Of Yeast 20s Proteasome With Compound 1
pdb|3MG0|N Chain N, Structure Of Yeast 20s Proteasome With Bortezomib
pdb|3MG0|2 Chain 2, Structure Of Yeast 20s Proteasome With Bortezomib
pdb|3MG6|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 6
pdb|3MG6|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 6
pdb|3MG7|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 8
pdb|3MG7|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 8
pdb|3MG8|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 16
pdb|3MG8|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 16
pdb|3OKJ|N Chain N, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
Lead Structure Motif For Proteasome Inhibition
pdb|3OKJ|2 Chain 2, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
Lead Structure Motif For Proteasome Inhibition
pdb|3OEU|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 24
pdb|3OEU|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 24
pdb|3OEV|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 25
pdb|3OEV|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 25
pdb|3TDD|N Chain N, Crystal Structure Of Yeast Cp In Complex With Belactosin
C
pdb|3TDD|2 Chain 2, Crystal Structure Of Yeast Cp In Complex With Belactosin
C
pdb|3SHJ|N Chain N, Proteasome In Complex With Hydroxyurea Derivative Hu10
pdb|3SHJ|2 Chain 2, Proteasome In Complex With Hydroxyurea Derivative Hu10
pdb|3UN4|N Chain N, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
pdb|3UN4|BB Chain b, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
pdb|3UN8|N Chain N, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
pdb|3UN8|BB Chain b, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
pdb|3SDI|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 20
pdb|3SDI|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 20
pdb|3SDK|N Chain N, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 34
pdb|3SDK|2 Chain 2, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 34
pdb|4GK7|N Chain N, Yeast 20s Proteasome In Complex With The
Syringolin-Glidobactin Chimera
pdb|4GK7|BB Chain b, Yeast 20s Proteasome In Complex With The
Syringolin-Glidobactin Chimera
pdb|4G4S|H Chain H, Structure Of Proteasome-Pba1-Pba2 Complex
pdb|4FZC|N Chain N, 20s Yeast Proteasome In Complex With Cepafungin I
pdb|4FZC|BB Chain b, 20s Yeast Proteasome In Complex With Cepafungin I
pdb|4FZG|N Chain N, 20s Yeast Proteasome In Complex With Glidobactin
pdb|4FZG|BB Chain b, 20s Yeast Proteasome In Complex With Glidobactin
pdb|4INR|N Chain N, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu102
pdb|4INR|BB Chain b, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu102
pdb|4INT|N Chain N, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu122
pdb|4INT|BB Chain b, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu122
pdb|4INU|N Chain N, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu112
pdb|4INU|BB Chain b, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu112
Length = 196
Score = 31.2 bits (69), Expect = 0.15, Method: Compositional matrix adjust.
Identities = 13/22 (59%), Positives = 19/22 (86%)
Query: 29 TTIIAVEFDGGVVIGADSRSST 50
T+I+AV F GV++GADSR++T
Sbjct: 1 TSIMAVTFKDGVILGADSRTTT 22
>pdb|3UNB|M Chain M, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNB|AA Chain a, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNB|OO Chain o, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNB|3 Chain 3, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNE|M Chain M, Mouse Constitutive 20s Proteasome
pdb|3UNE|AA Chain a, Mouse Constitutive 20s Proteasome
pdb|3UNE|OO Chain o, Mouse Constitutive 20s Proteasome
pdb|3UNE|3 Chain 3, Mouse Constitutive 20s Proteasome
pdb|3UNF|M Chain M, Mouse 20s Immunoproteasome In Complex With Pr-957
pdb|3UNF|AA Chain a, Mouse 20s Immunoproteasome In Complex With Pr-957
pdb|3UNH|M Chain M, Mouse 20s Immunoproteasome
pdb|3UNH|AA Chain a, Mouse 20s Immunoproteasome
Length = 219
Score = 31.2 bits (69), Expect = 0.17, Method: Composition-based stats.
