Query         psy511
Match_columns 67
No_of_seqs    103 out of 325
Neff          6.5 
Searched_HMMs 46136
Date          Fri Aug 16 17:30:22 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy511.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/511hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2189|consensus              100.0 1.2E-29 2.5E-34  191.5   7.8   65    2-66    186-250 (829)
  2 PF01496 V_ATPase_I:  V-type AT  99.3 9.9E-13 2.1E-17   99.7   3.1   63    2-66    156-218 (759)
  3 PF08793 2C_adapt:  2-cysteine   87.8    0.61 1.3E-05   23.4   2.2   28   25-60      9-36  (37)
  4 COG1269 NtpI Archaeal/vacuolar  79.4     1.2 2.6E-05   34.4   1.6   55    8-66    164-218 (660)
  5 PF11430 EGL-1:  Programmed cel  74.8    0.83 1.8E-05   20.4  -0.2   16   49-64      2-17  (21)
  6 PF14202 TnpW:  Transposon-enco  68.7     6.6 0.00014   19.5   2.3   26   35-60      6-36  (37)
  7 PF09827 CRISPR_Cas2:  CRISPR a  58.4      19 0.00041   19.8   3.2   23   40-62      3-27  (78)
  8 TIGR01573 cas2 CRISPR-associat  46.0      31 0.00068   20.0   2.9   29   32-60     28-61  (95)
  9 PF04807 Gemini_AC4_5:  Geminiv  45.9      11 0.00024   18.5   0.8   14    2-15     17-30  (33)
 10 PF13443 HTH_26:  Cro/C1-type H  45.8      11 0.00024   19.6   0.8   15   51-65     40-54  (63)
 11 PRK05771 V-type ATP synthase s  43.1      37  0.0008   26.0   3.6   31   36-66    175-205 (646)
 12 PF10369 ALS_ss_C:  Small subun  42.2      25 0.00054   19.7   2.0   19   47-65     12-30  (75)
 13 PF13014 KH_3:  KH domain        37.3      25 0.00054   17.1   1.3   17   51-67     10-26  (43)
 14 PF04914 DltD_C:  DltD C-termin  34.1      44 0.00096   20.8   2.4   19   48-66     75-93  (130)
 15 PF09353 DUF1995:  Domain of un  31.1   1E+02  0.0022   20.1   3.8   25   39-63     99-123 (209)
 16 PF03937 Sdh5:  Flavinator of s  30.8      36 0.00078   19.0   1.4   12    4-15      2-14  (74)
 17 PF07401 Lenti_VIF_2:  Bovine L  29.2      29 0.00063   23.2   1.0   19    8-26    170-189 (198)
 18 PF07830 PP2C_C:  Protein serin  27.8      97  0.0021   17.9   2.9   22   39-60      1-38  (81)
 19 PF08142 AARP2CN:  AARP2CN (NUC  27.2      67  0.0015   18.4   2.2   25    3-27     13-37  (85)
 20 smart00785 AARP2CN AARP2CN (NU  26.9      71  0.0015   18.3   2.2   24    3-26     13-36  (83)
 21 PF04086 SRP-alpha_N:  Signal r  26.9      94   0.002   21.0   3.2   20   38-57     38-64  (279)
 22 cd00231 ZipA ZipA C-terminal d  26.7 1.6E+02  0.0036   18.2   4.6   62    5-66     39-111 (130)
 23 TIGR00789 flhB_rel flhB C-term  26.2 1.2E+02  0.0026   17.4   3.1   25   42-66     19-44  (82)
 24 PF04312 DUF460:  Protein of un  26.1      40 0.00087   21.5   1.2   19   49-67     87-105 (138)
 25 PF03479 DUF296:  Domain of unk  25.6      93   0.002   18.6   2.7   25   40-64      4-28  (120)
 26 COG4062 MtrB Tetrahydromethano  24.9      91   0.002   19.1   2.5   31   27-57     13-43  (108)
 27 PF12153 CAP18_C:  LPS binding   24.6      59  0.0013   15.4   1.3   13   47-59      8-20  (28)
 28 PF08889 WbqC:  WbqC-like prote  24.4      55  0.0012   21.9   1.6   22   46-67    138-159 (219)
 29 PF12844 HTH_19:  Helix-turn-he  23.7      57  0.0012   16.8   1.3   14   51-64     41-54  (64)
 30 smart00530 HTH_XRE Helix-turn-  23.7      68  0.0015   14.5   1.5   15   50-64     38-52  (56)
 31 PF00356 LacI:  Bacterial regul  23.6      82  0.0018   16.0   1.9   16   47-62     27-42  (46)
 32 cd02394 vigilin_like_KH K homo  22.9      72  0.0016   16.4   1.6   17   51-67     19-35  (62)
 33 cd02393 PNPase_KH Polynucleoti  22.8      67  0.0014   17.0   1.5   17   51-67     21-37  (61)
 34 COG2102 Predicted ATPases of P  22.4      95  0.0021   21.4   2.5   19   48-66     98-116 (223)
 35 PF00013 KH_1:  KH domain syndr  22.3      61  0.0013   16.5   1.3   17   51-67     19-35  (60)
 36 COG3655 Predicted transcriptio  22.3      64  0.0014   18.4   1.4   14   51-64     45-58  (73)
 37 TIGR02684 dnstrm_HI1420 probab  22.1      71  0.0015   18.5   1.6   15   51-65     72-86  (89)
 38 cd02979 PHOX_C FAD-dependent P  22.0   1E+02  0.0022   19.6   2.5   22   42-63     32-57  (167)
 39 COG2938 Uncharacterized conser  21.9      68  0.0015   19.2   1.5   12    3-14     14-25  (94)
 40 PF05184 SapB_1:  Saposin-like   21.5   1E+02  0.0022   14.3   1.9   14   48-61     25-38  (39)
 41 PF12682 Flavodoxin_4:  Flavodo  21.0 1.7E+02  0.0037   18.3   3.3   26   41-66      3-29  (156)
 42 PRK04017 hypothetical protein;  20.5      89  0.0019   19.7   1.9   20   46-65     77-96  (132)

No 1  
>KOG2189|consensus
Probab=99.96  E-value=1.2e-29  Score=191.48  Aligned_cols=65  Identities=62%  Similarity=1.128  Sum_probs=64.1

Q ss_pred             hhHHHHHHHhhCCcEEEEeeecCCcccCCCCCCceeeEEEEEEEecHHHHHHHHHhhhhcCCeee
Q psy511            2 PAFERMLWRACRGNVFLRQAEIETPLEDINSGDPVYKSVFIIFFQGDQLKTRVMKICEGKKLSSV   66 (67)
Q Consensus         2 ~~fer~lwR~~RGN~~~~~~~i~~~~~d~~~~~~~~k~vFiv~~~G~~l~~Ki~KIc~~f~a~~~   66 (67)
                      ++|||+|||+||||+|+++.++|+++.||+|||+++|+|||||||||++++||+||||||||++|
T Consensus       186 ~~fER~LWRa~Rgn~f~r~~~ie~~l~dp~Tge~~~K~vFivF~~Geql~~kIkKIcd~f~a~~y  250 (829)
T KOG2189|consen  186 FAFERMLWRACRGNLFIRQSDIEEPLEDPKTGEPVEKNVFIVFFQGEQLKQKIKKICDGFGATLY  250 (829)
T ss_pred             HHHHHHHHHHhccceEEEeecccccccCCccCCcceeEEEEEEeecHHHHHHHHHHHhccCcEee
Confidence            68999999999999999999999999999999999999999999999999999999999999998


