Query         psy5099
Match_columns 50
No_of_seqs    119 out of 536
Neff          4.2 
Searched_HMMs 46136
Date          Fri Aug 16 17:15:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5099.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5099hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0173|consensus               99.5 1.1E-14 2.5E-19  101.3   4.5   45    4-50     15-59  (271)
  2 KOG0174|consensus               99.0 2.5E-10 5.4E-15   78.0   3.7   31   20-50     11-41  (224)
  3 KOG0185|consensus               98.8 5.4E-09 1.2E-13   72.7   3.5   33   18-50     31-63  (256)
  4 KOG0175|consensus               98.7   2E-08 4.3E-13   70.7   3.3   28   23-50     66-93  (285)
  5 PRK05456 ATP-dependent proteas  98.6 2.4E-08 5.2E-13   64.6   3.0   23   28-50      1-23  (172)
  6 PTZ00488 Proteasome subunit be  98.6 3.5E-08 7.6E-13   66.3   3.3   27   23-49     34-60  (247)
  7 cd03760 proteasome_beta_type_4  98.5 1.3E-07 2.8E-12   60.4   3.2   23   27-49      1-23  (197)
  8 cd03757 proteasome_beta_type_1  98.5 1.5E-07 3.3E-12   61.0   3.4   26   25-50      5-30  (212)
  9 COG0638 PRE1 20S proteasome, a  98.4 2.3E-07 4.9E-12   61.8   3.5   26   25-50     27-52  (236)
 10 cd03759 proteasome_beta_type_3  98.4 2.3E-07   5E-12   59.2   3.4   23   27-49      2-24  (195)
 11 cd03753 proteasome_alpha_type_  98.4 1.9E-07 4.1E-12   60.2   3.0   27   23-49     22-48  (213)
 12 cd01911 proteasome_alpha prote  98.4 2.3E-07 4.9E-12   59.6   2.9   27   23-49     22-48  (209)
 13 TIGR03692 ATP_dep_HslV ATP-dep  98.4 2.3E-07   5E-12   60.5   2.8   22   29-50      1-22  (171)
 14 TIGR03633 arc_protsome_A prote  98.4 2.7E-07 5.9E-12   59.8   3.0   27   23-49     24-50  (224)
 15 PF00227 Proteasome:  Proteasom  98.4 1.5E-07 3.3E-12   58.2   1.7   25   25-49      1-25  (190)
 16 cd01913 protease_HslV Protease  98.4 2.7E-07 5.8E-12   60.3   2.8   22   29-50      1-22  (171)
 17 cd03750 proteasome_alpha_type_  98.4 3.2E-07 6.8E-12   59.9   2.8   27   23-49     22-48  (227)
 18 cd03756 proteasome_alpha_arche  98.3 4.2E-07   9E-12   58.5   2.9   27   23-49     23-49  (211)
 19 TIGR03634 arc_protsome_B prote  98.3 6.4E-07 1.4E-11   56.1   3.4   22   28-49      1-22  (185)
 20 PRK03996 proteasome subunit al  98.3 5.4E-07 1.2E-11   59.1   2.9   27   23-49     31-57  (241)
 21 TIGR03690 20S_bact_beta protea  98.3   8E-07 1.7E-11   58.0   3.4   23   27-49      1-23  (219)
 22 cd03752 proteasome_alpha_type_  98.3 6.6E-07 1.4E-11   57.8   3.0   27   23-49     24-50  (213)
 23 cd03755 proteasome_alpha_type_  98.2   1E-06 2.2E-11   56.7   3.1   27   23-49     22-48  (207)
 24 cd03751 proteasome_alpha_type_  98.2 8.9E-07 1.9E-11   57.7   2.8   27   23-49     25-51  (212)
 25 cd03749 proteasome_alpha_type_  98.2 1.2E-06 2.6E-11   56.8   3.0   27   23-49     22-48  (211)
 26 PTZ00246 proteasome subunit al  98.2 1.2E-06 2.7E-11   58.0   3.1   27   24-50     27-53  (253)
 27 cd03762 proteasome_beta_type_6  98.2 1.6E-06 3.5E-11   54.6   3.3   22   29-50      1-22  (188)
 28 cd03761 proteasome_beta_type_5  98.2 1.9E-06 4.1E-11   54.7   3.3   22   29-50      1-22  (188)
 29 cd03763 proteasome_beta_type_7  98.2 2.1E-06 4.4E-11   54.4   3.3   22   29-50      1-22  (189)
 30 cd03758 proteasome_beta_type_2  98.1 2.5E-06 5.4E-11   54.5   3.1   21   29-49      2-22  (193)
 31 cd01906 proteasome_protease_Hs  98.1 3.2E-06   7E-11   51.9   3.4   21   29-49      1-21  (182)
 32 cd01912 proteasome_beta protea  98.1 3.9E-06 8.6E-11   52.3   3.3   21   29-49      1-21  (189)
 33 cd03764 proteasome_beta_archea  98.1   4E-06 8.7E-11   52.8   3.3   22   29-50      1-22  (188)
 34 cd03754 proteasome_alpha_type_  98.0 9.7E-06 2.1E-10   52.7   3.5   23   27-49     28-50  (215)
 35 TIGR03691 20S_bact_alpha prote  97.7 2.3E-05   5E-10   52.2   2.7   25   23-47     22-46  (228)
 36 cd03765 proteasome_beta_bacter  97.5  0.0001 2.3E-09   49.7   3.3   21   29-49      1-21  (236)
 37 cd01901 Ntn_hydrolase The Ntn   97.4 0.00018   4E-09   41.7   3.4   21   29-49      1-21  (164)
 38 KOG0176|consensus               96.4  0.0031 6.7E-08   43.8   2.7   27   24-50     30-56  (241)
 39 KOG0184|consensus               96.1  0.0043 9.4E-08   43.5   2.4   27   23-49     29-55  (254)
 40 KOG0178|consensus               92.6    0.11 2.3E-06   36.5   2.5   26   24-49     27-52  (249)
 41 KOG0179|consensus               90.7    0.26 5.6E-06   34.4   2.7   25   26-50     27-51  (235)
 42 COG5405 HslV ATP-dependent pro  89.9    0.26 5.7E-06   33.2   2.1   23   27-49      3-25  (178)
 43 KOG0181|consensus               85.8    0.83 1.8E-05   31.9   2.6   24   24-47     28-51  (233)
 44 KOG0177|consensus               81.1     1.4 3.1E-05   30.2   2.2   19   30-48      3-21  (200)
 45 KOG0180|consensus               79.6     2.2 4.7E-05   29.3   2.7   23   26-48      6-28  (204)
 46 KOG0183|consensus               68.4     4.2   9E-05   28.7   2.0   28   22-49     24-51  (249)
 47 PF09894 DUF2121:  Uncharacteri  66.1     5.1 0.00011   27.3   2.0   19   30-48      3-21  (194)
 48 COG3484 Predicted proteasome-t  57.0      12 0.00027   26.4   2.7   20   30-49      3-22  (255)
 49 cd01586 AcnA_IRP Aconitase A c  56.8     9.5 0.00021   28.3   2.2   17   33-50    117-133 (404)
 50 PLN00070 aconitate hydratase    31.4      27 0.00059   28.6   1.3   17   33-50    236-252 (936)
 51 COG4079 Uncharacterized protei  31.1      39 0.00086   24.4   1.9   20   29-48      2-21  (293)
 52 TIGR01341 aconitase_1 aconitat  30.8      28 0.00061   28.3   1.3   17   33-50    184-200 (876)
 53 COG1445 FrwB Phosphotransferas  30.2      33 0.00072   21.8   1.3   14   34-47     54-67  (122)
 54 KOG3333|consensus               28.7      46 0.00099   22.6   1.8   21   27-47     68-90  (188)
 55 PRK14364 Maf-like protein; Pro  26.3      37  0.0008   22.1   1.1   13   35-47     54-66  (181)
 56 COG0490 Putative regulatory, l  24.7      70  0.0015   21.2   2.1   20   24-43    109-128 (162)
 57 PTZ00092 aconitate hydratase-l  24.3      75  0.0016   26.1   2.6   17   33-50    204-220 (898)
 58 PRK00148 Maf-like protein; Rev  21.7      54  0.0012   21.5   1.2   13   35-47     58-70  (194)
 59 TIGR02764 spore_ybaN_pdaB poly  21.5      71  0.0015   19.7   1.6   14   27-40      3-16  (191)
 60 PF11697 DUF3293:  Protein of u  20.9      38 0.00083   18.9   0.3   12    4-15     15-26  (73)
 61 COG0424 Maf Nucleotide-binding  20.4      57  0.0012   21.9   1.1   11   37-47     63-73  (193)