Identities = 12/18 (66%), Positives = 16/18 (88%)
Query: 28 GTTIIAVEFDGGVVIGAD 45
GT+++ V+FDGGVVI AD
Sbjct: 8 GTSVLGVKFDGGVVIAAD 25
>pdb|1RYP|I Chain I, Crystal Structure Of The 20s Proteasome From Yeast At
2.4 Angstroms Resolution
pdb|1RYP|W Chain W, Crystal Structure Of The 20s Proteasome From Yeast At
2.4 Angstroms Resolution
pdb|1G65|H Chain H, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
Molecular Basis For Selectivity Of
Alpha,Beta-Epoxyketone Proteasome Inhibitors
pdb|1G65|V Chain V, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
Molecular Basis For Selectivity Of
Alpha,Beta-Epoxyketone Proteasome Inhibitors
pdb|1G0U|H Chain H, A Gated Channel Into The Proteasome Core Particle
pdb|1G0U|V Chain V, A Gated Channel Into The Proteasome Core Particle
pdb|1JD2|H Chain H, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
Complex: A Non- Covalent Proteasome Inhibitor
pdb|1JD2|O Chain O, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
Complex: A Non- Covalent Proteasome Inhibitor
pdb|1Z7Q|I Chain I, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1Z7Q|W Chain W, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|2F16|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Bortezomib
pdb|2F16|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Bortezomib
pdb|2FAK|H Chain H, Crystal Structure Of Salinosporamide A In Complex With
The Yeast 20s Proteasome
pdb|2FAK|V Chain V, Crystal Structure Of Salinosporamide A In Complex With
The Yeast 20s Proteasome
pdb|2GPL|H Chain H, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
Proteasome Inhibitors
pdb|2GPL|V Chain V, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
Proteasome Inhibitors
pdb|3D29|H Chain H, Proteasome Inhibition By Fellutamide B
pdb|3D29|V Chain V, Proteasome Inhibition By Fellutamide B
pdb|3E47|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Homobelactosin C
pdb|3E47|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Homobelactosin C
pdb|3DY3|H Chain H, Crystal Structure Of Yeast 20s Proteasome In Complex
With The Epimer Form Of Spirolactacystin
pdb|3DY3|V Chain V, Crystal Structure Of Yeast 20s Proteasome In Complex
With The Epimer Form Of Spirolactacystin
pdb|3DY4|H Chain H, Crystal Structure Of Yeast 20s Proteasome In Complex
With Spirolactacystin
pdb|3DY4|V Chain V, Crystal Structure Of Yeast 20s Proteasome In Complex
With Spirolactacystin
pdb|3GPJ|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Syringolin B
pdb|3GPJ|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Syringolin B
pdb|3GPT|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Slow Substrate Ligand
pdb|3GPT|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Slow Substrate Ligand
pdb|3GPW|H Chain H, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Irreversible
Inhibitor Ligand
pdb|3GPW|V Chain V, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Irreversible
Inhibitor Ligand
pdb|3HYE|H Chain H, Crystal Structure Of 20s Proteasome In Complex With
Hydroxylated Salinosporamide
pdb|3HYE|V Chain V, Crystal Structure Of 20s Proteasome In Complex With
Hydroxylated Salinosporamide
pdb|1VSY|I Chain I, Proteasome Activator Complex
pdb|1VSY|W Chain W, Proteasome Activator Complex
pdb|3L5Q|M Chain M, Proteasome Activator Complex
pdb|3L5Q|Y Chain Y, Proteasome Activator Complex
pdb|3MG4|H Chain H, Structure Of Yeast 20s Proteasome With Compound 1
pdb|3MG4|V Chain V, Structure Of Yeast 20s Proteasome With Compound 1
pdb|3MG0|H Chain H, Structure Of Yeast 20s Proteasome With Bortezomib
pdb|3MG0|V Chain V, Structure Of Yeast 20s Proteasome With Bortezomib
pdb|3MG6|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 6
pdb|3MG6|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 6
pdb|3MG7|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 8
pdb|3MG7|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 8
pdb|3MG8|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 16
pdb|3MG8|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 16
pdb|3OKJ|H Chain H, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
Lead Structure Motif For Proteasome Inhibition
pdb|3OKJ|V Chain V, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
Lead Structure Motif For Proteasome Inhibition
pdb|3OEU|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 24
pdb|3OEU|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 24
pdb|3OEV|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 25
pdb|3OEV|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 25
pdb|3TDD|H Chain H, Crystal Structure Of Yeast Cp In Complex With Belactosin
C
pdb|3TDD|V Chain V, Crystal Structure Of Yeast Cp In Complex With Belactosin
C
pdb|3SHJ|H Chain H, Proteasome In Complex With Hydroxyurea Derivative Hu10
pdb|3SHJ|V Chain V, Proteasome In Complex With Hydroxyurea Derivative Hu10
pdb|3SDI|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 20
pdb|3SDI|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 20
pdb|3SDK|H Chain H, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 34
pdb|3SDK|V Chain V, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 34
pdb|4GK7|H Chain H, Yeast 20s Proteasome In Complex With The
Syringolin-Glidobactin Chimera
pdb|4GK7|V Chain V, Yeast 20s Proteasome In Complex With The
Syringolin-Glidobactin Chimera
pdb|4FZC|H Chain H, 20s Yeast Proteasome In Complex With Cepafungin I
pdb|4FZC|V Chain V, 20s Yeast Proteasome In Complex With Cepafungin I
pdb|4FZG|H Chain H, 20s Yeast Proteasome In Complex With Glidobactin
pdb|4FZG|V Chain V, 20s Yeast Proteasome In Complex With Glidobactin
Length = 222
Score = 30.8 bits (68), Expect = 0.18, Method: Compositional matrix adjust.
Identities = 13/21 (61%), Positives = 18/21 (85%)
Query: 29 TTIIAVEFDGGVVIGADSRSS 49
TTI+ V+F+ GVVI AD+RS+
Sbjct: 1 TTIVGVKFNNGVVIAADTRST 21
>pdb|1FNT|I Chain I, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1FNT|W Chain W, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|2ZCY|H Chain H, Yeast 20s Proteasome:syringolin A-Complex
pdb|2ZCY|V Chain V, Yeast 20s Proteasome:syringolin A-Complex
pdb|3BDM|H Chain H, Yeast 20s Proteasome:glidobactin A-Complex
pdb|3BDM|V Chain V, Yeast 20s Proteasome:glidobactin A-Complex
pdb|3UN4|H Chain H, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
pdb|3UN4|V Chain V, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
pdb|3UN8|H Chain H, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
pdb|3UN8|V Chain V, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
pdb|4G4S|I Chain I, Structure Of Proteasome-Pba1-Pba2 Complex
pdb|4INR|H Chain H, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu102
pdb|4INR|V Chain V, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu102
pdb|4INT|H Chain H, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu122
pdb|4INT|V Chain V, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu122
pdb|4INU|H Chain H, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu112
pdb|4INU|V Chain V, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu112
Length = 232
Score = 30.8 bits (68), Expect = 0.19, Method: Compositional matrix adjust.