No 2  
>PF01496 V_ATPase_I:  V-type ATPase 116kDa subunit family  ;  InterPro: IPR002490 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   The V-ATPases (or V1V0-ATPase) and A-ATPases (or A1A0-ATPase) are each composed of two linked complexes: the V1 or A1 complex contains the catalytic core that hydrolyses/synthesizes ATP, and the V0 or A0 complex that forms the membrane-spanning pore. The V- and A-ATPases both contain rotary motors, one that drives proton translocation across the membrane and one that drives ATP synthesis/hydrolysis [, , ]. The V- and A-ATPases more closely resemble one another in subunit structure than they do the F-ATPases, although the function of A-ATPases is closer to that of F-ATPases.  This entry represents the 116kDa subunit (or subunit a) and subunit I found in the V0 or A0 complex of V- or A-ATPases, respectively. The 116kDa subunit is a transmembrane glycoprotein required for the assembly and proton transport activity of the ATPase complex. Several isoforms of the 116kDa subunit exist, providing a potential role in the differential targeting and regulation of the V-ATPase for specific organelles []. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015991 ATP hydrolysis coupled proton transport, 0033177 proton-transporting two-sector ATPase complex, proton-transporting domain; PDB: 2RPW_X 2NVJ_A 2JTW_A 3RRK_A.
Probab=99.31  E-value=9.9e-13  Score=99.67  Aligned_cols=63  Identities=46%  Similarity=0.805  Sum_probs=44.4

Q ss_pred             hhHHHHHHHhhCCcEEEEeeecCCcccCCCCCCceeeEEEEEEEecHHHHHHHHHhhhhcCCeee
Q psy511            2 PAFERMLWRACRGNVFLRQAEIETPLEDINSGDPVYKSVFIIFFQGDQLKTRVMKICEGKKLSSV   66 (67)
Q Consensus         2 ~~fer~lwR~~RGN~~~~~~~i~~~~~d~~~~~~~~k~vFiv~~~G~~l~~Ki~KIc~~f~a~~~   66 (67)
                      ++|+|+|||+++||+|+++.+++++..|+.  +.++|.+|+++++|++..+|++|||+++|++.|
T Consensus       156 ~~f~~~l~r~~~~N~fi~~~~Ie~~~~d~~--e~~~k~v~vv~~~~~~~~~kv~~il~~~~f~~~  218 (759)
T PF01496_consen  156 ESFERILWRATRGNIFIRFSEIEEILEDPK--EEVEKEVFVVFFSGKELEEKVKKILRSFGFERY  218 (759)
T ss_dssp             HHHHHHHHHHHTT-----S------EEEE---EE-SSSEEEEEEEEGGGHHHHHHHHHTTT--B-
T ss_pred             HHHHHHHHHhccCCeEEEEEeeeccccccc--ceeeeeeEEEEEEchhhHHHHHHHhhccCceec
Confidence            579999999999999999999999988877  778899999999999999999999999999876


No 3  
>PF08793 2C_adapt:  2-cysteine adaptor domain;  InterPro: IPR014901 The virus-specific 2-cysteine adaptor is found fused to OTU/A20-like peptidases and S/T protein kinases. The associations to these proteins indicate that they might function as viral adaptors connecting the kinases and OTU/A20 peptidases to specific targets []. 
Probab=87.83  E-value=0.61  Score=23.40  Aligned_cols=28  Identities=21%  Similarity=0.434  Sum_probs=23.1

Q ss_pred             CcccCCCCCCceeeEEEEEEEecHHHHHHHHHhhhh
Q psy511           25 TPLEDINSGDPVYKSVFIIFFQGDQLKTRVMKICEG   60 (67)
Q Consensus        25 ~~~~d~~~~~~~~k~vFiv~~~G~~l~~Ki~KIc~~   60 (67)
                      ++..+|.||.++..        |..+.+++.|.|++
T Consensus         9 np~~NP~Tgr~Ik~--------~gp~y~~l~~~C~~   36 (37)
T PF08793_consen    9 NPTVNPITGRKIKP--------GGPTYKKLVKECGG   36 (37)
T ss_pred             CCCCCCCCCCcCCC--------CChHHHHHHHHcCC
Confidence            44578899988765        88999999999986


No 4  
>COG1269 NtpI Archaeal/vacuolar-type H+-ATPase subunit I [Energy production and conversion]
Probab=79.45  E-value=1.2  Score=34.37  Aligned_cols=55  Identities=25%  Similarity=0.225  Sum_probs=38.9

Q ss_pred             HHHhhCCcEEEEeeecCCcccCCCCCCceeeEEEEEEEecHHHHHHHHHhhhhcCCeee
Q psy511            8 LWRACRGNVFLRQAEIETPLEDINSGDPVYKSVFIIFFQGDQLKTRVMKICEGKKLSSV   66 (67)
Q Consensus         8 lwR~~RGN~~~~~~~i~~~~~d~~~~~~~~k~vFiv~~~G~~l~~Ki~KIc~~f~a~~~   66 (67)
                      +|+..++++.....+.....    -++...+.+++++.+++....++.+++++.+.+.+
T Consensus       164 ~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~v~~~~~~~~~~v~~~~~~~~~~~~  218 (660)
T COG1269         164 LVRREKLEALVGVIEDEVAL----YGENVEASVVIVVAHGAEDLDKVSKILNELGFELY  218 (660)
T ss_pred             eehhhhhhHHHhhcccccch----hhhccccceEEEEEecccchHHHHHHHHhCCcEEe
Confidence            45555555555444333321    11456789999999999999999999999988765


No 5  
>PF11430 EGL-1:  Programmed cell death activator EGL-1;  InterPro: IPR021543  Initiation of programmed cell death in C.elegans occurs by the binding of EGL-1 to CED-9 which disrupts a complex involving CED-4/CED-9 and allows CED-4 to activate CED-3, a caspase. It is the C-terminal domain of EGL-1 which is involved in the formation of the complex with CED-9. The formation of the complex induces structural rearrangements in CED-9 and EGL-1 adopts an extended alpha-helical conformation []. ; PDB: 1TY4_D.
Probab=74.83  E-value=0.83  Score=20.35  Aligned_cols=16  Identities=13%  Similarity=0.466  Sum_probs=13.6

Q ss_pred             HHHHHHHHhhhhcCCe
Q psy511           49 QLKTRVMKICEGKKLS   64 (67)
Q Consensus        49 ~l~~Ki~KIc~~f~a~   64 (67)
                      .|+.|+-+.||.|++.
T Consensus         2 ~IG~kla~MCDdFD~e   17 (21)
T PF11430_consen    2 EIGTKLAAMCDDFDAE   17 (21)
T ss_dssp             HHHHHHHHHHHHHHHH
T ss_pred             cHHHHHHHHHHHHHHH
Confidence            4789999999999765


No 6  
>PF14202 TnpW:  Transposon-encoded protein TnpW
Probab=68.75  E-value=6.6  Score=19.52  Aligned_cols=26  Identities=4%  Similarity=0.335  Sum_probs=19.0

Q ss_pred             ceeeEEEEEEEe-----cHHHHHHHHHhhhh
Q psy511           35 PVYKSVFIIFFQ-----GDQLKTRVMKICEG   60 (67)
Q Consensus        35 ~~~k~vFiv~~~-----G~~l~~Ki~KIc~~   60 (67)
                      .+.+++|+|-.+     .|.+..|++|++..
T Consensus         6 kIG~Tty~V~~~F~~~s~et~~DKi~rli~~   36 (37)
T PF14202_consen    6 KIGKTTYVVEVHFSETSKETMQDKIKRLIRR   36 (37)
T ss_pred             EECCEEEEEEEEECCCccccHHHHHHHHHhc
Confidence            356778886542     37899999999863