No 1  
>KOG0173|consensus
Probab=99.52  E-value=1.1e-14  Score=101.34  Aligned_cols=45  Identities=31%  Similarity=0.419  Sum_probs=42.4

Q ss_pred             hhhhhhhhhcCCCCCCccccccccCccEEEEEeCCeEEEeeeCCCCC
Q psy5099           4 KDYNVNAYHGGVEAPDWLTAKHSCGTTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus         4 ~n~~Rn~~l~~~~~~~~~~~~~~tGTTivgi~~~~GVIlaaD~rat~   50 (50)
                      +||+||+.|.+++++  .|...+|||||+|+.|+||||||||+|+|.
T Consensus        15 ~nc~rn~~l~~~g~k--~p~~tkTGTtIvgv~~k~gvIlgADtRaT~   59 (271)
T KOG0173|consen   15 DNCQRNAALLKKGLK--APKATKTGTTIVGVIFKDGVILGADTRATE   59 (271)
T ss_pred             hhhhhHHHHHhcCCC--CCcccccCcEEEEEEeCCeEEEeecccccC
Confidence            799999999999888  788899999999999999999999999984


No 2  
>KOG0174|consensus
Probab=99.02  E-value=2.5e-10  Score=78.03  Aligned_cols=31  Identities=65%  Similarity=0.912  Sum_probs=27.9

Q ss_pred             ccccccccCccEEEEEeCCeEEEeeeCCCCC
Q psy5099          20 WLTAKHSCGTTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        20 ~~~~~~~tGTTivgi~~~~GVIlaaD~rat~   50 (50)
                      ....+++|||||+|++|+||||||||+|+|+
T Consensus        11 ~~~~evstGTTImAv~y~gGVvlGaDSRTs~   41 (224)
T KOG0174|consen   11 LPKEEVSTGTTIMAVEYDGGVVLGADSRTST   41 (224)
T ss_pred             CcccccccCceEEEEEEcCcEEEeccCCccc
Confidence            3456899999999999999999999999984


No 3  
>KOG0185|consensus
Probab=98.78  E-value=5.4e-09  Score=72.72  Aligned_cols=33  Identities=30%  Similarity=0.426  Sum_probs=29.4

Q ss_pred             CCccccccccCccEEEEEeCCeEEEeeeCCCCC
Q psy5099          18 PDWLTAKHSCGTTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        18 ~~~~~~~~~tGTTivgi~~~~GVIlaaD~rat~   50 (50)
                      .....+++.|||||+|++|+||||||||++.|.
T Consensus        31 ~qrt~~p~vTGTSVla~ky~~GVviaaD~lgSY   63 (256)
T KOG0185|consen   31 IQRTLNPIVTGTSVLALKYKDGVVIAADTLGSY   63 (256)
T ss_pred             cccccCceeccceEEEEEecCceEEEecccccc
Confidence            445678999999999999999999999999874


No 4  
>KOG0175|consensus
Probab=98.66  E-value=2e-08  Score=70.74  Aligned_cols=28  Identities=46%  Similarity=0.786  Sum_probs=25.6

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat~   50 (50)
                      .+..+|||++|++|++|||+|+|+|||+
T Consensus        66 i~~~hGTTTLAF~f~~GvivAvDSRAs~   93 (285)
T KOG0175|consen   66 IKFAHGTTTLAFKFKGGVIVAVDSRASA   93 (285)
T ss_pred             eeecCCceEEEEEecCcEEEEEeccccc
Confidence            3468999999999999999999999985


No 5  
>PRK05456 ATP-dependent protease subunit HslV; Provisional
Probab=98.63  E-value=2.4e-08  Score=64.58  Aligned_cols=23  Identities=43%  Similarity=0.629  Sum_probs=21.6

Q ss_pred             CccEEEEEeCCeEEEeeeCCCCC
Q psy5099          28 GTTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        28 GTTivgi~~~~GVIlaaD~rat~   50 (50)
                      |||++||+|+||||||||+|+|.
T Consensus         1 gtTivgi~~~dgVvlaaD~r~s~   23 (172)
T PRK05456          1 GTTILAVRRNGKVAIAGDGQVTL   23 (172)
T ss_pred             CcEEEEEEECCEEEEEECCceEe
Confidence            79999999999999999999873


No 6  
>PTZ00488 Proteasome subunit beta type-5; Provisional
Probab=98.61  E-value=3.5e-08  Score=66.26  Aligned_cols=27  Identities=33%  Similarity=0.728  Sum_probs=25.0

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      -++++|+|+|||+++||||||+|+|.+
T Consensus        34 ~~~~~G~T~IgIk~kdgVvlAaD~r~~   60 (247)
T PTZ00488         34 IEFAHGTTTLAFKYGGGIIIAVDSKAT   60 (247)
T ss_pred             cccCCCceEEEEEeCCEEEEEEecCcc
Confidence            367899999999999999999999976


No 7  
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis.Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.48  E-value=1.3e-07  Score=60.36  Aligned_cols=23  Identities=43%  Similarity=0.814  Sum_probs=22.0

Q ss_pred             cCccEEEEEeCCeEEEeeeCCCC
Q psy5099          27 CGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        27 tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      ||+|+|||+++||||||+|+|.+
T Consensus         1 ~G~T~igi~~kdgVvlaad~r~~   23 (197)
T cd03760           1 TGTSVIAIKYKDGVIIAADTLGS   23 (197)
T ss_pred             CCceEEEEEeCCcEEEEEcCccc
Confidence            69999999999999999999976