Identities = 13/21 (61%), Positives = 18/21 (85%)
Query: 29 TTIIAVEFDGGVVIGADSRSS 49
TTI+ V+F+ GVVI AD+RS+
Sbjct: 1 TTIVGVKFNNGVVIAADTRST 21
>pdb|2JAY|A Chain A, Proteasome Beta Subunit Prcb From Mycobacterium
Tuberculosis
Length = 291
Score = 29.6 bits (65), Expect = 0.43, Method: Composition-based stats.
Identities = 12/22 (54%), Positives = 18/22 (81%)
Query: 28 GTTIIAVEFDGGVVIGADSRSS 49
GTTI+A+++ GGVV+ D RS+
Sbjct: 57 GTTIVALKYPGGVVMAGDRRST 78
>pdb|1VSY|H Chain H, Proteasome Activator Complex
pdb|1VSY|V Chain V, Proteasome Activator Complex
pdb|3L5Q|B Chain B, Proteasome Activator Complex
pdb|3L5Q|D Chain D, Proteasome Activator Complex
Length = 196
Score = 29.6 bits (65), Expect = 0.46, Method: Compositional matrix adjust.
Identities = 12/21 (57%), Positives = 18/21 (85%)
Query: 30 TIIAVEFDGGVVIGADSRSST 50
+I+AV F GV++GADSR++T
Sbjct: 2 SIMAVTFKDGVILGADSRTTT 22
>pdb|1IRU|N Chain N, Crystal Structure Of The Mammalian 20s Proteasome At
2.75 A Resolution
pdb|1IRU|2 Chain 2, Crystal Structure Of The Mammalian 20s Proteasome At
2.75 A Resolution
Length = 219
Score = 29.3 bits (64), Expect = 0.58, Method: Composition-based stats.
Identities = 11/18 (61%), Positives = 16/18 (88%)
Query: 28 GTTIIAVEFDGGVVIGAD 45
GT+++ V+F+GGVVI AD
Sbjct: 8 GTSVLGVKFEGGVVIAAD 25
>pdb|3NZJ|K Chain K, Crystal Structure Of Yeast 20s Proteasome In Complex
With Ligand 2a
pdb|3NZJ|Y Chain Y, Crystal Structure Of Yeast 20s Proteasome In Complex
With Ligand 2a
pdb|3NZW|K Chain K, Crystal Structure Of The Yeast 20s Proteasome In Complex
With 2b
pdb|3NZW|Y Chain Y, Crystal Structure Of The Yeast 20s Proteasome In Complex
With 2b
pdb|3NZX|K Chain K, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Ligand 2c
pdb|3NZX|Y Chain Y, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Ligand 2c
Length = 287
Score = 28.9 bits (63), Expect = 0.67, Method: Compositional matrix adjust.
Identities = 10/22 (45%), Positives = 16/22 (72%)
Query: 28 GTTIIAVEFDGGVVIGADSRSS 49
GTT +A F GG+++ DSR++
Sbjct: 75 GTTTLAFRFQGGIIVAVDSRAT 96
>pdb|4B4T|5 Chain 5, Near-Atomic Resolution Structural Model Of The Yeast 26s
Proteasome
Length = 287
Score = 28.9 bits (63), Expect = 0.68, Method: Compositional matrix adjust.