No 7  
>PF09827 CRISPR_Cas2:  CRISPR associated protein Cas2;  InterPro: IPR019199 Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR) are a family of DNA direct repeats separated by regularly sized non-repetitive spacer sequences that are found in most bacterial and archaeal genomes []. CRISPRs appear to provide acquired resistance against bacteriophages, possibly acting with an RNA interference-like mechanism to inhibit gene functions of invasive DNA elements [, ]. Differences in the number and type of spacers between CRISPR repeats correlate with phage sensitivity. It is thought that following phage infection, bacteria integrate new spacers derived from phage genomic sequences, and that the removal or addition of particular spacers modifies the phage-resistance phenotype of the cell. Therefore, the specificity of CRISPRs may be determined by spacer-phage sequence similarity. In addition, there are many protein families known as CRISPR-associated sequences (Cas), which are encoded in the vicinity of CRISPR loci []. CRISPR/cas gene regions can be quite large, with up to 20 different, tandem-arranged cas genes next to a CRISPR cluster or filling the region between two repeat clusters. Cas genes and CRISPRs are found on mobile genetic elements such as plasmids, and have undergone extensive horizontal transfer. Cas proteins are thought to be involved in the propagation and functioning of CRISPRs. Some Cas proteins show similarity to helicases and repair proteins, although the functions of most are unknown. Cas families can be divided into subtypes according to operon organisation and phylogeny.   Members of this family of bacterial proteins comprise various hypothetical proteins, as well as CRISPR (clustered regularly interspaced short palindromic repeats) associated proteins, conferring resistance to infection by certain bacteriophages. ; PDB: 3EXC_X 2I0X_A 3OQ2_B 3UI3_A 1ZPW_X 2I8E_A 2IVY_A.
Probab=58.39  E-value=19  Score=19.79  Aligned_cols=23  Identities=13%  Similarity=0.423  Sum_probs=18.3

Q ss_pred             EEEEEE--ecHHHHHHHHHhhhhcC
Q psy511           40 VFIIFF--QGDQLKTRVMKICEGKK   62 (67)
Q Consensus        40 vFiv~~--~G~~l~~Ki~KIc~~f~   62 (67)
                      -++|.|  ..+..++|+.|+++++|
T Consensus         3 ~~lv~YDi~~~k~~~kv~k~L~~~g   27 (78)
T PF09827_consen    3 LYLVAYDISDNKRRNKVRKILKSYG   27 (78)
T ss_dssp             EEEEEEEEHSHHHHHHHHHHHHHTT
T ss_pred             EEEEEEECCCcHHHHHHHHHHHHhC
Confidence            356666  45788999999999998


No 8  
>TIGR01573 cas2 CRISPR-associated endoribonuclease Cas2. This model describes most members of the family of Cas2, one of the first four protein families found to mark prokaryotic genomes that contain multiple CRISPR elements. It is an endoribonuclease, capable of cleaving single-stranded RNA. CRISPR is an acronym for Clustered Regularly Interspaced Short Palindromic Repeats. The cas genes are found near the repeats. A distinct branch of the Cas2 family shows a very low level of sequence identity and is modeled by TIGR01873 instead.
Probab=46.01  E-value=31  Score=19.97  Aligned_cols=29  Identities=28%  Similarity=0.330  Sum_probs=21.2

Q ss_pred             CC-CceeeEEEEEEEecH----HHHHHHHHhhhh
Q psy511           32 SG-DPVYKSVFIIFFQGD----QLKTRVMKICEG   60 (67)
Q Consensus        32 ~~-~~~~k~vFiv~~~G~----~l~~Ki~KIc~~   60 (67)
                      .| ..+++|||.......    .+.+++.++.+.
T Consensus        28 ~G~~rvQ~SVf~~~~~~~~~~~~l~~~l~~~i~~   61 (95)
T TIGR01573        28 YGLQRVQYSVFEGILEPNQLARKLIERLKRIIPD   61 (95)
T ss_pred             cchhheeccEEEEEcCHHHHHHHHHHHHHHhCCC
Confidence            46 678999999988653    466777777654


No 9  
>PF04807 Gemini_AC4_5:  Geminivirus AC4/5 conserved region;  InterPro: IPR006892 This entry represents a conserved domain found in Gemini virus AC4 and AC5 proteins [].
Probab=45.88  E-value=11  Score=18.53  Aligned_cols=14  Identities=29%  Similarity=0.880  Sum_probs=11.0

Q ss_pred             hhHHHHHHHhhCCc
Q psy511            2 PAFERMLWRACRGN   15 (67)
Q Consensus         2 ~~fer~lwR~~RGN   15 (67)
                      ..|.+++|+++|-.
T Consensus        17 k~l~KIl~~~~rst   30 (33)
T PF04807_consen   17 KHLTKILWFICRST   30 (33)
T ss_pred             HHHHHHhhhcccCc
Confidence            46889999998753


No 10 
>PF13443 HTH_26:  Cro/C1-type HTH DNA-binding domain; PDB: 3TYR_A 3TYS_A 3B7H_A.
Probab=45.83  E-value=11  Score=19.57  Aligned_cols=15  Identities=20%  Similarity=0.151  Sum_probs=10.6

Q ss_pred             HHHHHHhhhhcCCee
Q psy511           51 KTRVMKICEGKKLSS   65 (67)
Q Consensus        51 ~~Ki~KIc~~f~a~~   65 (67)
                      .+.+.+||+.||+++
T Consensus        40 ~~~l~~ia~~l~~~~   54 (63)
T PF13443_consen   40 LDTLEKIAKALNCSP   54 (63)
T ss_dssp             HHHHHHHHHHHT--H
T ss_pred             HHHHHHHHHHcCCCH
Confidence            467889999998763


No 11 
>PRK05771 V-type ATP synthase subunit I; Validated
Probab=43.08  E-value=37  Score=25.97  Aligned_cols=31  Identities=10%  Similarity=0.075  Sum_probs=25.1

Q ss_pred             eeeEEEEEEEecHHHHHHHHHhhhhcCCeee
Q psy511           36 VYKSVFIIFFQGDQLKTRVMKICEGKKLSSV   66 (67)
Q Consensus        36 ~~k~vFiv~~~G~~l~~Ki~KIc~~f~a~~~   66 (67)
                      ....++++++......+++.++|++++++.+
T Consensus       175 ~~~~~~~vvv~~~~~~~~~~~~l~~~~f~~~  205 (646)
T PRK05771        175 DKGYVYVVVVVLKELSDEVEEELKKLGFERL  205 (646)
T ss_pred             cCCcEEEEEEEEhhhHHHHHHHHHHCCCEEe
Confidence            3557778877777888999999999988764


No 12 
>PF10369 ALS_ss_C:  Small subunit of acetolactate synthase;  InterPro: IPR019455 This entry represents the C-terminal domain of the small subunit of acetolactate synthase (the N-terminal domain being an ACT domain). Acetolactate synthase is a tetrameric enzyme, composed of two large and two small subunits, which catalyses the first step in branched-chain amino acid biosynthesis. This reaction is sensitive to certain herbicides []. ; PDB: 2F1F_B 2FGC_A 2PC6_A.
Probab=42.21  E-value=25  Score=19.65  Aligned_cols=19  Identities=5%  Similarity=0.134  Sum_probs=15.5

Q ss_pred             cHHHHHHHHHhhhhcCCee
Q psy511           47 GDQLKTRVMKICEGKKLSS   65 (67)
Q Consensus        47 G~~l~~Ki~KIc~~f~a~~   65 (67)
                      ...-+..|.+||+.|+|++
T Consensus        12 ~~~~r~ei~~l~~~f~a~i   30 (75)
T PF10369_consen   12 TPENRSEILQLAEIFRARI   30 (75)
T ss_dssp             SCHHHHHHHHHHHHTT-EE
T ss_pred             CccCHHHHHHHHHHhCCEE
Confidence            4577899999999999986


