Diaphorina citri psyllid: psy5132


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200----
MEKTPHGILSGDGANEFGRRMGLPQIPDSELITENAKHALEKFLCEGQDPNVTEIGGGGVGTVGAVAVDARGHMVSCTSTGGITGKMKGRVGDTPIPGSGGYCDDNIASVSTTGHGDSILRYCVAHRILHYIEQGLSATEASQKALDGMRTRVGKTAGAITVTKCGKVGVYFNSPKMAWAYIRGTKLHYGIYPGQDIEEDLAQS
ccccccCEEEcHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccccccccccccccccEEEEEEcccccEEEEEcccccccccccccccccccccccEEccccEEEEEcccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccCEEEEEcccccEEEEEcccccEEEEEEccCEEEEEEcccccccccccc
MEKTPHGILSGDGANEFGRRMGLPQIPDSELITENAKHALEKFLCEGQDPNVTEIGGGGVGTVGAVAVDARGHMVSCTSTGGITGKMKGRVGDTPIPGSGGYCDDNIASVSTTGHGDSILRYCVAHRILHYIEQGLSATEASQKALDGMRTRVGKTAGAITVTKCGKVGVYFNSPKMAWAYIRGTKLHYGIYPGQDI*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKTPHGILSGDGANEFGRRMGLPQIPDSELITENAKHALEKFLCEGQDPNVTEIGGGGVGTVGAVAVDARGHMVSCTSTGGITGKMKGRVGDTPIPGSGGYCDDNIASVSTTGHGDSILRYCVAHRILHYIEQGLSATEASQKALDGMRTRVGKTAGAITVTKCGKVGVYFNSPKMAWAYIRGTKLHYGIYPGQDIEEDLAQS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Isoaspartyl peptidase/L-asparaginase Acts in asparagine catabolism. May be involved in astroglial production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions.confidentQ7L266
Probable isoaspartyl peptidase/L-asparaginase GA20639 Acts in asparagine catabolism.confidentQ29I93
Isoaspartyl peptidase/L-asparaginase Acts in asparagine catabolism. May be involved in astroglial production of L-aspartate, which can act as an excitatory neurotransmitter in some brain regions.confidentQ32LE5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0003948 [MF]N4-(beta-N-acetylglucosaminyl)-L-asparaginase activityprobableGO:0016787, GO:0016810, GO:0016811, GO:0003674, GO:0003824
GO:0008798 [MF]beta-aspartyl-peptidase activityprobableGO:0016787, GO:0003824, GO:0008242, GO:0008238, GO:0070011, GO:0003674, GO:0008233
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0004067 [MF]asparaginase activityprobableGO:0016787, GO:0016810, GO:0016811, GO:0003674, GO:0003824
GO:0015630 [CC]microtubule cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GDV, chain A
Confidence level:very confident
Coverage over the Query: 1-45,59-202
View the alignment between query and template
View the model in PyMOL