Identities = 10/22 (45%), Positives = 16/22 (72%)
Query: 28 GTTIIAVEFDGGVVIGADSRSS 49
GTT +A F GG+++ DSR++
Sbjct: 75 GTTTLAFRFQGGIIVAVDSRAT 96
>pdb|1RYP|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast At
2.4 Angstroms Resolution
pdb|1RYP|2 Chain 2, Crystal Structure Of The 20s Proteasome From Yeast At
2.4 Angstroms Resolution
pdb|1G65|M Chain M, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
Molecular Basis For Selectivity Of
Alpha,Beta-Epoxyketone Proteasome Inhibitors
pdb|1G65|1 Chain 1, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
Molecular Basis For Selectivity Of
Alpha,Beta-Epoxyketone Proteasome Inhibitors
pdb|1FNT|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1FNT|BB Chain b, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1JD2|M Chain M, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
Complex: A Non- Covalent Proteasome Inhibitor
pdb|1JD2|T Chain T, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
Complex: A Non- Covalent Proteasome Inhibitor
pdb|1Z7Q|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1Z7Q|BB Chain b, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|2F16|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Bortezomib
pdb|2F16|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Bortezomib
pdb|2FAK|M Chain M, Crystal Structure Of Salinosporamide A In Complex With
The Yeast 20s Proteasome
pdb|2FAK|1 Chain 1, Crystal Structure Of Salinosporamide A In Complex With
The Yeast 20s Proteasome
pdb|2GPL|M Chain M, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
Proteasome Inhibitors
pdb|2GPL|1 Chain 1, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
Proteasome Inhibitors
pdb|3D29|M Chain M, Proteasome Inhibition By Fellutamide B
pdb|3D29|1 Chain 1, Proteasome Inhibition By Fellutamide B
pdb|3E47|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Homobelactosin C
pdb|3E47|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Homobelactosin C
pdb|3DY3|M Chain M, Crystal Structure Of Yeast 20s Proteasome In Complex
With The Epimer Form Of Spirolactacystin
pdb|3DY3|1 Chain 1, Crystal Structure Of Yeast 20s Proteasome In Complex
With The Epimer Form Of Spirolactacystin
pdb|3DY4|M Chain M, Crystal Structure Of Yeast 20s Proteasome In Complex
With Spirolactacystin
pdb|3DY4|1 Chain 1, Crystal Structure Of Yeast 20s Proteasome In Complex
With Spirolactacystin
pdb|3GPJ|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Syringolin B
pdb|3GPJ|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Syringolin B
pdb|3GPT|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Slow Substrate Ligand
pdb|3GPT|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Slow Substrate Ligand
pdb|3GPW|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Irreversible
Inhibitor Ligand
pdb|3GPW|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Irreversible
Inhibitor Ligand
pdb|3HYE|M Chain M, Crystal Structure Of 20s Proteasome In Complex With
Hydroxylated Salinosporamide
pdb|3HYE|1 Chain 1, Crystal Structure Of 20s Proteasome In Complex With
Hydroxylated Salinosporamide
pdb|1VSY|N Chain N, Proteasome Activator Complex
pdb|1VSY|2 Chain 2, Proteasome Activator Complex
pdb|3L5Q|R Chain R, Proteasome Activator Complex
pdb|3L5Q|4 Chain 4, Proteasome Activator Complex
pdb|3MG4|M Chain M, Structure Of Yeast 20s Proteasome With Compound 1
pdb|3MG4|1 Chain 1, Structure Of Yeast 20s Proteasome With Compound 1
pdb|3MG0|M Chain M, Structure Of Yeast 20s Proteasome With Bortezomib
pdb|3MG0|1 Chain 1, Structure Of Yeast 20s Proteasome With Bortezomib
pdb|3OKJ|M Chain M, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
Lead Structure Motif For Proteasome Inhibition
pdb|3OKJ|1 Chain 1, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
Lead Structure Motif For Proteasome Inhibition
pdb|3OEU|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 24
pdb|3OEU|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 24
pdb|3OEV|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 25
pdb|3OEV|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 25
pdb|3TDD|M Chain M, Crystal Structure Of Yeast Cp In Complex With Belactosin
C
pdb|3TDD|1 Chain 1, Crystal Structure Of Yeast Cp In Complex With Belactosin
C
pdb|3SHJ|M Chain M, Proteasome In Complex With Hydroxyurea Derivative Hu10
pdb|3SHJ|1 Chain 1, Proteasome In Complex With Hydroxyurea Derivative Hu10
pdb|3UN4|M Chain M, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
pdb|3UN4|AA Chain a, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
pdb|3UN8|M Chain M, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
pdb|3UN8|AA Chain a, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
pdb|3SDI|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 20
pdb|3SDI|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 20
pdb|3SDK|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 34
pdb|3SDK|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 34
pdb|4GK7|M Chain M, Yeast 20s Proteasome In Complex With The
Syringolin-Glidobactin Chimera
pdb|4GK7|AA Chain a, Yeast 20s Proteasome In Complex With The
Syringolin-Glidobactin Chimera
pdb|4G4S|N Chain N, Structure Of Proteasome-Pba1-Pba2 Complex
pdb|4FZC|M Chain M, 20s Yeast Proteasome In Complex With Cepafungin I
pdb|4FZC|AA Chain a, 20s Yeast Proteasome In Complex With Cepafungin I
pdb|4FZG|M Chain M, 20s Yeast Proteasome In Complex With Glidobactin
pdb|4FZG|AA Chain a, 20s Yeast Proteasome In Complex With Glidobactin
pdb|4INR|M Chain M, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu102
pdb|4INR|AA Chain a, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu102
pdb|4INT|M Chain M, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu122
pdb|4INT|AA Chain a, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu122
pdb|4INU|M Chain M, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu112
pdb|4INU|AA Chain a, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu112
Length = 233
Score = 28.1 bits (61), Expect = 1.4, Method: Composition-based stats.
Identities = 10/22 (45%), Positives = 18/22 (81%)
Query: 28 GTTIIAVEFDGGVVIGADSRSS 49
GT++I++++D GV+I AD+ S
Sbjct: 8 GTSVISMKYDNGVIIAADNLGS 29
>pdb|3MKA|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|G Chain G, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|H Chain H, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|J Chain J, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|L Chain L, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|N Chain N, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|P Chain P, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|R Chain R, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|T Chain T, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|V Chain V, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|X Chain X, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|Z Chain Z, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
pdb|3MKA|2 Chain 2, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome With Propetide And An T1a Mutation At
Beta-Subunit
Length = 291
Score = 27.7 bits (60), Expect = 1.5, Method: Composition-based stats.