No 8  
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.47  E-value=1.5e-07  Score=60.95  Aligned_cols=26  Identities=31%  Similarity=0.374  Sum_probs=23.4

Q ss_pred             cccCccEEEEEeCCeEEEeeeCCCCC
Q psy5099          25 HSCGTTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        25 ~~tGTTivgi~~~~GVIlaaD~rat~   50 (50)
                      +..|+|+|||+|+||||||+|+|.+.
T Consensus         5 ~~~G~Tvigik~~dgVvlaaD~r~~~   30 (212)
T cd03757           5 TDNGGTVLAIAGNDFAVIAGDTRLSE   30 (212)
T ss_pred             cCCCccEEEEEcCCEEEEEECCcccc
Confidence            35799999999999999999999873


No 9  
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones]
Probab=98.43  E-value=2.3e-07  Score=61.79  Aligned_cols=26  Identities=35%  Similarity=0.583  Sum_probs=23.5

Q ss_pred             cccCccEEEEEeCCeEEEeeeCCCCC
Q psy5099          25 HSCGTTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        25 ~~tGTTivgi~~~~GVIlaaD~rat~   50 (50)
                      ..+|||+|||+++||||||+|+|+|+
T Consensus        27 ~~~gtT~vgik~~dgVVlaadkr~t~   52 (236)
T COG0638          27 KRGGTTTVGIKGKDGVVLAADKRATS   52 (236)
T ss_pred             HcCCceEEEEEecCEEEEEEeccCCC
Confidence            45679999999999999999999874


No 10 
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.43  E-value=2.3e-07  Score=59.24  Aligned_cols=23  Identities=26%  Similarity=0.329  Sum_probs=21.8

Q ss_pred             cCccEEEEEeCCeEEEeeeCCCC
Q psy5099          27 CGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        27 tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      .|+|++||+++||||||+|+|.+
T Consensus         2 ~G~t~igik~~dgVvlaad~~~~   24 (195)
T cd03759           2 NGGAVVAMAGKDCVAIASDLRLG   24 (195)
T ss_pred             CCceEEEEEcCCEEEEEEccccc
Confidence            69999999999999999999976


No 11 
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.43  E-value=1.9e-07  Score=60.18  Aligned_cols=27  Identities=26%  Similarity=0.447  Sum_probs=24.7

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      ..+++|+|+||++|+||||||+|+|.+
T Consensus        22 ~a~~~G~t~igik~~dgVvlaad~r~~   48 (213)
T cd03753          22 EAIKLGSTAIGIKTKEGVVLAVEKRIT   48 (213)
T ss_pred             HHHhcCCCEEEEEeCCEEEEEEecccC
Confidence            356899999999999999999999985


No 12 
>cd01911 proteasome_alpha proteasome alpha subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 different alpha and 10 different beta proteasome subunit genes while archaea have one of each.
Probab=98.40  E-value=2.3e-07  Score=59.56  Aligned_cols=27  Identities=19%  Similarity=0.394  Sum_probs=24.6

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      ..+.+|+|+||++|+||||||+|+|.+
T Consensus        22 ~~~~~G~tvigi~~~dgVvlaaD~~~~   48 (209)
T cd01911          22 EAVKNGSTAVGIKGKDGVVLAVEKKVT   48 (209)
T ss_pred             HHHHcCCCEEEEEECCEEEEEEEecCC
Confidence            356899999999999999999999976


No 13 
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit. The ATP-dependent protease HslVU, a complex of hexameric HslU active as a protein-unfolding ATPase and dodecameric HslV, the catalytic threonine protease.
Probab=98.39  E-value=2.3e-07  Score=60.53  Aligned_cols=22  Identities=45%  Similarity=0.608  Sum_probs=20.7

Q ss_pred             ccEEEEEeCCeEEEeeeCCCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~rat~   50 (50)
                      |||+||+|+||||||+|+|+|.
T Consensus         1 tTivgi~~~dgVvlaaD~r~s~   22 (171)
T TIGR03692         1 TTILAVRRNGKVVIAGDGQVTL   22 (171)
T ss_pred             CeEEEEEECCEEEEEECCceEe
Confidence            7999999999999999999873


No 14 
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit. This protein family describes the archaeal proteasome alpha subunit, homologous to both the beta subunit and to the alpha and beta subunits of eukaryotic proteasome subunits. This family is universal in the first 29 complete archaeal genomes but occasionally is duplicated.
Probab=98.39  E-value=2.7e-07  Score=59.82  Aligned_cols=27  Identities=30%  Similarity=0.478  Sum_probs=24.6

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      ..+.+|+|+|||+++||||||+|+|.+
T Consensus        24 ~av~~G~tvigi~~~dgvvlaad~r~~   50 (224)
T TIGR03633        24 EAVKRGTTAVGIKTKDGVVLAVDKRIT   50 (224)
T ss_pred             HHHHcCCCEEEEEECCEEEEEEeccCC
Confidence            357899999999999999999999975


No 15 
>PF00227 Proteasome:  Proteasome subunit;  InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins. They include the proteasome in Eukaryotes, Archaea, and Actinomycetales and the HslVU (ClpQY, clpXP) complex in other eubacteria. Genes homologous to eubacterial HslV (ClpQ) and HslU (ClpY, clpX) have also been demonstrated in to be present in the genome of trypanosomatid protozoa []. The proteasome (or macropain) (3.4.25.1 from EC) [, , , , ] is a eukaryotic and archaeal multicatalytic proteinase complex that seems to be involved in an ATP/ubiquitin-dependent nonlysosomal proteolytic pathway. In eukaryotes the proteasome is composed of about 28 distinct subunits which form a highly ordered ring-shaped structure (20S ring) of about 700 kDa. Most proteasome subunits can be classified, on the basis on sequence similarities into two groups, alpha (A) and beta (B). The prokaryotic ATP-dependent proteasome is coded for by the heat-shock locus VU (HslVU). It consists of HslV, the protease (MEROPS peptidase subfamily T1B), and HslU, IPR004491 from INTERPRO, the ATPase and chaperone belonging to the AAA/Clp/Hsp100 family. The crystal structure of Thermotoga maritima HslV has been determined to 2.1-A resolution. The structure of the dodecameric enzyme is well conserved compared to those from Escherichia coli and Haemophilus influenzae [, ]. This entry contains threonine peptidases and non-peptidase homologs belong to MEROPS peptidase family T1 (proteasome family, clan PB(T)). The family consists of the protease components of the archaeal and bacterial proteasomes and the alpha and beta subunits of the eukaryotic proteasome. ; GO: 0004298 threonine-type endopeptidase activity, 0051603 proteolysis involved in cellular protein catabolic process, 0005839 proteasome core complex; PDB: 3KRD_1 3H6F_M 2FHH_F 3HF9_F 2FHG_D 3HFA_B 3H6I_K 3MI0_A 3MFE_1 3MKA_F ....
Probab=98.38  E-value=1.5e-07  Score=58.18  Aligned_cols=25  Identities=40%  Similarity=0.589  Sum_probs=22.8