No 13 
>PF13014 KH_3:  KH domain
Probab=37.25  E-value=25  Score=17.15  Aligned_cols=17  Identities=12%  Similarity=0.108  Sum_probs=13.6

Q ss_pred             HHHHHHhhhhcCCeeeC
Q psy511           51 KTRVMKICEGKKLSSVV   67 (67)
Q Consensus        51 ~~Ki~KIc~~f~a~~~~   67 (67)
                      +..|++|.+..+|++.+
T Consensus        10 G~~I~~I~~~tg~~I~i   26 (43)
T PF13014_consen   10 GSTIKEIREETGAKIQI   26 (43)
T ss_pred             ChHHHHHHHHhCcEEEE
Confidence            45688999999998764


No 14 
>PF04914 DltD_C:  DltD C-terminal region;  InterPro: IPR006998 The dlt operon (dltA to dltD) of Lactobacillus rhamnosus 7469 encodes four proteins responsible for the esterification of lipoteichoic acid (LTA) by D-alanine. These esters play an important role in controlling the net anionic charge of the poly (GroP) moiety of LTA. DltA and DltC encode the D-alanine-D-alanyl carrier protein ligase (Dcl) and D-alanyl carrier protein (Dcp), respectively. Whereas the functions of DltA and DltC are defined, the functions of DltB and DltD are unknown. In vitro assays showed that DltD bound Dcp for ligation with D-alanine by Dcl in the presence of ATP. In contrast, the homologue of Dcp, the Escherichia coli acyl carrier protein (ACP), involved in fatty acid biosynthesis, was not bound to DltD and thus was not ligated with D-alanine. DltD also catalyzed the hydrolysis of the mischarged D-alanyl-ACP. The hydrophobic N-terminal sequence of DltD was required for anchoring the protein in the membrane. It is hypothesized that this membrane-associated DltD facilitates the binding of Dcp and Dcl for ligation of Dcp with D-alanine and that the resulting D-alanyl-Dcp is translocated to the primary site of D-alanylation []. These sequences contain the C-terminal region of DltD.; PDB: 3BMA_C.
Probab=34.08  E-value=44  Score=20.79  Aligned_cols=19  Identities=0%  Similarity=0.064  Sum_probs=14.3

Q ss_pred             HHHHHHHHHhhhhcCCeee
Q psy511           48 DQLKTRVMKICEGKKLSSV   66 (67)
Q Consensus        48 ~~l~~Ki~KIc~~f~a~~~   66 (67)
                      +...+||+++|++.|.++.
T Consensus        75 ~~~y~kI~~~~~~~gf~v~   93 (130)
T PF04914_consen   75 QEYYKKIKYQLKSQGFNVA   93 (130)
T ss_dssp             HHHHHHHHHHHHTTT--EE
T ss_pred             HHHHHHHHHHHHHCCCEEE
Confidence            4678999999999998653


No 15 
>PF09353 DUF1995:  Domain of unknown function (DUF1995);  InterPro: IPR018962  This family of proteins are functionally uncharacterised. 
Probab=31.14  E-value=1e+02  Score=20.11  Aligned_cols=25  Identities=20%  Similarity=0.317  Sum_probs=21.0

Q ss_pred             EEEEEEEecHHHHHHHHHhhhhcCC
Q psy511           39 SVFIIFFQGDQLKTRVMKICEGKKL   63 (67)
Q Consensus        39 ~vFiv~~~G~~l~~Ki~KIc~~f~a   63 (67)
                      .+++++.++..-...+.++|+..+.
T Consensus        99 ~~~vvv~p~~~~l~~~e~~~~~~~~  123 (209)
T PF09353_consen   99 DILVVVAPSPQELDDVEKLCEAAGG  123 (209)
T ss_pred             CEEEEEECChhhHHHHHHHHHhcCC
Confidence            6778888777679999999999876


No 16 
>PF03937 Sdh5:  Flavinator of succinate dehydrogenase;  InterPro: IPR005631 This entry represents a group of uncharacterised small proteins found in both eukaryotes and prokaryotes, including NMA1147 from Neisseria meningitidis [] and YgfY from Escherichia coli []. YgfY may be involved in transcriptional regulation. The structure of these proteins consists of a complex bundle of five alpha-helices, which is composed of an up-down 3-helix bundle plus an orthogonal 2-helix bundle. ; PDB: 2LM4_A 1PUZ_A 2JR5_A 1X6I_A 1X6J_A.
Probab=30.85  E-value=36  Score=18.98  Aligned_cols=12  Identities=42%  Similarity=0.822  Sum_probs=8.8

Q ss_pred             HHHHHHHh-hCCc
Q psy511            4 FERMLWRA-CRGN   15 (67)
Q Consensus         4 fer~lwR~-~RGN   15 (67)
                      -+|+.||+ -||.
T Consensus         2 ~kRl~~r~~rRG~   14 (74)
T PF03937_consen    2 RKRLRWRCKRRGM   14 (74)
T ss_dssp             HHHHHHHHSS-SS
T ss_pred             cHHHHHHhhcccH
Confidence            47899999 7774


No 17 
>PF07401 Lenti_VIF_2:  Bovine Lentivirus VIF protein;  InterPro: IPR009979 This family consists of several Lentivirus viral infectivity factor (VIF) proteins. VIF is known to be essential for ability of cell-free virus preparation to infect cells []. Members of this family are specific to Bovine immunodeficiency virus (BIV) and Jembrana disease virus (JDV) which also infects cattle.
Probab=29.24  E-value=29  Score=23.21  Aligned_cols=19  Identities=32%  Similarity=0.639  Sum_probs=14.4

Q ss_pred             HHHhhCCc-EEEEeeecCCc
Q psy511            8 LWRACRGN-VFLRQAEIETP   26 (67)
Q Consensus         8 lwR~~RGN-~~~~~~~i~~~   26 (67)
                      |||+.||+ ++++|..=.+|
T Consensus       170 LwRarR~Ttlw~~f~~gkep  189 (198)
T PF07401_consen  170 LWRARRVTTLWMNFSSGKEP  189 (198)
T ss_pred             eeeeccCceEEEEecCCCCc
Confidence            78999996 78887765554


No 18 
>PF07830 PP2C_C:  Protein serine/threonine phosphatase 2C, C-terminal domain;  InterPro: IPR012911 Protein phosphatase 2C (PP2C) is involved in regulating cellular responses to stress in various eukaryotes. It consists of two domains: an N-terminal catalytic domain and a C-terminal domain characteristic of mammalian PP2Cs. This domain consists of three antiparallel alpha helices, one of which packs against two corresponding alpha-helices of the N-terminal domain. The C-terminal domain does not seem to play a role in catalysis, but it may provide protein substrate specificity due to the cleft that is created between it and the catalytic domain []. ; GO: 0000287 magnesium ion binding, 0004721 phosphoprotein phosphatase activity, 0030145 manganese ion binding; PDB: 2P8E_A 3FXL_A 3FXO_A 1A6Q_A 3FXK_A 3FXM_A 3FXJ_A.
Probab=27.76  E-value=97  Score=17.95  Aligned_cols=22  Identities=36%  Similarity=0.629  Sum_probs=14.2

Q ss_pred             EEEEEEEec----------------HHHHHHHHHhhhh
Q psy511           39 SVFIIFFQG----------------DQLKTRVMKICEG   60 (67)
Q Consensus        39 ~vFiv~~~G----------------~~l~~Ki~KIc~~   60 (67)
                      ++-+|.|+|                ..|.+|++.|++.
T Consensus         1 SiILV~FPgAPkvs~EAv~~E~eLd~~l~~rv~ei~~~   38 (81)
T PF07830_consen    1 SIILVCFPGAPKVSEEAVKKEAELDKYLEQRVEEIIEK   38 (81)
T ss_dssp             EEEEEE-TTS----HHHHHHHHHHHHHHHHHHHHHT--
T ss_pred             CEEEEecCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            456788887                2578888888865