Identities = 11/22 (50%), Positives = 17/22 (77%)
Query: 28 GTTIIAVEFDGGVVIGADSRSS 49
G TI+A+++ GGVV+ D RS+
Sbjct: 57 GATIVALKYPGGVVMAGDRRST 78
>pdb|1G0U|M Chain M, A Gated Channel Into The Proteasome Core Particle
pdb|1G0U|1 Chain 1, A Gated Channel Into The Proteasome Core Particle
pdb|2ZCY|M Chain M, Yeast 20s Proteasome:syringolin A-Complex
pdb|2ZCY|0 Chain 0, Yeast 20s Proteasome:syringolin A-Complex
pdb|3BDM|M Chain M, Yeast 20s Proteasome:glidobactin A-Complex
pdb|3BDM|0 Chain 0, Yeast 20s Proteasome:glidobactin A-Complex
pdb|3NZJ|M Chain M, Crystal Structure Of Yeast 20s Proteasome In Complex
With Ligand 2a
pdb|3NZJ|1 Chain 1, Crystal Structure Of Yeast 20s Proteasome In Complex
With Ligand 2a
pdb|3NZW|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
With 2b
pdb|3NZW|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
With 2b
pdb|3NZX|M Chain M, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Ligand 2c
pdb|3NZX|1 Chain 1, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Ligand 2c
pdb|3MG6|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 6
pdb|3MG6|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 6
pdb|3MG7|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 8
pdb|3MG7|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 8
pdb|3MG8|M Chain M, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 16
pdb|3MG8|1 Chain 1, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 16
pdb|4B4T|7 Chain 7, Near-Atomic Resolution Structural Model Of The Yeast 26s
Proteasome
Length = 266
Score = 27.7 bits (60), Expect = 1.9, Method: Composition-based stats.
Identities = 10/22 (45%), Positives = 18/22 (81%)
Query: 28 GTTIIAVEFDGGVVIGADSRSS 49
GT++I++++D GV+I AD+ S
Sbjct: 41 GTSVISMKYDNGVIIAADNLGS 62
>pdb|2FHG|H Chain H, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|C Chain C, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|E Chain E, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|G Chain G, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|J Chain J, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|L Chain L, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|N Chain N, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|P Chain P, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|R Chain R, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|T Chain T, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|V Chain V, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|X Chain X, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|Z Chain Z, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHG|2 Chain 2, Crystal Structure Of Mycobacterial Tuberculosis
Proteasome
pdb|2FHH|H Chain H, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|G Chain G, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|J Chain J, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|L Chain L, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|N Chain N, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|P Chain P, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|R Chain R, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|T Chain T, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|V Chain V, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|X Chain X, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|Z Chain Z, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|2FHH|2 Chain 2, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With A Peptidyl Boronate
Inhibitor Mln-273
pdb|3HFA|H Chain H, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|G Chain G, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|J Chain J, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|L Chain L, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|N Chain N, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|P Chain P, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|R Chain R, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|T Chain T, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|V Chain V, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|X Chain X, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|Z Chain Z, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3HFA|2 Chain 2, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant
pdb|3MFE|G Chain G, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|V Chain V, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MI0|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|G Chain G, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|H Chain H, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|J Chain J, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|L Chain L, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|N Chain N, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|P Chain P, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|R Chain R, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|T Chain T, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|V Chain V, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|X Chain X, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|Z Chain Z, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3MI0|2 Chain 2, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome At 2.2 A
pdb|3KRD|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|G Chain G, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|H Chain H, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|J Chain J, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|L Chain L, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|N Chain N, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|P Chain P, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|R Chain R, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|T Chain T, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|V Chain V, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|X Chain X, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|Z Chain Z, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
pdb|3KRD|2 Chain 2, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome In Complex With Fellutamide B
Length = 240
Score = 27.3 bits (59), Expect = 2.0, Method: Compositional matrix adjust.
Identities = 11/21 (52%), Positives = 17/21 (80%)
Query: 29 TTIIAVEFDGGVVIGADSRSS 49
TTI+A+++ GGVV+ D RS+
Sbjct: 1 TTIVALKYPGGVVMAGDRRST 21
>pdb|1Q5R|H Chain H, The Rhodococcus 20s Proteasome With Unprocessed
Pro-Peptides
pdb|1Q5R|I Chain I, The Rhodococcus 20s Proteasome With Unprocessed
Pro-Peptides
pdb|1Q5R|J Chain J, The Rhodococcus 20s Proteasome With Unprocessed
Pro-Peptides
pdb|1Q5R|K Chain K, The Rhodococcus 20s Proteasome With Unprocessed
Pro-Peptides
pdb|1Q5R|L Chain L, The Rhodococcus 20s Proteasome With Unprocessed
Pro-Peptides
pdb|1Q5R|M Chain M, The Rhodococcus 20s Proteasome With Unprocessed
Pro-Peptides
pdb|1Q5R|N Chain N, The Rhodococcus 20s Proteasome With Unprocessed
Pro-Peptides
Length = 294
Score = 27.3 bits (59), Expect = 2.2, Method: Composition-based stats.