Q ss_pred             cccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          25 HSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        25 ~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      +.+|+|+|||+++||||||+|+|.+
T Consensus         1 v~~G~t~vgi~~~dgvvla~d~~~~   25 (190)
T PF00227_consen    1 VNNGTTVVGIKGKDGVVLAADKRIS   25 (190)
T ss_dssp             HHTSBEEEEEEESSEEEEEEEEEEE
T ss_pred             CCCCeEEEEEEECCEEEEEEccccc
Confidence            4689999999999999999999865


No 16 
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome. HslV is a dimer of hexamers (a dodecamer) that forms a central proteolytic chamber with active sites on the interior walls of the cavity. HslV shares significant sequence and structural similarity with the proteasomal beta-subunit and both are members of the Ntn-family of hydrolases.  HslV has a nucleophilic threonine residue at its N-terminus that is exposed after processing of the propeptide and is directly involved in active site catalysis.
Probab=98.37  E-value=2.7e-07  Score=60.27  Aligned_cols=22  Identities=45%  Similarity=0.607  Sum_probs=20.6

Q ss_pred             ccEEEEEeCCeEEEeeeCCCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~rat~   50 (50)
                      |||+||+|+||||||+|+|+|.
T Consensus         1 tTivgi~~~dgVvlaaD~r~t~   22 (171)
T cd01913           1 TTILAVRKNGKVVIAGDGQVTL   22 (171)
T ss_pred             CeEEEEEECCEEEEEECCceEe
Confidence            7999999999999999999873


No 17 
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.36  E-value=3.2e-07  Score=59.89  Aligned_cols=27  Identities=22%  Similarity=0.442  Sum_probs=24.7

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      ..+++|+|+|||+++||||||+|+|.+
T Consensus        22 ~av~~G~t~igik~~dgVvlaad~~~~   48 (227)
T cd03750          22 AAVSSGAPSVGIKAANGVVLATEKKVP   48 (227)
T ss_pred             HHHHcCCCEEEEEeCCEEEEEEeecCC
Confidence            456899999999999999999999976


No 18 
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.33  E-value=4.2e-07  Score=58.52  Aligned_cols=27  Identities=30%  Similarity=0.480  Sum_probs=24.6

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      ..+++|+|+||++++||||||+|+|.+
T Consensus        23 ~av~~G~t~igik~~dgvvla~d~~~~   49 (211)
T cd03756          23 EAVKRGTTALGIKCKEGVVLAVDKRIT   49 (211)
T ss_pred             HHHHcCCCEEEEEECCEEEEEEeccCC
Confidence            457899999999999999999999975


No 19 
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit. This protein family describes the archaeal proteasome beta subunit, homologous to both the alpha subunit and to the alpha and beta subunits of eukaryotic proteasome subunits. This family is universal in the first 29 complete archaeal genomes but occasionally is duplicated.
Probab=98.31  E-value=6.4e-07  Score=56.14  Aligned_cols=22  Identities=45%  Similarity=0.767  Sum_probs=21.0

Q ss_pred             CccEEEEEeCCeEEEeeeCCCC
Q psy5099          28 GTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        28 GTTivgi~~~~GVIlaaD~rat   49 (50)
                      |||++||+++||||||+|+|.+
T Consensus         1 G~t~igi~~~dgVvla~d~~~~   22 (185)
T TIGR03634         1 GTTTVGIKCKDGVVLAADKRAS   22 (185)
T ss_pred             CCcEEEEEeCCEEEEEEcCccc
Confidence            8999999999999999999976


No 20 
>PRK03996 proteasome subunit alpha; Provisional
Probab=98.29  E-value=5.4e-07  Score=59.12  Aligned_cols=27  Identities=33%  Similarity=0.481  Sum_probs=24.6

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      ..+.+|+|+|||+++||||||+|+|.+
T Consensus        31 ~av~~G~t~igik~~dgVvlaad~r~~   57 (241)
T PRK03996         31 EAVKRGTTAVGVKTKDGVVLAVDKRIT   57 (241)
T ss_pred             HHHHhCCCEEEEEeCCEEEEEEeccCC
Confidence            347899999999999999999999976


No 21 
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type. Members of this family are the beta subunit of the 20S proteasome as found in Actinobacteria such as Mycobacterium, Rhodococcus, and Streptomyces. In Streptomyces, maturation during proteasome assembly was shown to remove a 53-amino acid propeptide. Most of the length of the propeptide is not included in this model.
Probab=98.28  E-value=8e-07  Score=57.96  Aligned_cols=23  Identities=43%  Similarity=0.863  Sum_probs=21.7

Q ss_pred             cCccEEEEEeCCeEEEeeeCCCC
Q psy5099          27 CGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        27 tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      +|+|+|||+++||||||+|+|.+
T Consensus         1 ~G~T~igi~~kdgVvlaad~r~~   23 (219)
T TIGR03690         1 HGTTIVALTYPGGVLMAGDRRAT   23 (219)
T ss_pred             CCcEEEEEEECCEEEEEECCccc
Confidence            48999999999999999999987


No 22 
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.28  E-value=6.6e-07  Score=57.78  Aligned_cols=27  Identities=19%  Similarity=0.320  Sum_probs=24.6

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      +.+.+|+|+|||+++||||||+|+|.+
T Consensus        24 ~a~~~G~t~igi~~~dgVvla~d~r~~   50 (213)
T cd03752          24 EAISHAGTCLGILAKDGIVLAAEKKVT   50 (213)
T ss_pred             HHHhcCCCEEEEEeCCEEEEEEEeccC
Confidence            356899999999999999999999976


No 23 
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.23  E-value=1e-06  Score=56.69  Aligned_cols=27  Identities=30%  Similarity=0.362  Sum_probs=24.3

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      +.+.+|+|+|||+++||||||+|+|.+
T Consensus        22 ~av~~G~t~Igik~~dgVvlaad~~~~   48 (207)
T cd03755          22 EAVRKGTTAVGVRGKDCVVLGVEKKSV   48 (207)
T ss_pred             HHHHcCCCEEEEEeCCEEEEEEecCCC
Confidence            457899999999999999999999864


No 24 
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.23  E-value=8.9e-07  Score=57.74  Aligned_cols=27  Identities=19%  Similarity=0.277  Sum_probs=24.3

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      ..+..|+|+|||+++||||||+|+|.+
T Consensus        25 ~a~~~G~tvIgik~kdgVvla~d~r~~   51 (212)
T cd03751          25 KAVENSGTAIGIRCKDGVVLAVEKLVT   51 (212)
T ss_pred             HHHhcCCCEEEEEeCCEEEEEEEcccc
Confidence            346889999999999999999999976


No 25 
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.21  E-value=1.2e-06  Score=56.76  Aligned_cols=27  Identities=15%  Similarity=0.175  Sum_probs=24.3

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      ..+..|+|+|||+++||||||+|+|.+
T Consensus        22 ~av~~G~t~IgIk~~dgVvlaad~r~~   48 (211)
T cd03749          22 EAVKQGSATVGLKSKTHAVLVALKRAT   48 (211)
T ss_pred             HHHhcCCCEEEEEeCCEEEEEEeccCc
Confidence            346789999999999999999999975