No 19 
>PF08142 AARP2CN:  AARP2CN (NUC121) domain;  InterPro: IPR012948 This domain is the central domain of AARP2 (asparagine and aspartate rich protein 2). It is weakly similar to the GTP-binding domain of elongation factor TU []. PfAARP2 is an antigen from Plasmodium falciparum of 150 kDa, which is encoded by a unique gene on chromosome 1 []. The central region of Pfaarp2 contains blocks of repetitions encoding asparagine and aspartate residues. ; GO: 0042254 ribosome biogenesis, 0005634 nucleus
Probab=27.25  E-value=67  Score=18.42  Aligned_cols=25  Identities=16%  Similarity=0.230  Sum_probs=19.4

Q ss_pred             hHHHHHHHhhCCcEEEEeeecCCcc
Q psy511            3 AFERMLWRACRGNVFLRQAEIETPL   27 (67)
Q Consensus         3 ~fer~lwR~~RGN~~~~~~~i~~~~   27 (67)
                      .++.+-||-.|+.++..-.+....-
T Consensus        13 k~~~i~WR~~r~y~lad~~e~~~~~   37 (85)
T PF08142_consen   13 KPRPISWRDQRPYMLADRVEFVPDP   37 (85)
T ss_pred             ccCCCccccCCCeEEEEEEEecCCc
Confidence            3456789999999999887776543


No 20 
>smart00785 AARP2CN AARP2CN (NUC121) domain. This domain is the central domain of AARP2. It is weakly similar to the GTP-binding domain of elongation factor TU PUBMED:15112237.
Probab=26.94  E-value=71  Score=18.29  Aligned_cols=24  Identities=17%  Similarity=0.174  Sum_probs=18.2

Q ss_pred             hHHHHHHHhhCCcEEEEeeecCCc
Q psy511            3 AFERMLWRACRGNVFLRQAEIETP   26 (67)
Q Consensus         3 ~fer~lwR~~RGN~~~~~~~i~~~   26 (67)
                      .++.+-||-.|+.+...-.+..+.
T Consensus        13 k~~~l~WR~~rpY~lad~~e~~~~   36 (83)
T smart00785       13 KPRPLSWRDQHPYMLADRVEDITD   36 (83)
T ss_pred             cCCCCcccCCCCeEEEEEeEecCC
Confidence            356678999999999877665543


No 21 
>PF04086 SRP-alpha_N:  Signal recognition particle, alpha subunit, N-terminal;  InterPro: IPR007222  The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ]. SRP recognises the signal sequence of the nascent polypeptide on the ribosome, retards its elongation, and docks the SRP-ribosome-polypeptide complex to the RER membrane via the SR receptor. Eukaryotic SRP consists of six polypeptides (SRP9, SRP14, SRP19, SRP54, SRP68 and SRP72) and a single 300 nucleotide 7S RNA molecule. The RNA component catalyses the interaction of SRP with its SR receptor []. In higher eukaryotes, the SRP complex consists of the Alu domain and the S domain linked by the SRP RNA. The Alu domain consists of a heterodimer of SRP9 and SRP14 bound to the 5' and 3' terminal sequences of SRP RNA. This domain is necessary for retarding the elongation of the nascent polypeptide chain, which gives SRP time to dock the ribosome-polypeptide complex to the RER membrane. In archaea, the SRP complex contains 7S RNA like its eukaryotic counterpart, yet only includes two of the six protein subunits found in the eukarytic complex: SRP19 and SRP54 []. The SR receptor is a monomer consisting of the loosely membrane-associated SR-alpha homologue FtsY, while the eukaryotic SR receptor is a heterodimer of SR-alpha (70 kDa) and SR-beta (25 kDa), both of which contain a GTP-binding domain []. SR-alpha regulates the targeting of SRP-ribosome-nascent polypeptide complexes to the translocon []. SR-alpha binds to the SRP54 subunit of the SRP complex. The SR-beta subunit is a transmembrane GTPase that anchors the SR-alpha subunit (a peripheral membrane GTPase) to the ER membrane []. SR-beta interacts with the N-terminal SRX-domain of SR-alpha, which is not present in the bacterial FtsY homologue. SR-beta also functions in recruiting the SRP-nascent polypeptide to the protein-conducting channel.  This entry represents the alpha subunit of the SR receptor.; GO: 0003924 GTPase activity, 0005047 signal recognition particle binding, 0005525 GTP binding, 0006184 GTP catabolic process, 0006886 intracellular protein transport, 0005785 signal recognition particle receptor complex; PDB: 2FH5_A 2GO5_1.
Probab=26.86  E-value=94  Score=21.01  Aligned_cols=20  Identities=35%  Similarity=0.509  Sum_probs=13.1

Q ss_pred             eEEEEEEEec-------HHHHHHHHHh
Q psy511           38 KSVFIIFFQG-------DQLKTRVMKI   57 (67)
Q Consensus        38 k~vFiv~~~G-------~~l~~Ki~KI   57 (67)
                      -.||||.||+       +.|...|+++
T Consensus        38 ~LvfVvvYq~il~l~yvd~LL~~v~~~   64 (279)
T PF04086_consen   38 GLVFVVVYQKILQLTYVDKLLDDVKKE   64 (279)
T ss_dssp             TEEEEEEES-GGGHHHHHHHHHHHHHH
T ss_pred             CEEEeeeecccccchHHHHHHHHHHHH
Confidence            3899999998       4555555543


No 22 
>cd00231 ZipA ZipA C-terminal domain. ZipA, a membrane-anchored protein, is one of at least nine essential gene products necessary for assembly of the septal ring which mediates cell division in E.coli. ZipA and FtsA directly bind FtsZ, a homolog of eukaryotic tubulins, at the prospective division site, followed by the sequential addition of FtsK, FtsQ, FtsL, FtsW, FtsI, and FtsN.  ZipA contains three domains: a short N-terminal membrane-anchored domain, a central P/Q domain that is rich in proline and glutamine and a C-terminal domain, which comprises almost half the protein.
Probab=26.67  E-value=1.6e+02  Score=18.17  Aligned_cols=62  Identities=15%  Similarity=0.110  Sum_probs=39.3

Q ss_pred             HHHHHHhhCCcEEEEeeecCCc-ccCCCCC--CceeeEEEEEEEec--------HHHHHHHHHhhhhcCCeee
Q psy511            5 ERMLWRACRGNVFLRQAEIETP-LEDINSG--DPVYKSVFIIFFQG--------DQLKTRVMKICEGKKLSSV   66 (67)
Q Consensus         5 er~lwR~~RGN~~~~~~~i~~~-~~d~~~~--~~~~k~vFiv~~~G--------~~l~~Ki~KIc~~f~a~~~   66 (67)
                      .|..=....|++.+..+.+.+| ..|+.+-  ....-.+|.+--++        +.+-+--+++++.+++.+.
T Consensus        39 Hr~~~~~~~g~vlFSlan~~~PG~F~~~~m~~~~t~Gvtlfm~lP~~~~~~~~F~~Ml~~A~~lA~~LgG~ll  111 (130)
T cd00231          39 HRHLSLSGSGPVLFSVANMVKPGTFDPDNMADFSTPGISFFMQLPSPGDALQNFKLMLQAAQRIADDLGGVVL  111 (130)
T ss_pred             EeccccCCCCceEEEEeeccCCCCCChhhhhccccCeEEEEEECCCCCcHHHHHHHHHHHHHHHHHHcCCEEE
Confidence            3433345678888888887765 3455432  23344555555554        4677888899999998764