Identities = 10/22 (45%), Positives = 17/22 (77%)
Query: 28 GTTIIAVEFDGGVVIGADSRSS 49
GTTI+A+ + GGV++ D R++
Sbjct: 65 GTTIVALTYKGGVLLAGDRRAT 86
>pdb|2H6J|H Chain H, Crystal Structure Of The Beta F145a Rhodococcus
Proteasome (Casp Target)
pdb|2H6J|I Chain I, Crystal Structure Of The Beta F145a Rhodococcus
Proteasome (Casp Target)
pdb|2H6J|J Chain J, Crystal Structure Of The Beta F145a Rhodococcus
Proteasome (Casp Target)
pdb|2H6J|K Chain K, Crystal Structure Of The Beta F145a Rhodococcus
Proteasome (Casp Target)
pdb|2H6J|L Chain L, Crystal Structure Of The Beta F145a Rhodococcus
Proteasome (Casp Target)
pdb|2H6J|M Chain M, Crystal Structure Of The Beta F145a Rhodococcus
Proteasome (Casp Target)
pdb|2H6J|N Chain N, Crystal Structure Of The Beta F145a Rhodococcus
Proteasome (Casp Target)
Length = 294
Score = 27.3 bits (59), Expect = 2.3, Method: Composition-based stats.
Identities = 10/22 (45%), Positives = 17/22 (77%)
Query: 28 GTTIIAVEFDGGVVIGADSRSS 49
GTTI+A+ + GGV++ D R++
Sbjct: 65 GTTIVALTYKGGVLLAGDRRAT 86
>pdb|1G0U|K Chain K, A Gated Channel Into The Proteasome Core Particle
pdb|1G0U|Y Chain Y, A Gated Channel Into The Proteasome Core Particle
pdb|1JD2|K Chain K, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
Complex: A Non- Covalent Proteasome Inhibitor
pdb|1JD2|R Chain R, Crystal Structure Of The Yeast 20s Proteasome:tmc-95a
Complex: A Non- Covalent Proteasome Inhibitor
pdb|2F16|K Chain K, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Bortezomib
pdb|2F16|Y Chain Y, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Bortezomib
pdb|2FAK|K Chain K, Crystal Structure Of Salinosporamide A In Complex With
The Yeast 20s Proteasome
pdb|2FAK|Y Chain Y, Crystal Structure Of Salinosporamide A In Complex With
The Yeast 20s Proteasome
pdb|2GPL|K Chain K, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
Proteasome Inhibitors
pdb|2GPL|Y Chain Y, Tmc-95 Based Biphenyl-Ether Macrocycles: Specific
Proteasome Inhibitors
pdb|2ZCY|K Chain K, Yeast 20s Proteasome:syringolin A-Complex
pdb|2ZCY|Y Chain Y, Yeast 20s Proteasome:syringolin A-Complex
pdb|3BDM|K Chain K, Yeast 20s Proteasome:glidobactin A-Complex
pdb|3BDM|Y Chain Y, Yeast 20s Proteasome:glidobactin A-Complex
pdb|3D29|K Chain K, Proteasome Inhibition By Fellutamide B
pdb|3D29|Y Chain Y, Proteasome Inhibition By Fellutamide B
pdb|3E47|K Chain K, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Homobelactosin C
pdb|3E47|Y Chain Y, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Homobelactosin C
pdb|3DY3|K Chain K, Crystal Structure Of Yeast 20s Proteasome In Complex
With The Epimer Form Of Spirolactacystin
pdb|3DY3|Y Chain Y, Crystal Structure Of Yeast 20s Proteasome In Complex
With The Epimer Form Of Spirolactacystin
pdb|3DY4|K Chain K, Crystal Structure Of Yeast 20s Proteasome In Complex
With Spirolactacystin
pdb|3DY4|Y Chain Y, Crystal Structure Of Yeast 20s Proteasome In Complex
With Spirolactacystin
pdb|3GPJ|K Chain K, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Syringolin B
pdb|3GPJ|Y Chain Y, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Syringolin B
pdb|3GPT|K Chain K, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Slow Substrate Ligand
pdb|3GPT|Y Chain Y, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Slow Substrate Ligand
pdb|3GPW|K Chain K, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Irreversible
Inhibitor Ligand
pdb|3GPW|Y Chain Y, Crystal Structure Of The Yeast 20s Proteasome In Complex
With Salinosporamide Derivatives: Irreversible
Inhibitor Ligand
pdb|3HYE|K Chain K, Crystal Structure Of 20s Proteasome In Complex With
Hydroxylated Salinosporamide
pdb|3HYE|Y Chain Y, Crystal Structure Of 20s Proteasome In Complex With
Hydroxylated Salinosporamide
pdb|3MG4|K Chain K, Structure Of Yeast 20s Proteasome With Compound 1
pdb|3MG4|Y Chain Y, Structure Of Yeast 20s Proteasome With Compound 1
pdb|3MG0|K Chain K, Structure Of Yeast 20s Proteasome With Bortezomib
pdb|3MG0|Y Chain Y, Structure Of Yeast 20s Proteasome With Bortezomib
pdb|3MG6|K Chain K, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 6
pdb|3MG6|Y Chain Y, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 6
pdb|3MG7|K Chain K, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 8
pdb|3MG7|Y Chain Y, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 8
pdb|3MG8|K Chain K, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 16