No 26 
>PTZ00246 proteasome subunit alpha; Provisional
Probab=98.20  E-value=1.2e-06  Score=57.99  Aligned_cols=27  Identities=22%  Similarity=0.373  Sum_probs=24.4

Q ss_pred             ccccCccEEEEEeCCeEEEeeeCCCCC
Q psy5099          24 KHSCGTTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        24 ~~~tGTTivgi~~~~GVIlaaD~rat~   50 (50)
                      .+..|+|+|||+++||||||+|+|.+.
T Consensus        27 av~~g~t~Igik~~dgVvlaad~r~s~   53 (253)
T PTZ00246         27 AINNASLTVGILCKEGVILGADKPISS   53 (253)
T ss_pred             HHHhCCCEEEEEECCEEEEEEecCCCC
Confidence            467899999999999999999999863


No 27 
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.19  E-value=1.6e-06  Score=54.57  Aligned_cols=22  Identities=86%  Similarity=1.238  Sum_probs=20.3

Q ss_pred             ccEEEEEeCCeEEEeeeCCCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~rat~   50 (50)
                      ||++||+|+||||||+|+|.++
T Consensus         1 ~t~igi~~~dgVvla~D~r~~~   22 (188)
T cd03762           1 TTIIAVEYDGGVVLGADSRTST   22 (188)
T ss_pred             CeEEEEEECCeEEEEEcccccC
Confidence            6999999999999999999863


No 28 
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.17  E-value=1.9e-06  Score=54.73  Aligned_cols=22  Identities=45%  Similarity=0.804  Sum_probs=20.4

Q ss_pred             ccEEEEEeCCeEEEeeeCCCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~rat~   50 (50)
                      ||++||+++||||||+|+|.+.
T Consensus         1 tT~igi~~kdgVvla~d~r~~~   22 (188)
T cd03761           1 TTTLAFIFQGGVIVAVDSRATA   22 (188)
T ss_pred             CcEEEEEECCEEEEEEcCCccC
Confidence            6999999999999999999863


No 29 
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.16  E-value=2.1e-06  Score=54.39  Aligned_cols=22  Identities=55%  Similarity=0.913  Sum_probs=20.3

Q ss_pred             ccEEEEEeCCeEEEeeeCCCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~rat~   50 (50)
                      ||++||+++||||||+|+|.+.
T Consensus         1 tt~igi~~~dgvvlaad~r~~~   22 (189)
T cd03763           1 TTIVGVVFKDGVVLGADTRATE   22 (189)
T ss_pred             CeEEEEEECCeEEEEEcCCccc
Confidence            7999999999999999999763


No 30 
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis.Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.12  E-value=2.5e-06  Score=54.51  Aligned_cols=21  Identities=24%  Similarity=0.392  Sum_probs=20.1

Q ss_pred             ccEEEEEeCCeEEEeeeCCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~rat   49 (50)
                      ||+||++++||||||+|+|.|
T Consensus         2 ~t~igi~~~dgVvlaad~r~~   22 (193)
T cd03758           2 ETLIGIKGKDFVILAADTSAA   22 (193)
T ss_pred             ceEEEEEeCCEEEEEEcCccc
Confidence            799999999999999999986


No 31 
>cd01906 proteasome_protease_HslV proteasome_protease_HslV. This group contains the eukaryotic proteosome alpha and beta subunits and the prokaryotic protease hslV subunit. Proteasomes are large multimeric self-compartmentalizing proteases, involved in the clearance of misfolded proteins, the breakdown of regulatory proteins, and the processing of proteins such as the preparation of peptides for immune presentation. Two main proteasomal types are distinguished by their different tertiary structures: the eukaryotic/archeal 20S proteasome and the prokaryotic proteasome-like heat shock protein encoded by heat shock locus V, hslV.  The proteasome core particle is a highly conserved cylindrical structure made up of non-identical subunits that have their active sites on the inner walls of a large central cavity. The proteasome subunits of bacteria, archaea, and eukaryotes all share a conserved Ntn (N terminal nucleophile) hydrolase fold and a catalytic mechanism involving an N-terminal nucleo
Probab=98.11  E-value=3.2e-06  Score=51.95  Aligned_cols=21  Identities=43%  Similarity=0.658  Sum_probs=19.8

Q ss_pred             ccEEEEEeCCeEEEeeeCCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~rat   49 (50)
                      ||+|||+++||||||+|+|.+
T Consensus         1 tt~igi~~~dgvvla~d~~~~   21 (182)
T cd01906           1 TTIVGIKGKDGVVLAADKRVT   21 (182)
T ss_pred             CcEEEEEeCCEEEEEEecccC
Confidence            689999999999999999976


No 32 
>cd01912 proteasome_beta proteasome beta subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.08  E-value=3.9e-06  Score=52.35  Aligned_cols=21  Identities=48%  Similarity=0.724  Sum_probs=19.9

Q ss_pred             ccEEEEEeCCeEEEeeeCCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~rat   49 (50)
                      ||+||++++||||||+|+|.+
T Consensus         1 tt~i~i~~~dgVvla~d~~~~   21 (189)
T cd01912           1 TTIVGIKGKDGVVLAADTRAS   21 (189)
T ss_pred             CcEEEEEeCCEEEEEEcCCcc
Confidence            699999999999999999976


No 33 
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme for non-lysosomal protein degradation in both the cytosol and the nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are both members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=98.07  E-value=4e-06  Score=52.78  Aligned_cols=22  Identities=41%  Similarity=0.611  Sum_probs=20.3

Q ss_pred             ccEEEEEeCCeEEEeeeCCCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~rat~   50 (50)
                      ||++||+|+||||||+|+|.++
T Consensus         1 tt~iai~~~dgvvia~d~r~~~   22 (188)
T cd03764           1 TTTVGIVCKDGVVLAADKRASM   22 (188)
T ss_pred             CcEEEEEeCCEEEEEEcccccc
Confidence            6999999999999999999763


No 34 
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=97.95  E-value=9.7e-06  Score=52.74  Aligned_cols=23  Identities=22%  Similarity=0.237  Sum_probs=21.7

Q ss_pred             cCccEEEEEeCCeEEEeeeCCCC
Q psy5099          27 CGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        27 tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      .|+|++||+++||||||+|+|.+
T Consensus        28 ~g~t~igi~~~d~Vvlaad~r~~   50 (215)
T cd03754          28 AGLTSVAVRGKDCAVVVTQKKVP   50 (215)
T ss_pred             CCccEEEEEeCCEEEEEEecccc
Confidence            69999999999999999999975


No 35 
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type. Members of this family are the alpha subunit of the 20S proteasome as found in Actinobacteria such as Mycobacterium, Rhodococcus, and Streptomyces. In most Actinobacteria (an exception is Propionibacterium acnes), the proteasome is accompanied by a system of tagging proteins for degradation with Pup.
Probab=97.74  E-value=2.3e-05  Score=52.18  Aligned_cols=25  Identities=12%  Similarity=0.405  Sum_probs=22.4

