Diaphorina citri psyllid: psy5111

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130--
EKFLLTSKGQCTTADFQRATSVVTHEFTHQWFGDLVTPASWNFAWLNEAFARLFEYFGTRMLYVQEIPTPIREKFLLTSKHQCTTADFQRATSVVTHEFTHQWFGDLVTPASWNFAWLNEAFARLFEYFGTR
cccEEEccccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHccccHHHHHHHHHcccccccccccHHHHHHHcccccccHHHHHHccccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHcc
EKFLLTSKGQCTTADFQRATSVVTHEFTHQWFGDLVTPASWNFAWLNEAFARLFEYFGTRMLYVQEIPTPIREKFLLTSKHQCTTADFQRATSVVTHEFTHQWFGDLVTPASWNFAWLNEAFARLFEYFGTR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
EKFLLTSKGQCTTADFQRATSVVTHEFTHQWFGDLVTPASWNFAWLNEAFARLFEYFGTRMLYVQEIPTPIREKFLLTSKHQCTTADFQRATSVVTHEFTHQWFGDLVTPASWNFAWLNEAFARLFEYFGTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005615 [CC]extracellular spaceprobableGO:0005575, GO:0005576, GO:0044421
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043233 [CC]organelle lumenprobableGO:0005575, GO:0044422, GO:0031974, GO:0043226
GO:0044237 [BP]cellular metabolic processprobableGO:0009987, GO:0008150, GO:0008152
GO:0070006 [MF]metalloaminopeptidase activityprobableGO:0004177, GO:0016787, GO:0003824, GO:0008238, GO:0070011, GO:0003674, GO:0008233, GO:0008235, GO:0008237
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0031988 [CC]membrane-bounded vesicleprobableGO:0005575, GO:0031982, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XQ0, chain A
Confidence level:very confident
Coverage over the Query: 46-131
View the alignment between query and template
View the model in PyMOL
Template: 3SE6, chain A
Confidence level:very confident
Coverage over the Query: 1-98
View the alignment between query and template
View the model in PyMOL