No 23 
>TIGR00789 flhB_rel flhB C-terminus-related protein. This model describes a short protein (80-93 residues) homologous to the C-terminus of the flagellar biosynthetic protein FlhB. It is found so far only in species that also have FlhB. In a phylogenetic tree based on alignment of both this family and the homologous region of FlhB and its homologs, the members of this family form a monophyletic set.
Probab=26.25  E-value=1.2e+02  Score=17.38  Aligned_cols=25  Identities=16%  Similarity=0.389  Sum_probs=19.5

Q ss_pred             EEEEec-HHHHHHHHHhhhhcCCeee
Q psy511           42 IIFFQG-DQLKTRVMKICEGKKLSSV   66 (67)
Q Consensus        42 iv~~~G-~~l~~Ki~KIc~~f~a~~~   66 (67)
                      +|...| +.+.++|+++++..+..++
T Consensus        19 ~VvAKG~g~~A~~I~~~A~e~~VPi~   44 (82)
T TIGR00789        19 KVVASGVGEVAERIIEIAKKHGIPIV   44 (82)
T ss_pred             EEEEEeCCHHHHHHHHHHHHcCCCEE
Confidence            355556 7999999999998887654


No 24 
>PF04312 DUF460:  Protein of unknown function (DUF460);  InterPro: IPR007408 This is an archaeal protein of unknown function.
Probab=26.06  E-value=40  Score=21.55  Aligned_cols=19  Identities=16%  Similarity=-0.011  Sum_probs=15.0

Q ss_pred             HHHHHHHHhhhhcCCeeeC
Q psy511           49 QLKTRVMKICEGKKLSSVV   67 (67)
Q Consensus        49 ~l~~Ki~KIc~~f~a~~~~   67 (67)
                      ..=.-++||..+|+|..|+
T Consensus        87 p~P~~V~Kia~~f~A~ly~  105 (138)
T PF04312_consen   87 PPPETVKKIARSFNAVLYT  105 (138)
T ss_pred             CCcHHHHHHHHHhCCcccC
Confidence            3456788999999998885


No 25 
>PF03479 DUF296:  Domain of unknown function (DUF296);  InterPro: IPR005175 This putative conserved domain is found in proteins that contain AT-hook motifs IPR000637 from INTERPRO, suggesting a DNA-binding function for the proteins as a whole, however, the function of this domain is unknown. Overexpression of a protein containing this domain, Q9S7C9 from SWISSPROT, in Arabidopsis thaliana causes late flowering and modified leaf development []. ; PDB: 2DT4_A 2P6Y_A 3HWU_A 3HTN_A 2NMU_A 2H6L_A 2HX0_A.
Probab=25.60  E-value=93  Score=18.58  Aligned_cols=25  Identities=12%  Similarity=0.182  Sum_probs=19.1

Q ss_pred             EEEEEEecHHHHHHHHHhhhhcCCe
Q psy511           40 VFIIFFQGDQLKTRVMKICEGKKLS   64 (67)
Q Consensus        40 vFiv~~~G~~l~~Ki~KIc~~f~a~   64 (67)
                      ..+-+-+|+.+.+.|.++|+..+.+
T Consensus         4 ~~~rl~~Gedl~~~l~~~~~~~~i~   28 (120)
T PF03479_consen    4 FVIRLDPGEDLLESLEAFAREHGIR   28 (120)
T ss_dssp             EEEEEETTSBHHHHHHHHHHHHT-S
T ss_pred             EEEEECCCCHHHHHHHHHHHHCCCc
Confidence            3455558999999999999987653


No 26 
>COG4062 MtrB Tetrahydromethanopterin S-methyltransferase, subunit B [Coenzyme metabolism]
Probab=24.93  E-value=91  Score=19.12  Aligned_cols=31  Identities=19%  Similarity=0.266  Sum_probs=20.9

Q ss_pred             ccCCCCCCceeeEEEEEEEecHHHHHHHHHh
Q psy511           27 LEDINSGDPVYKSVFIIFFQGDQLKTRVMKI   57 (67)
Q Consensus        27 ~~d~~~~~~~~k~vFiv~~~G~~l~~Ki~KI   57 (67)
                      ..||+||--..+.==+|++.=+.+.++|+|.
T Consensus        13 vmd~~Tgvvae~~edvi~ldv~pi~Eqi~kL   43 (108)
T COG4062          13 VMDPETGVVAEGFEDVIFLDVDPIEEQIKKL   43 (108)
T ss_pred             eEccchhhHhhccCceEEEeccHHHHHHHHH
Confidence            4799987544444345666668888888874


No 27 
>PF12153 CAP18_C:  LPS binding domain of CAP18 (C terminal);  InterPro: IPR022746 This entry represents the cathlecidin antimicrobial C-terminal peptides. The C terminus is cleaved from the cathlecidin precursor, and is approximately 30 amino acids in length with a helical structure. This entry is found in association with PF00666 from PFAM. The C terminus peptides possess antimicrobial activity by virtue of their binding to bacterial lipopolysaccharides [][].; GO: 0042742 defense response to bacterium; PDB: 1LYP_A 2LMF_A 2FBU_H 2FBS_N 2K6O_A 2FCG_F.
Probab=24.65  E-value=59  Score=15.37  Aligned_cols=13  Identities=23%  Similarity=0.575  Sum_probs=7.8

Q ss_pred             cHHHHHHHHHhhh
Q psy511           47 GDQLKTRVMKICE   59 (67)
Q Consensus        47 G~~l~~Ki~KIc~   59 (67)
                      |+.+.+|++||-+
T Consensus         8 ~eKigeklkkIGQ   20 (28)
T PF12153_consen    8 GEKIGEKLKKIGQ   20 (28)
T ss_dssp             HHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHH
Confidence            3566667766643


No 28 
>PF08889 WbqC:  WbqC-like protein family;  InterPro: IPR014985 This family of proteins are functionally uncharacterised. However, it is found in an O-antigen gene cluster in Escherichia coli [] and other bacteria [] suggesting a role in O-antigen production. It has been suggested that wbnG may code for a glycine transferase []. 
Probab=24.37  E-value=55  Score=21.86  Aligned_cols=22  Identities=18%  Similarity=0.401  Sum_probs=17.9

Q ss_pred             ecHHHHHHHHHhhhhcCCeeeC
Q psy511           46 QGDQLKTRVMKICEGKKLSSVV   67 (67)
Q Consensus        46 ~G~~l~~Ki~KIc~~f~a~~~~   67 (67)
                      ++..-.+++..||..+||+.|+
T Consensus       138 ~~~~~~~~vi~i~~~~ga~~Yi  159 (219)
T PF08889_consen  138 PEGKKSERVIDICKALGADTYI  159 (219)
T ss_pred             CCCCchHHHHHHHHHcCCCeee
Confidence            3455678999999999999885


No 29 
>PF12844 HTH_19:  Helix-turn-helix domain; PDB: 3LIS_B 3LFP_A 2XIU_B 2GZU_B 2XJ3_A 1UTX_A 2XI8_B 3F6W_C 3EUS_B.
Probab=23.71  E-value=57  Score=16.77  Aligned_cols=14  Identities=29%  Similarity=0.301  Sum_probs=10.6

Q ss_pred             HHHHHHhhhhcCCe
Q psy511           51 KTRVMKICEGKKLS   64 (67)
Q Consensus        51 ~~Ki~KIc~~f~a~   64 (67)
                      ...+++||+.|+++
T Consensus        41 ~~~l~~i~~~~~v~   54 (64)
T PF12844_consen   41 VSTLKKIAEALGVS   54 (64)
T ss_dssp             HHHHHHHHHHHTS-
T ss_pred             HHHHHHHHHHhCCC
Confidence            46678999998875