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSR   47 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~r   47 (50)
                      ..++.|+|+|||+++||||||+|++
T Consensus        22 kav~~g~T~VGIk~kdgVVLaaek~   46 (228)
T TIGR03691        22 KGIARGRSVVVLTYADGILFVAENP   46 (228)
T ss_pred             HHHHcCCcEEEEEeCCeEEEEEecC
Confidence            3467899999999999999999986


No 36 
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit. The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis. Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each.
Probab=97.51  E-value=0.0001  Score=49.66  Aligned_cols=21  Identities=33%  Similarity=0.678  Sum_probs=19.0

Q ss_pred             ccEEEEEeCCeEEEeeeCCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~rat   49 (50)
                      |=+|||+++||||||||+|++
T Consensus         1 ~~~vGIk~kdGVVLaadkr~~   21 (236)
T cd03765           1 TYCLGIKLDAGLVFASDSRTN   21 (236)
T ss_pred             CeEEEEEeCCeEEEEEccCcc
Confidence            457999999999999999976


No 37 
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid.  N-terminal nucleophile (NTN-) hydrolase superfamily, which contains a four-layered alpha, beta, beta, alpha core structure. This family of hydrolases includes penicillin acylase, the 20S proteasome alpha and beta subunits, and glutamate synthase. The mechanism of activation of these proteins is conserved, although they differ in their substrate specificities. All known members catalyze the hydrolysis of amide bonds in either proteins or small molecules, and each one of them is synthesized as a preprotein. For each, an autocatalytic endoproteolytic process generates a new N-terminal residue. This mature N-terminal residue is central to catalysis and acts as both a polarizing base and a nucleophile during the reaction. The N-terminal amino group acts as the proton acceptor and activates either t
Probab=97.44  E-value=0.00018  Score=41.71  Aligned_cols=21  Identities=48%  Similarity=0.676  Sum_probs=19.5

Q ss_pred             ccEEEEEeCCeEEEeeeCCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~rat   49 (50)
                      +|++|++++||||||+|++.+
T Consensus         1 ~t~i~i~~~~gvila~d~~~~   21 (164)
T cd01901           1 STSVAIKGKGGVVLAADKRLS   21 (164)
T ss_pred             CcEEEEEeCCEEEEEEecccC
Confidence            689999999999999999875


No 38 
>KOG0176|consensus
Probab=96.39  E-value=0.0031  Score=43.84  Aligned_cols=27  Identities=30%  Similarity=0.469  Sum_probs=24.8

Q ss_pred             ccccCccEEEEEeCCeEEEeeeCCCCC
Q psy5099          24 KHSCGTTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        24 ~~~tGTTivgi~~~~GVIlaaD~rat~   50 (50)
                      .++.|+|.+||+.++|||||.+.|.|+
T Consensus        30 AikLGsTaIGv~TkEgVvL~vEKritS   56 (241)
T KOG0176|consen   30 AIKLGSTAIGVKTKEGVVLAVEKRITS   56 (241)
T ss_pred             HHhcCCceeeeeccceEEEEEeccccC
Confidence            468999999999999999999999874


No 39 
>KOG0184|consensus
Probab=96.13  E-value=0.0043  Score=43.49  Aligned_cols=27  Identities=19%  Similarity=0.273  Sum_probs=23.0

Q ss_pred             cccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          23 AKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        23 ~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      ..+-.+.|.|||+++|||||++|...+
T Consensus        29 KAven~~T~IGIk~kdGVVl~vEKli~   55 (254)
T KOG0184|consen   29 KAVENSGTCIGIKCKDGVVLAVEKLIT   55 (254)
T ss_pred             HHHhcCCcEEEEecCCeEEEEEeeeec
Confidence            345678999999999999999998654


No 40 
>KOG0178|consensus
Probab=92.63  E-value=0.11  Score=36.52  Aligned_cols=26  Identities=23%  Similarity=0.337  Sum_probs=23.3

Q ss_pred             ccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          24 KHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        24 ~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      .+++-.|.+|+..+|||||+++.+.+
T Consensus        27 ais~aGt~iGila~DGvvLa~e~k~t   52 (249)
T KOG0178|consen   27 AISHAGTCIGILASDGVVLAGENKVT   52 (249)
T ss_pred             HHhhhcceeEEEecCceEEEeecccc
Confidence            46888899999999999999998865


No 41 
>KOG0179|consensus
Probab=90.69  E-value=0.26  Score=34.43  Aligned_cols=25  Identities=28%  Similarity=0.373  Sum_probs=22.4

Q ss_pred             ccCccEEEEEeCCeEEEeeeCCCCC
Q psy5099          26 SCGTTIIAVEFDGGVVIGADSRSST   50 (50)
Q Consensus        26 ~tGTTivgi~~~~GVIlaaD~rat~   50 (50)
                      ..|-|+|||.-.|=.|+|+|+|.|.
T Consensus        27 ~NGGT~vaIaG~dFavvA~DTR~s~   51 (235)
T KOG0179|consen   27 DNGGTTVAIAGEDFAVVAGDTRMSS   51 (235)
T ss_pred             cCCceEEEEcCCceEEEeccccccc
Confidence            4688999999999999999999763


No 42 
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones]
Probab=89.87  E-value=0.26  Score=33.20  Aligned_cols=23  Identities=43%  Similarity=0.534  Sum_probs=21.2

Q ss_pred             cCccEEEEEeCCeEEEeeeCCCC
Q psy5099          27 CGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        27 tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      ++|||++++-++=|+||+|...|
T Consensus         3 h~TTiv~vr~~gkv~iagDGQVt   25 (178)
T COG5405           3 HMTTIVAVRKNGKVVIAGDGQVT   25 (178)
T ss_pred             eeEEEEEEeeCCeEEEecCceEe
Confidence            68999999999999999998765


No 43 
>KOG0181|consensus
Probab=85.76  E-value=0.83  Score=31.86  Aligned_cols=24  Identities=21%  Similarity=0.426  Sum_probs=21.5

Q ss_pred             ccccCccEEEEEeCCeEEEeeeCC
Q psy5099          24 KHSCGTTIIAVEFDGGVVIGADSR   47 (50)
Q Consensus        24 ~~~tGTTivgi~~~~GVIlaaD~r   47 (50)
                      .++.|.+-+|++..||||||++..
T Consensus        28 Av~~G~~SvGi~A~nGvVlatekk   51 (233)
T KOG0181|consen   28 AVVNGQTSVGIKAANGVVLATEKK   51 (233)
T ss_pred             HHhCCCCceeeeecCceEEEeccC
Confidence            467899999999999999999874


No 44 
>KOG0177|consensus
Probab=81.11  E-value=1.4  Score=30.20  Aligned_cols=19  Identities=16%  Similarity=0.350  Sum_probs=17.4

Q ss_pred             cEEEEEeCCeEEEeeeCCC
Q psy5099          30 TIIAVEFDGGVVIGADSRS   48 (50)
Q Consensus        30 Tivgi~~~~GVIlaaD~ra   48 (50)
                      +++||+-+|=||+|+|+-+
T Consensus         3 ~llGIkg~dfvilAsDt~~   21 (200)
T KOG0177|consen    3 TLLGIKGPDFVILASDTSA   21 (200)
T ss_pred             eEEEeecCCEEEEeecchh
Confidence            7899999999999999864


