Diaphorina citri psyllid: psy5109


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-----
MAPPLYGDLGKHARDLFSKGYNIDVIKIDLKTKTDSGVEFNSGGTAQLESGKIFGTLESKYKAKNYAGLTFSEKWNTDNVLTTEVSSNIIDGARLAANTSFAPQTGDKTVKLSGEYKNSLAAVNLESEFKSLNPVISAAGVLGYN
cccccccccccccccccccccccccEEEEEEEccccccEEEEEEECcccccCEEEEEEEEEEEcccccEEEEEEECccccCEEEEEEECcccccEEEEEEEccccccccEEEEccEEcccEEEEEEEcccccccEEEEEEEEECc
MAPPLYGDLGKHARDLFSKGYNIDVIKIDLKTKTDSGVEFNSGGTAQLESGKIFGTLESKYKAKNYAGLTFSEKWNTDNVLTTEVSSNIIDGARLAANTSFAPQTGDKTVKLSGEYKNSLAAVNLESEFKSLNPVISAAGVLGYN
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPPLYGDLGKHARDLFSKGYNIDVIKIDLKTKTDSGVEFNSGGTAQLESGKIFGTLESKYKAKNYAGLTFSEKWNTDNVLTTEVSSNIIDGARLAANTSFAPQTGDKTVKLSGEYKNSLAAVNLESEFKSLNPVISAAGVLGYN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Voltage-dependent anion-selective channel Forms a channel through the cell membrane that allows diffusion of small hydrophilic molecules.confidentQ94920

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016006 [CC]NebenkernprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005739, GO:0005622, GO:0005575, GO:0044444, GO:0005623, GO:0044424, GO:0043227, GO:0043226
GO:0006811 [BP]ion transportprobableGO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0008308 [MF]voltage-gated anion channel activityprobableGO:0022891, GO:0005244, GO:0005215, GO:0005216, GO:0015075, GO:0022832, GO:0022857, GO:0015267, GO:0003674, GO:0022838, GO:0022892, GO:0022803, GO:0022839, GO:0005253, GO:0008509, GO:0022836
GO:0005875 [CC]microtubule associated complexprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0005741 [CC]mitochondrial outer membraneprobableGO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0031968, GO:0031967, GO:0031966, GO:0043231, GO:0044464, GO:0019867, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044429, GO:0044424, GO:0044422
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EMN, chain X
Confidence level:very confident
Coverage over the Query: 1-145
View the alignment between query and template
View the model in PyMOL