BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy510
         (380 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3RJL|A Chain A, Crystal Structure Of 1-Pyrroline-5-Carboxylate
           Dehydrogenase From Bacillus Licheniformis (Target
           Nysgrc-000337)
 pdb|3RJL|B Chain B, Crystal Structure Of 1-Pyrroline-5-Carboxylate
           Dehydrogenase From Bacillus Licheniformis (Target
           Nysgrc-000337)
 pdb|3RJL|C Chain C, Crystal Structure Of 1-Pyrroline-5-Carboxylate
           Dehydrogenase From Bacillus Licheniformis (Target
           Nysgrc-000337)
 pdb|3RJL|D Chain D, Crystal Structure Of 1-Pyrroline-5-Carboxylate
           Dehydrogenase From Bacillus Licheniformis (Target
           Nysgrc-000337)
 pdb|3RJL|E Chain E, Crystal Structure Of 1-Pyrroline-5-Carboxylate
           Dehydrogenase From Bacillus Licheniformis (Target
           Nysgrc-000337)
 pdb|3RJL|F Chain F, Crystal Structure Of 1-Pyrroline-5-Carboxylate
           Dehydrogenase From Bacillus Licheniformis (Target
           Nysgrc-000337)
 pdb|3RJL|G Chain G, Crystal Structure Of 1-Pyrroline-5-Carboxylate
           Dehydrogenase From Bacillus Licheniformis (Target
           Nysgrc-000337)
 pdb|3RJL|H Chain H, Crystal Structure Of 1-Pyrroline-5-Carboxylate
           Dehydrogenase From Bacillus Licheniformis (Target
           Nysgrc-000337)
          Length = 538

 Score = 30.4 bits (67), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 23/42 (54%)

Query: 73  TDRREMSMGVTTRIEDLNTVIGETQDHRHRVLVAAAKNIKNW 114
           T+ + +S+    + E + TV   TQDH  + + AAAK  + W
Sbjct: 49  TENKIVSINPANKEEVVGTVSKATQDHAEKAIQAAAKAFETW 90


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.139    0.428 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 11,537,460
Number of Sequences: 62578
Number of extensions: 474963
Number of successful extensions: 1127
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 1126
Number of HSP's gapped (non-prelim): 1
length of query: 380
length of database: 14,973,337
effective HSP length: 101
effective length of query: 279
effective length of database: 8,652,959
effective search space: 2414175561
effective search space used: 2414175561
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 52 (24.6 bits)