pdb|3MG8|Y Chain Y, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 16
pdb|3OKJ|K Chain K, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
Lead Structure Motif For Proteasome Inhibition
pdb|3OKJ|Y Chain Y, Alpha-Keto-Aldehyde Binding Mechanism Reveals A Novel
Lead Structure Motif For Proteasome Inhibition
pdb|3OEU|K Chain K, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 24
pdb|3OEU|Y Chain Y, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 24
pdb|3OEV|K Chain K, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 25
pdb|3OEV|Y Chain Y, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 25
pdb|3TDD|K Chain K, Crystal Structure Of Yeast Cp In Complex With Belactosin
C
pdb|3TDD|Y Chain Y, Crystal Structure Of Yeast Cp In Complex With Belactosin
C
pdb|3SHJ|K Chain K, Proteasome In Complex With Hydroxyurea Derivative Hu10
pdb|3SHJ|Y Chain Y, Proteasome In Complex With Hydroxyurea Derivative Hu10
pdb|1G65|K Chain K, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
Molecular Basis For Selectivity Of
Alpha,Beta-Epoxyketone Proteasome Inhibitors
pdb|1G65|Y Chain Y, Crystal Structure Of Epoxomicin:20s Proteasome Reveals A
Molecular Basis For Selectivity Of
Alpha,Beta-Epoxyketone Proteasome Inhibitors
pdb|3UN4|K Chain K, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
pdb|3UN4|Y Chain Y, Yeast 20s Proteasome In Complex With Pr-957 (Morpholine)
pdb|3UN8|K Chain K, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
pdb|3UN8|Y Chain Y, Yeast 20s Proteasome In Complex With Pr-957 (Epoxide)
pdb|3SDI|K Chain K, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 20
pdb|3SDI|Y Chain Y, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 20
pdb|3SDK|K Chain K, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 34
pdb|3SDK|Y Chain Y, Structure Of Yeast 20s Open-Gate Proteasome With
Compound 34
pdb|4GK7|K Chain K, Yeast 20s Proteasome In Complex With The
Syringolin-Glidobactin Chimera
pdb|4GK7|Y Chain Y, Yeast 20s Proteasome In Complex With The
Syringolin-Glidobactin Chimera
pdb|4G4S|L Chain L, Structure Of Proteasome-Pba1-Pba2 Complex
pdb|4FZC|K Chain K, 20s Yeast Proteasome In Complex With Cepafungin I
pdb|4FZC|Y Chain Y, 20s Yeast Proteasome In Complex With Cepafungin I
pdb|4FZG|K Chain K, 20s Yeast Proteasome In Complex With Glidobactin
pdb|4FZG|Y Chain Y, 20s Yeast Proteasome In Complex With Glidobactin
pdb|4INR|K Chain K, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu102
pdb|4INR|Y Chain Y, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu102
pdb|4INT|K Chain K, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu122
pdb|4INT|Y Chain Y, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu122
pdb|4INU|K Chain K, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu112
pdb|4INU|Y Chain Y, Yeast 20s Proteasome In Complex With The Vinyl Sulfone
Lu112
Length = 212
Score = 26.9 bits (58), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 9/21 (42%), Positives = 15/21 (71%)
Query: 29 TTIIAVEFDGGVVIGADSRSS 49
TT +A F GG+++ DSR++
Sbjct: 1 TTTLAFRFQGGIIVAVDSRAT 21
>pdb|1RYP|L Chain L, Crystal Structure Of The 20s Proteasome From Yeast At
2.4 Angstroms Resolution
pdb|1RYP|Z Chain Z, Crystal Structure Of The 20s Proteasome From Yeast At
2.4 Angstroms Resolution
pdb|1FNT|L Chain L, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1FNT|Z Chain Z, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1Z7Q|L Chain L, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1Z7Q|Z Chain Z, Crystal Structure Of The 20s Proteasome From Yeast In
Complex With The Proteasome Activator Pa26 From
Trypanosome Brucei At 3.2 Angstroms Resolution
pdb|1VSY|L Chain L, Proteasome Activator Complex
pdb|1VSY|Z Chain Z, Proteasome Activator Complex
pdb|3L5Q|P Chain P, Proteasome Activator Complex
pdb|3L5Q|2 Chain 2, Proteasome Activator Complex
Length = 212
Score = 26.9 bits (58), Expect = 3.2, Method: Compositional matrix adjust.
Identities = 9/21 (42%), Positives = 15/21 (71%)
Query: 29 TTIIAVEFDGGVVIGADSRSS 49
TT +A F GG+++ DSR++
Sbjct: 1 TTTLAFRFQGGIIVAVDSRAT 21
>pdb|3UNF|H Chain H, Mouse 20s Immunoproteasome In Complex With Pr-957
pdb|3UNF|V Chain V, Mouse 20s Immunoproteasome In Complex With Pr-957
pdb|3UNH|H Chain H, Mouse 20s Immunoproteasome
pdb|3UNH|V Chain V, Mouse 20s Immunoproteasome
Length = 234
Score = 26.2 bits (56), Expect = 4.8, Method: Composition-based stats.
