Diaphorina citri psyllid: psy5147


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MSGIIHTCKPSRSPSNAFDRDVYTSGIGPVPALQCGVAVDLRPVKIRQRRAMLRAAGVDKIDPTEKNQCKQIRISREFCGCACEGYCDPEICACALAGIKCQVDRQNFPCGCSRDCCANPKGRIEFNPVRVHSHYIQTIMRMKAQKKDDDDMSRQHFS
cccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEccccccccccccccccccccEEccHHHHHHHHHHHHHHHHccccccccccccccc
********************DVYTSGIGPVPALQCGVAVDLRPVKIRQRRAMLRAAGVDKIDPTEKNQCKQIRISREFCGCACEGYCDPEICACALAGIKCQVDRQNFPCGCSRDCCANPKGRIEFNPVRVHSHYIQTIM******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGIIHTCKPSRSPSNAFDRDVYTSGIGPVPALQCGVAVDLRPVKIRQRRAMLRAAGVDKIDPTEKNQCKQIRISREFCGCACEGYCDPEICACALAGIKCQVDRQNFPCGCSRDCCANPKGRIEFNPVRVHSHYIQTIMRMKAQKKDDDDMSRQHFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cysteine/serine-rich nuclear protein 2 Binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity (By similarity). May play a role in apoptosis.confidentQ9H175
Cysteine/serine-rich nuclear protein 2 Binds to the consensus sequence 5'-AGAGTG-3' and has transcriptional activator activity. May play a role in apoptosis.confidentQ8BGQ2

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0019902 [MF]phosphatase bindingprobableGO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0010923 [BP]negative regulation of phosphatase activityprobableGO:0051336, GO:0019220, GO:0051346, GO:0019222, GO:0065009, GO:0010921, GO:0050790, GO:0031323, GO:0050789, GO:0051174, GO:0065007, GO:0044092, GO:0008150, GO:0035303, GO:0050794, GO:0043086
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0043065 [BP]positive regulation of apoptotic processprobableGO:0050794, GO:0050789, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3HNA, chain A
Confidence level:probable
Coverage over the Query: 78-121
View the alignment between query and template
View the model in PyMOL