No 45 
>KOG0180|consensus
Probab=79.59  E-value=2.2  Score=29.34  Aligned_cols=23  Identities=26%  Similarity=0.313  Sum_probs=20.8

Q ss_pred             ccCccEEEEEeCCeEEEeeeCCC
Q psy5099          26 SCGTTIIAVEFDGGVVIGADSRS   48 (50)
Q Consensus        26 ~tGTTivgi~~~~GVIlaaD~ra   48 (50)
                      -.|-+++|++-+++|-||+|.|-
T Consensus         6 ynGg~vvAM~gk~cvaIa~D~Rl   28 (204)
T KOG0180|consen    6 YNGGSVVAMAGKNCVAIASDLRL   28 (204)
T ss_pred             ecCceEEEEeCCceEEEEecccc
Confidence            35889999999999999999984


No 46 
>KOG0183|consensus
Probab=68.39  E-value=4.2  Score=28.72  Aligned_cols=28  Identities=25%  Similarity=0.361  Sum_probs=24.0

Q ss_pred             ccccccCccEEEEEeCCeEEEeeeCCCC
Q psy5099          22 TAKHSCGTTIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        22 ~~~~~tGTTivgi~~~~GVIlaaD~rat   49 (50)
                      +..+..|+|.||+.-++.|+||.+.+..
T Consensus        24 qEAvrkGstaVgvrg~~~vvlgvEkkSv   51 (249)
T KOG0183|consen   24 QEAVRKGSTAVGVRGNNCVVLGVEKKSV   51 (249)
T ss_pred             HHHHhcCceEEEeccCceEEEEEeecch
Confidence            3457889999999999999999998753


No 47 
>PF09894 DUF2121:  Uncharacterized protein conserved in archaea (DUF2121);  InterPro: IPR016754 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function. They do show distant similarity to NTPases and to nucleic acid binding enzymes.
Probab=66.06  E-value=5.1  Score=27.29  Aligned_cols=19  Identities=42%  Similarity=0.466  Sum_probs=16.8

Q ss_pred             cEEEEEeCCeEEEeeeCCC
Q psy5099          30 TIIAVEFDGGVVIGADSRS   48 (50)
Q Consensus        30 Tivgi~~~~GVIlaaD~ra   48 (50)
                      =|+|..-++|.|||.|.|.
T Consensus         3 LII~y~GknGaViaGDkR~   21 (194)
T PF09894_consen    3 LIIAYYGKNGAVIAGDKRN   21 (194)
T ss_pred             EEEEEecCCCcEEecccee
Confidence            3789999999999999984


No 48 
>COG3484 Predicted proteasome-type protease [Posttranslational modification, protein turnover, chaperones]
Probab=57.01  E-value=12  Score=26.38  Aligned_cols=20  Identities=35%  Similarity=0.596  Sum_probs=17.6

Q ss_pred             cEEEEEeCCeEEEeeeCCCC
Q psy5099          30 TIIAVEFDGGVVIGADSRSS   49 (50)
Q Consensus        30 Tivgi~~~~GVIlaaD~rat   49 (50)
                      =-||++.+.|.|+++|+|+.
T Consensus         3 YCv~l~l~~GlVf~sDsRTN   22 (255)
T COG3484           3 YCVGLILDFGLVFGSDSRTN   22 (255)
T ss_pred             eEEEEEeccceEEecccccc
Confidence            35899999999999999974


No 49 
>cd01586 AcnA_IRP Aconitase A catalytic domain. Aconitase A catalytic domain. This is the major form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydrolyase. It includes bacterial and archaeal aconitase A, and the eukaryotic cytosolic form of aconitase. This group also includes sequences that have been shown to act as an iron-responsive element (IRE) binding protein in animals and may have the same role in other eukaryotes.
Probab=56.84  E-value=9.5  Score=28.33  Aligned_cols=17  Identities=29%  Similarity=0.608  Sum_probs=13.0

Q ss_pred             EEEeCCeEEEeeeCCCCC
Q psy5099          33 AVEFDGGVVIGADSRSST   50 (50)
Q Consensus        33 gi~~~~GVIlaaD~rat~   50 (50)
                      |+.+. ++|+++||.+++
T Consensus       117 g~~~P-~~ivg~DSHT~t  133 (404)
T cd01586         117 GVAYP-DSVVGTDSHTTM  133 (404)
T ss_pred             ceEee-eeEeecCCCCcc
Confidence            45666 699999998763


No 50 
>PLN00070 aconitate hydratase
Probab=31.43  E-value=27  Score=28.63  Aligned_cols=17  Identities=24%  Similarity=0.548  Sum_probs=12.9

Q ss_pred             EEEeCCeEEEeeeCCCCC
Q psy5099          33 AVEFDGGVVIGADSRSST   50 (50)
Q Consensus        33 gi~~~~GVIlaaD~rat~   50 (50)
                      |+.|.| .|+|+||.+++
T Consensus       236 G~~~Pd-tlVGtDSHT~~  252 (936)
T PLN00070        236 GILYPD-SVVGTDSHTTM  252 (936)
T ss_pred             CcccCC-eEEeCCcccCC
Confidence            456664 59999998874


No 51 
>COG4079 Uncharacterized protein conserved in archaea [Function unknown]
Probab=31.11  E-value=39  Score=24.40  Aligned_cols=20  Identities=40%  Similarity=0.453  Sum_probs=16.8

Q ss_pred             ccEEEEEeCCeEEEeeeCCC
Q psy5099          29 TTIIAVEFDGGVVIGADSRS   48 (50)
Q Consensus        29 TTivgi~~~~GVIlaaD~ra   48 (50)
                      |-|++..-++|.+||.|.|.
T Consensus         2 tLviay~gknGaviaGDrR~   21 (293)
T COG4079           2 TLVIAYIGKNGAVIAGDRRE   21 (293)
T ss_pred             eEEEEEecCCCcEEeccceE
Confidence            34788888999999999984


No 52 
>TIGR01341 aconitase_1 aconitate hydratase 1. This model represents one form of the TCA cycle enzyme aconitate hydratase, also known as aconitase and citrate hydro-lyase. It is found in bacteria, archaea, and eukaryotic cytosol. It has been shown to act also as an iron-responsive element binding protein in animals and may have the same role in other eukaryotes.
Probab=30.78  E-value=28  Score=28.33  Aligned_cols=17  Identities=18%  Similarity=0.477  Sum_probs=13.0

Q ss_pred             EEEeCCeEEEeeeCCCCC
Q psy5099          33 AVEFDGGVVIGADSRSST   50 (50)
Q Consensus        33 gi~~~~GVIlaaD~rat~   50 (50)
                      ++.|.| +|+|+||.+++
T Consensus       184 g~a~Pd-tlVGtDSHT~t  200 (876)
T TIGR01341       184 LTAYPD-SLVGTDSHTTM  200 (876)
T ss_pred             ceeccc-eeeecCCCCCC
Confidence            356664 89999998874