Identities = 10/21 (47%), Positives = 16/21 (76%)
Query: 29 TTIIAVEFDGGVVIGADSRSS 49
TTI + F GV++GAD+R++
Sbjct: 1 TTIAGLVFRDGVILGADTRAT 21
>pdb|3UNB|H Chain H, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNB|V Chain V, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNB|JJ Chain j, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNB|XX Chain x, Mouse Constitutive 20s Proteasome In Complex With Pr-957
pdb|3UNE|H Chain H, Mouse Constitutive 20s Proteasome
pdb|3UNE|V Chain V, Mouse Constitutive 20s Proteasome
pdb|3UNE|JJ Chain j, Mouse Constitutive 20s Proteasome
pdb|3UNE|XX Chain x, Mouse Constitutive 20s Proteasome
Length = 234
Score = 26.2 bits (56), Expect = 4.9, Method: Composition-based stats.
Identities = 10/21 (47%), Positives = 16/21 (76%)
Query: 29 TTIIAVEFDGGVVIGADSRSS 49
TTI V + G+V+GAD+R++
Sbjct: 1 TTIAGVVYKDGIVLGADTRAT 21
>pdb|1IRU|I Chain I, Crystal Structure Of The Mammalian 20s Proteasome At
2.75 A Resolution
pdb|1IRU|W Chain W, Crystal Structure Of The Mammalian 20s Proteasome At
2.75 A Resolution
Length = 234
Score = 26.2 bits (56), Expect = 5.2, Method: Composition-based stats.
Identities = 10/21 (47%), Positives = 16/21 (76%)
Query: 29 TTIIAVEFDGGVVIGADSRSS 49
TTI V + G+V+GAD+R++
Sbjct: 1 TTIAGVVYKDGIVLGADTRAT 21
>pdb|1IRU|L Chain L, Crystal Structure Of The Mammalian 20s Proteasome At
2.75 A Resolution
pdb|1IRU|Z Chain Z, Crystal Structure Of The Mammalian 20s Proteasome At
2.75 A Resolution
Length = 204
Score = 25.8 bits (55), Expect = 6.1, Method: Compositional matrix adjust.
Identities = 10/21 (47%), Positives = 16/21 (76%)
Query: 29 TTIIAVEFDGGVVIGADSRSS 49
TT +A +F GV++ ADSR++
Sbjct: 1 TTTLAFKFRHGVIVAADSRAT 21
>pdb|3H6F|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|G Chain G, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|H Chain H, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|J Chain J, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|L Chain L, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|N Chain N, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|P Chain P, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|R Chain R, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|T Chain T, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|V Chain V, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|X Chain X, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|Z Chain Z, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6F|2 Chain 2, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Ht1171
pdb|3H6I|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|G Chain G, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|H Chain H, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|J Chain J, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|L Chain L, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|N Chain N, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|P Chain P, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|R Chain R, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|T Chain T, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|V Chain V, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|X Chain X, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|Z Chain Z, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3H6I|2 Chain 2, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Modified By Inhibitor Gl1
pdb|3HF9|H Chain H, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|G Chain G, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|J Chain J, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|L Chain L, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|N Chain N, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|P Chain P, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|R Chain R, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|T Chain T, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|V Chain V, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|X Chain X, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|Z Chain Z, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|2 Chain 2, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|HH Chain h, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|CC Chain c, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|EE Chain e, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|GG Chain g, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|JJ Chain j, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|LL Chain l, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|NN Chain n, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|PP Chain p, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|RR Chain r, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|TT Chain t, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|VV Chain v, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|XX Chain x, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|ZZ Chain z, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3HF9|4 Chain 4, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant Modified By Inhibitor Gl1
pdb|3MFE|H Chain H, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|C Chain C, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|E Chain E, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|J Chain J, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|L Chain L, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|N Chain N, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|P Chain P, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|R Chain R, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|T Chain T, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|X Chain X, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|Z Chain Z, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
pdb|3MFE|2 Chain 2, Crystal Structure Of Mycobacterium Tuberculosis
Proteasome Open-Gate Mutant With H0 Movement
Length = 240
Score = 25.8 bits (55), Expect = 6.9, Method: Compositional matrix adjust.
Identities = 10/20 (50%), Positives = 16/20 (80%)
Query: 30 TIIAVEFDGGVVIGADSRSS 49
TI+A+++ GGVV+ D RS+
Sbjct: 2 TIVALKYPGGVVMAGDRRST 21
>pdb|2JGT|A Chain A, Low Resolution Structure Of Spt
pdb|2JGT|B Chain B, Low Resolution Structure Of Spt
Length = 422
Score = 25.0 bits (53), Expect = 9.9, Method: Composition-based stats.
Identities = 11/34 (32%), Positives = 19/34 (55%), Gaps = 3/34 (8%)
Query: 1 MWNKDYNVNAYHGGVEAPDWLTAKHSCGTTIIAV 34
+W+ N A HGG++A + +C + I+AV
Sbjct: 322 LWS---NARALHGGLKAMGFRLGTETCDSAIVAV 352
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.132 0.426
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,723,384
Number of Sequences: 62578
Number of extensions: 50004
Number of successful extensions: 142
Number of sequences better than 100.0: 36
Number of HSP's better than 100.0 without gapping: 36
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 106
Number of HSP's gapped (non-prelim): 36
length of query: 50
length of database: 14,973,337
effective HSP length: 23
effective length of query: 27
effective length of database: 13,534,043
effective search space: 365419161
effective search space used: 365419161
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)