No 30 
>smart00530 HTH_XRE Helix-turn-helix XRE-family like proteins.
Probab=23.70  E-value=68  Score=14.52  Aligned_cols=15  Identities=13%  Similarity=0.111  Sum_probs=11.0

Q ss_pred             HHHHHHHhhhhcCCe
Q psy511           50 LKTRVMKICEGKKLS   64 (67)
Q Consensus        50 l~~Ki~KIc~~f~a~   64 (67)
                      -...+.+||+.||.+
T Consensus        38 ~~~~~~~i~~~~~~~   52 (56)
T smart00530       38 SLETLKKLAKALGVS   52 (56)
T ss_pred             CHHHHHHHHHHhCCC
Confidence            356678888888765


No 31 
>PF00356 LacI:  Bacterial regulatory proteins, lacI family;  InterPro: IPR000843 Numerous bacterial transcription regulatory proteins bind DNA via a helix-turn-helix (HTH) motif. These proteins are very diverse, but for convenience may be grouped into subfamilies on the basis of sequence similarity. One such family groups together a range of proteins, including ascG, ccpA, cytR, ebgR, fruR, galR, galS, lacI, malI, opnR, purF, rafR, rbtR and scrR [, ]. Within this family, the HTH motif is situated towards the N terminus.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0006355 regulation of transcription, DNA-dependent, 0005622 intracellular; PDB: 3KJX_C 1ZAY_A 1VPW_A 2PUA_A 1QQA_A 1PNR_A 1JFT_A 1QP4_A 2PUD_A 1JH9_A ....
Probab=23.58  E-value=82  Score=16.04  Aligned_cols=16  Identities=13%  Similarity=0.360  Sum_probs=13.3

Q ss_pred             cHHHHHHHHHhhhhcC
Q psy511           47 GDQLKTRVMKICEGKK   62 (67)
Q Consensus        47 G~~l~~Ki~KIc~~f~   62 (67)
                      ++..++||.++++.+|
T Consensus        27 s~~tr~rI~~~a~~lg   42 (46)
T PF00356_consen   27 SEETRERILEAAEELG   42 (46)
T ss_dssp             THHHHHHHHHHHHHHT
T ss_pred             CHHHHHHHHHHHHHHC
Confidence            4788999999998765


No 32 
>cd02394 vigilin_like_KH K homology RNA-binding domain_vigilin_like.  The vigilin family is a large and extended family of multiple KH-domain proteins, including vigilin, also called high density lipoprotein binding protien (HBP), fungal Scp160 and bicaudal-C. Yeast Scp160p has been shown to bind RNA and to associate with both soluble and membrane-bound polyribosomes as a mRNP component. Bicaudal-C is a RNA-binding molecule believed to function in embryonic development at the post-transcriptional level. In general, KH binds single-stranded RNA or DNA. It is found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.
Probab=22.86  E-value=72  Score=16.37  Aligned_cols=17  Identities=18%  Similarity=0.167  Sum_probs=12.4

Q ss_pred             HHHHHHhhhhcCCeeeC
Q psy511           51 KTRVMKICEGKKLSSVV   67 (67)
Q Consensus        51 ~~Ki~KIc~~f~a~~~~   67 (67)
                      +..+++|.+..++++.+
T Consensus        19 G~~i~~i~~~~g~~I~i   35 (62)
T cd02394          19 GSNIRKIMEETGVKIRF   35 (62)
T ss_pred             CCcHHHHHHHhCCEEEc
Confidence            34577888888888764


No 33 
>cd02393 PNPase_KH Polynucleotide phosphorylase (PNPase) K homology RNA-binding domain (KH). PNPase is a polyribonucleotide nucleotidyl transferase that degrades mRNA in prokaryotes and plant chloroplasts. The C-terminal region of PNPase contains domains homologous to those in other RNA binding proteins: a KH domain and an S1 domain. KH domains bind single-stranded RNA and are found in a wide variety of proteins including ribosomal proteins, transcription factors and post-transcriptional modifiers of mRNA.
Probab=22.81  E-value=67  Score=16.98  Aligned_cols=17  Identities=18%  Similarity=0.173  Sum_probs=13.2

Q ss_pred             HHHHHHhhhhcCCeeeC
Q psy511           51 KTRVMKICEGKKLSSVV   67 (67)
Q Consensus        51 ~~Ki~KIc~~f~a~~~~   67 (67)
                      +.-+++|.+.++|++.+
T Consensus        21 G~~ik~I~~~tg~~I~i   37 (61)
T cd02393          21 GKTIKKIIEETGVKIDI   37 (61)
T ss_pred             chHHHHHHHHHCCEEEe
Confidence            45678899999998753


No 34 
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only]
Probab=22.45  E-value=95  Score=21.35  Aligned_cols=19  Identities=32%  Similarity=0.478  Sum_probs=16.4

Q ss_pred             HHHHHHHHHhhhhcCCeee
Q psy511           48 DQLKTRVMKICEGKKLSSV   66 (67)
Q Consensus        48 ~~l~~Ki~KIc~~f~a~~~   66 (67)
                      +.-++++.++|+.+|+..|
T Consensus        98 ~yqk~rve~lc~~lGl~~~  116 (223)
T COG2102          98 EYQKERVERLCEELGLKVY  116 (223)
T ss_pred             HHHHHHHHHHHHHhCCEEe
Confidence            5678999999999998876


No 35 
>PF00013 KH_1:  KH domain syndrome, contains KH motifs.;  InterPro: IPR018111 The K homology (KH) domain was first identified in the human heterogeneous nuclear ribonucleoprotein (hnRNP) K. It is a domain of around 70 amino acids that is present in a wide variety of quite diverse nucleic acid-binding proteins []. It has been shown to bind RNA [, ]. Like many other RNA-binding motifs, KH motifs are found in one or multiple copies (14 copies in chicken vigilin) and, at least for hnRNP K (three copies) and FMR-1 (two copies), each motif is necessary for in vitro RNA binding activity, suggesting that they may function cooperatively or, in the case of single KH motif proteins (for example, Mer1p), independently []. According to structural [, , ] analysis the KH domain can be separated in two groups. The first group or type-1 contain a beta-alpha-alpha-beta-beta-alpha structure, whereas in the type-2 the two last beta-sheet are located in the N-terminal part of the domain (alpha-beta-beta-alpha-alpha-beta). Sequence similarity between these two folds are limited to a short region (VIGXXGXXI) in the RNA binding motif. This motif is located between helice 1 and 2 in type-1 and between helice 2 and 3 in type-2. Proteins known to contain a type-1 KH domain include bacterial polyribonucleotide nucleotidyltransferases (2.7.7.8 from EC); vertebrate fragile X mental retardation protein 1 (FMR1); eukaryotic heterogeneous nuclear ribonucleoprotein K (hnRNP K), one of at least 20 major proteins that are part of hnRNP particles in mammalian cells; mammalian poly(rC) binding proteins; Artemia salina glycine-rich protein GRP33; yeast PAB1-binding protein 2 (PBP2); vertebrate vigilin; and human high-density lipoprotein binding protein (HDL-binding protein). More information about these proteins can be found at Protein of the Month: RNA Exosomes [].; GO: 0003723 RNA binding; PDB: 1TUA_A 2Z0S_A 1WE8_A 4AM3_B 4AIM_A 4AID_A 2HH3_A 2JVZ_A 1J4W_A 2HH2_A ....
Probab=22.25  E-value=61  Score=16.54  Aligned_cols=17  Identities=12%  Similarity=0.161  Sum_probs=13.7