No 53 
>COG1445 FrwB Phosphotransferase system fructose-specific component IIB [Carbohydrate transport and metabolism]
Probab=30.18  E-value=33  Score=21.85  Aligned_cols=14  Identities=21%  Similarity=0.306  Sum_probs=10.9

Q ss_pred             EEeCCeEEEeeeCC
Q psy5099          34 VEFDGGVVIGADSR   47 (50)
Q Consensus        34 i~~~~GVIlaaD~r   47 (50)
                      |.-.|+||||+|..
T Consensus        54 I~~Ad~VI~AaD~~   67 (122)
T COG1445          54 IAAADVVILAADIE   67 (122)
T ss_pred             HHhCCEEEEEeccc
Confidence            34569999999964


No 54 
>KOG3333|consensus
Probab=28.69  E-value=46  Score=22.63  Aligned_cols=21  Identities=29%  Similarity=0.469  Sum_probs=15.2

Q ss_pred             cCccEEE--EEeCCeEEEeeeCC
Q psy5099          27 CGTTIIA--VEFDGGVVIGADSR   47 (50)
Q Consensus        27 tGTTivg--i~~~~GVIlaaD~r   47 (50)
                      ++--+-|  ..|+|||||.|-++
T Consensus        68 ~~~hveg~v~H~~~gvvvSAST~   90 (188)
T KOG3333|consen   68 TQHHVEGLVEHQNGGVVVSASTR   90 (188)
T ss_pred             cccceeeeeeEecCCEEEEeccc
Confidence            3434444  67999999998775


No 55 
>PRK14364 Maf-like protein; Provisional
Probab=26.28  E-value=37  Score=22.07  Aligned_cols=13  Identities=38%  Similarity=0.603  Sum_probs=10.4

Q ss_pred             EeCCeEEEeeeCC
Q psy5099          35 EFDGGVVIGADSR   47 (50)
Q Consensus        35 ~~~~GVIlaaD~r   47 (50)
                      ++.+.+||+||+-
T Consensus        54 ~~~~~~vI~aDTv   66 (181)
T PRK14364         54 IFPDSVIIAADTS   66 (181)
T ss_pred             hCCCCEEEEeCeE
Confidence            3578899999983


No 56 
>COG0490 Putative regulatory, ligand-binding protein related to C-terminal domains of K+ channels [Inorganic ion transport and metabolism]
Probab=24.72  E-value=70  Score=21.20  Aligned_cols=20  Identities=20%  Similarity=0.446  Sum_probs=15.4

Q ss_pred             ccccCccEEEEEeCCeEEEe
Q psy5099          24 KHSCGTTIIAVEFDGGVVIG   43 (50)
Q Consensus        24 ~~~tGTTivgi~~~~GVIla   43 (50)
                      ...||.|||||.=++=+|+.
T Consensus       109 rq~TGaTIIAI~r~~e~I~S  128 (162)
T COG0490         109 RQNTGATVIAIVRNEEKILS  128 (162)
T ss_pred             ccccCcEEEEEEecCcEecC
Confidence            35799999999876666654


No 57 
>PTZ00092 aconitate hydratase-like protein; Provisional
Probab=24.31  E-value=75  Score=26.11  Aligned_cols=17  Identities=24%  Similarity=0.522  Sum_probs=12.7

Q ss_pred             EEEeCCeEEEeeeCCCCC
Q psy5099          33 AVEFDGGVVIGADSRSST   50 (50)
Q Consensus        33 gi~~~~GVIlaaD~rat~   50 (50)
                      |+.|. +.|+|+||.+++
T Consensus       204 G~~~P-d~lvGtDSHT~~  220 (898)
T PTZ00092        204 GLLYP-DSVVGTDSHTTM  220 (898)
T ss_pred             CcccC-CeEEecCCCCCC
Confidence            35566 569999998874


No 58 
>PRK00148 Maf-like protein; Reviewed
Probab=21.72  E-value=54  Score=21.52  Aligned_cols=13  Identities=38%  Similarity=0.524  Sum_probs=10.5

Q ss_pred             EeCCeEEEeeeCC
Q psy5099          35 EFDGGVVIGADSR   47 (50)
Q Consensus        35 ~~~~GVIlaaD~r   47 (50)
                      ++.+.+||+||+-
T Consensus        58 ~~~~~~vI~aDTv   70 (194)
T PRK00148         58 NAPDAVVLGCDSM   70 (194)
T ss_pred             hCCCCEEEEeCcE
Confidence            3678899999983


No 59 
>TIGR02764 spore_ybaN_pdaB polysaccharide deacetylase family sporulation protein PdaB. This model describes the YbaN protein family, also called PdaB and SpoVIE, of Gram-positive bacteria. Although ybaN null mutants have only a mild sporulation defect, ybaN/ytrI double mutants show drastically reducted sporulation efficiencies. This synthetic defect suggests the role of this sigmaE-controlled gene in sporulation had been masked by functional redundancy. Members of this family are homologous to a characterized polysaccharide deacetylase; the exact function this protein family is unknown.
Probab=21.49  E-value=71  Score=19.74  Aligned_cols=14  Identities=29%  Similarity=0.264  Sum_probs=11.2

Q ss_pred             cCccEEEEEeCCeE
Q psy5099          27 CGTTIIAVEFDGGV   40 (50)
Q Consensus        27 tGTTivgi~~~~GV   40 (50)
                      +....|+++|+||-
T Consensus         3 ~~~k~V~LTFDDgp   16 (191)
T TIGR02764         3 TSDKKIALTFDISW   16 (191)
T ss_pred             CCCCEEEEEEECCC
Confidence            45578999999985


No 60 
>PF11697 DUF3293:  Protein of unknown function (DUF3293);  InterPro: IPR021710  This bacterial family of proteins has no known function. 
Probab=20.94  E-value=38  Score=18.93  Aligned_cols=12  Identities=8%  Similarity=-0.078  Sum_probs=10.2

Q ss_pred             hhhhhhhhhcCC
Q psy5099           4 KDYNVNAYHGGV   15 (50)
Q Consensus         4 ~n~~Rn~~l~~~   15 (50)
                      +|+.||+.|...
T Consensus        15 eN~~~~~~L~~~   26 (73)
T PF11697_consen   15 ENRRRNRQLRAE   26 (73)
T ss_pred             HHHHHHHHHHHH
Confidence            799999998755


No 61 
>COG0424 Maf Nucleotide-binding protein implicated in inhibition of septum formation [Cell division and chromosome partitioning]
Probab=20.40  E-value=57  Score=21.90  Aligned_cols=11  Identities=45%  Similarity=0.676  Sum_probs=9.5

Q ss_pred             CCeEEEeeeCC
Q psy5099          37 DGGVVIGADSR   47 (50)
Q Consensus        37 ~~GVIlaaD~r   47 (50)
                      +|.+||+||+-
T Consensus        63 ~~~~VigaDtv   73 (193)
T COG0424          63 PDALVIGADTV   73 (193)
T ss_pred             CCCEEEecCeE
Confidence            59999999973


Done!