Q ss_pred             HHHHHHhhhhcCCeeeC
Q psy511           51 KTRVMKICEGKKLSSVV   67 (67)
Q Consensus        51 ~~Ki~KIc~~f~a~~~~   67 (67)
                      +..|++|.+.++|++.+
T Consensus        19 G~~i~~I~~~t~~~I~i   35 (60)
T PF00013_consen   19 GSNIKEIEEETGVKIQI   35 (60)
T ss_dssp             GHHHHHHHHHHTSEEEE
T ss_pred             CCcHHHhhhhcCeEEEE
Confidence            56788999999998753


No 36 
>COG3655 Predicted transcriptional regulator [Transcription]
Probab=22.25  E-value=64  Score=18.43  Aligned_cols=14  Identities=21%  Similarity=0.411  Sum_probs=11.1

Q ss_pred             HHHHHHhhhhcCCe
Q psy511           51 KTRVMKICEGKKLS   64 (67)
Q Consensus        51 ~~Ki~KIc~~f~a~   64 (67)
                      -+-+.|||+++.|+
T Consensus        45 ~~tL~~iC~~LeCq   58 (73)
T COG3655          45 LSTLEKICKALECQ   58 (73)
T ss_pred             HHHHHHHHHHcCCC
Confidence            35678999999875


No 37 
>TIGR02684 dnstrm_HI1420 probable addiction module antidote protein. gene pairs, when found on the bacterial chromosome, are located often with prophage regions, but also both in integrated plasmid regions and in housekeeping gene regions. Analysis suggests that the gene pair may serve as an addiction module.
Probab=22.08  E-value=71  Score=18.50  Aligned_cols=15  Identities=13%  Similarity=0.195  Sum_probs=11.2

Q ss_pred             HHHHHHhhhhcCCee
Q psy511           51 KTRVMKICEGKKLSS   65 (67)
Q Consensus        51 ~~Ki~KIc~~f~a~~   65 (67)
                      ...+.|||++||.++
T Consensus        72 ~~tL~kI~~aLgi~l   86 (89)
T TIGR02684        72 FDTILKVTKALGLKL   86 (89)
T ss_pred             HHHHHHHHHHcCCce
Confidence            466788888888765


No 38 
>cd02979 PHOX_C FAD-dependent Phenol hydoxylase (PHOX) family, C-terminal TRX-fold domain; composed of proteins similar to PHOX from the aerobic topsoil yeast Trichosporon cutaneum. PHOX is a flavoprotein monooxygenase that catalyzes the hydroxylation of phenol and simple phenol derivatives in the ortho position with the consumption of NADPH and oxygen. This is the first step in the biodegradation and detoxification of phenolic compounds. PHOX contains three domains. The substrate and FAD/NAD(P) binding sites are contained in the first two domains, which adopt a complicated folding pattern. The third or C-terminal domain contains a TRX fold and is involved in dimerization. The functional unit of PHOX is a dimer, although active tetramers of the recombinant enzyme can be isolated when overproduced in bacteria.
Probab=22.00  E-value=1e+02  Score=19.58  Aligned_cols=22  Identities=36%  Similarity=0.735  Sum_probs=16.7

Q ss_pred             EEEEecH----HHHHHHHHhhhhcCC
Q psy511           42 IIFFQGD----QLKTRVMKICEGKKL   63 (67)
Q Consensus        42 iv~~~G~----~l~~Ki~KIc~~f~a   63 (67)
                      |++|.|+    .-.+++.+.|+.+..
T Consensus        32 I~vFagd~~~~~~~~~l~~~~~~L~~   57 (167)
T cd02979          32 IYVFAGDIAPAQQKSRLTQLCDALDS   57 (167)
T ss_pred             EEEEcCCCCchhHHHHHHHHHHHHcC
Confidence            5667775    557899999998854


No 39 
>COG2938 Uncharacterized conserved protein [Function unknown]
Probab=21.92  E-value=68  Score=19.16  Aligned_cols=12  Identities=42%  Similarity=0.847  Sum_probs=10.2

Q ss_pred             hHHHHHHHhhCC
Q psy511            3 AFERMLWRACRG   14 (67)
Q Consensus         3 ~fer~lwR~~RG   14 (67)
                      .-.|+.||+=||
T Consensus        14 ~~~RL~~rsrRG   25 (94)
T COG2938          14 RKARLRWRSRRG   25 (94)
T ss_pred             HHHHHHHHHHhc
Confidence            457999999999


No 40 
>PF05184 SapB_1:  Saposin-like type B, region 1;  InterPro: IPR007856 Synonym(s):cerebroside sulphate activator, CSAct   Saposin B is a small non-enzymatic glycoprotein required for the breakdown of cerebroside sulphates (sulphatides) in lysosomes. Saposin B contains three intramolecular disulphide bridges, exists as a dimer and is remarkably heat, protease, and pH stable. The crystal structure of human saposin B reveals an unusual shell-like dimer consisting of a monolayer of alpha-helices enclosing a large hydrophobic cavity. Although the secondary structure of saposin B is similar to that of the known monomeric members of the saposin-like superfamily, the helices are repacked into a different tertiary arrangement to form the homodimer. A comparison of the two forms of the saposin B dimer suggests that extraction of target lipids from membranes involves a conformational change that facilitates access to the inner cavity [].; GO: 0006629 lipid metabolic process; PDB: 1N69_C 1QDM_C 4DDJ_A 2DOB_A 1OF9_A 2Z9A_A 1M12_A 2GTG_A 1SN6_A 2QYP_B ....
Probab=21.45  E-value=1e+02  Score=14.31  Aligned_cols=14  Identities=21%  Similarity=0.508  Sum_probs=11.1

Q ss_pred             HHHHHHHHHhhhhc
Q psy511           48 DQLKTRVMKICEGK   61 (67)
Q Consensus        48 ~~l~~Ki~KIc~~f   61 (67)
                      +.+.+.+.++|+.+
T Consensus        25 ~~I~~~l~~~C~~l   38 (39)
T PF05184_consen   25 EEIKKALEKACNKL   38 (39)
T ss_dssp             HHHHHHHHHHHTTS
T ss_pred             HHHHHHHHHHHhhC
Confidence            57888888898765


No 41 
>PF12682 Flavodoxin_4:  Flavodoxin; PDB: 3EDO_B 3KLB_A.
Probab=20.98  E-value=1.7e+02  Score=18.34  Aligned_cols=26  Identities=15%  Similarity=0.299  Sum_probs=15.9

Q ss_pred             EEEEEe-cHHHHHHHHHhhhhcCCeee
Q psy511           41 FIIFFQ-GDQLKTRVMKICEGKKLSSV   66 (67)
Q Consensus        41 Fiv~~~-G~~l~~Ki~KIc~~f~a~~~   66 (67)
                      -||+|+ ....+.=-++|++..+|.++
T Consensus         3 LVvYyS~tGnT~~vA~~Ia~~~gadi~   29 (156)
T PF12682_consen    3 LVVYYSRTGNTKKVAEKIAEKTGADIF   29 (156)
T ss_dssp             EEEE--SSSHHHHHHHHHHHCCT-EEE
T ss_pred             EEEEECCCchHHHHHHHHHHHHCCCEE
Confidence            467774 45666666678888888775


No 42 
>PRK04017 hypothetical protein; Provisional
Probab=20.52  E-value=89  Score=19.69  Aligned_cols=20  Identities=15%  Similarity=0.423  Sum_probs=15.5

Q ss_pred             ecHHHHHHHHHhhhhcCCee
Q psy511           46 QGDQLKTRVMKICEGKKLSS   65 (67)
Q Consensus        46 ~G~~l~~Ki~KIc~~f~a~~   65 (67)
                      +|+.++.++.+.-.+.|+.+
T Consensus        77 ~GekIr~~l~~~l~~~G~~v   96 (132)
T PRK04017         77 KGEELAKKLSEYLQGYGIKV   96 (132)
T ss_pred             chHHHHHHHHHHHHhCCCCc
Confidence            47899999988887777653


Done!