BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy516
(80 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1OCC|I Chain I, Structure Of Bovine Heart Cytochrome C Oxidase At The
Fully Oxidized State
pdb|1OCC|V Chain V, Structure Of Bovine Heart Cytochrome C Oxidase At The
Fully Oxidized State
pdb|2OCC|I Chain I, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|2OCC|V Chain V, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|1OCO|I Chain I, Bovine Heart Cytochrome C Oxidase In Carbon
Monoxide-bound State
pdb|1OCO|V Chain V, Bovine Heart Cytochrome C Oxidase In Carbon
Monoxide-bound State
pdb|1OCR|I Chain I, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
State
pdb|1OCR|V Chain V, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
State
pdb|1OCZ|I Chain I, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
pdb|1OCZ|V Chain V, Bovine Heart Cytochrome C Oxidase In Azide-Bound State
pdb|2YBB|T Chain T, Fitted Model For Bovine Mitochondrial Supercomplex
I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
Length = 73
Score = 63.9 bits (154), Expect = 2e-11, Method: Compositional matrix adjust.
Identities = 27/68 (39%), Positives = 43/68 (63%)
Query: 10 LPKPQLRNLLQSSIKVALVQGAVIAFGTAVAWKVLIMDPHKKAISEFYKTYDGEKDFERM 69
L KPQ+R LL ++ +V +++ G A +K + + KKA ++FY+ YD KDFE M
Sbjct: 4 LAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEM 63
Query: 70 KKAGLFEE 77
+KAG+F+
Sbjct: 64 RKAGIFQS 71
>pdb|2Y69|I Chain I, Bovine Heart Cytochrome C Oxidase Re-Refined With
Molecular Oxygen
pdb|2Y69|V Chain V, Bovine Heart Cytochrome C Oxidase Re-Refined With
Molecular Oxygen
Length = 74
Score = 63.9 bits (154), Expect = 2e-11, Method: Compositional matrix adjust.
Identities = 27/68 (39%), Positives = 43/68 (63%)
Query: 10 LPKPQLRNLLQSSIKVALVQGAVIAFGTAVAWKVLIMDPHKKAISEFYKTYDGEKDFERM 69
L KPQ+R LL ++ +V +++ G A +K + + KKA ++FY+ YD KDFE M
Sbjct: 5 LAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEM 64
Query: 70 KKAGLFEE 77
+KAG+F+
Sbjct: 65 RKAGIFQS 72
>pdb|1V54|I Chain I, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|1V54|V Chain V, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|1V55|I Chain I, Bovine Heart Cytochrome C Oxidase At The Fully Reduced
State
pdb|1V55|V Chain V, Bovine Heart Cytochrome C Oxidase At The Fully Reduced
State
pdb|2DYR|I Chain I, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|2DYR|V Chain V, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State
pdb|2DYS|I Chain I, Bovine Heart Cytochrome C Oxidase Modified By Dccd
pdb|2DYS|V Chain V, Bovine Heart Cytochrome C Oxidase Modified By Dccd
pdb|2EIJ|I Chain I, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
State
pdb|2EIJ|V Chain V, Bovine Heart Cytochrome C Oxidase In The Fully Reduced
State
pdb|2EIK|I Chain I, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
C Oxidase In The Fully Reduced State
pdb|2EIK|V Chain V, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
C Oxidase In The Fully Reduced State
pdb|2EIL|I Chain I, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
C Oxidase In The Fully Oxidized State
pdb|2EIL|V Chain V, Cadmium Ion Binding Structure Of Bovine Heart Cytochrome
C Oxidase In The Fully Oxidized State
pdb|2EIM|I Chain I, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
Oxidase In The Fully Reduced State
pdb|2EIM|V Chain V, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
Oxidase In The Fully Reduced State
pdb|2EIN|I Chain I, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
Oxidase In The Fully Oxidized State
pdb|2EIN|V Chain V, Zinc Ion Binding Structure Of Bovine Heart Cytochrome C
Oxidase In The Fully Oxidized State
pdb|2ZXW|I Chain I, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (1-S X-Ray Exposure Dataset)
pdb|2ZXW|V Chain V, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (1-S X-Ray Exposure Dataset)
pdb|3ABL|I Chain I, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (15-S X-Ray Exposure Dataset)
pdb|3ABL|V Chain V, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (15-S X-Ray Exposure Dataset)
pdb|3ABM|I Chain I, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (200-S X-Ray Exposure Dataset)
pdb|3ABM|V Chain V, Bovine Heart Cytochrome C Oxidase At The Fully Oxidized
State (200-S X-Ray Exposure Dataset)
pdb|3ABK|I Chain I, Bovine Heart Cytochrome C Oxidase At The No-Bound Fully
Reduced State (50k)
pdb|3ABK|V Chain V, Bovine Heart Cytochrome C Oxidase At The No-Bound Fully
Reduced State (50k)
pdb|3AG1|I Chain I, Bovine Heart Cytochrome C Oxidase In The Carbon
Monoxide-Bou Reduced State At 280 K
pdb|3AG1|V Chain V, Bovine Heart Cytochrome C Oxidase In The Carbon
Monoxide-Bou Reduced State At 280 K
pdb|3AG2|I Chain I, Bovine Heart Cytochrome C Oxidase In The Carbon
Monoxide-Bou Reduced State At 100 K
pdb|3AG2|V Chain V, Bovine Heart Cytochrome C Oxidase In The Carbon
Monoxide-Bou Reduced State At 100 K
pdb|3AG3|I Chain I, Bovine Heart Cytochrome C Oxidase In The Nitric
Oxide-Bound Reduced State At 100 K
pdb|3AG3|V Chain V, Bovine Heart Cytochrome C Oxidase In The Nitric
Oxide-Bound Reduced State At 100 K
pdb|3AG4|I Chain I, Bovine Heart Cytochrome C Oxidase In The Cyanide
Ion-Bound F Reduced State At 100 K
pdb|3AG4|V Chain V, Bovine Heart Cytochrome C Oxidase In The Cyanide
Ion-Bound F Reduced State At 100 K
pdb|3ASN|I Chain I, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
State Measured At 1.7470 Angstrom Wavelength
pdb|3ASN|V Chain V, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
State Measured At 1.7470 Angstrom Wavelength
pdb|3ASO|I Chain I, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
State Measured At 0.9 Angstrom Wavelength
pdb|3ASO|V Chain V, Bovine Heart Cytochrome C Oxidase In The Fully Oxidized
State Measured At 0.9 Angstrom Wavelength
Length = 73
Score = 63.9 bits (154), Expect = 2e-11, Method: Compositional matrix adjust.
Identities = 27/68 (39%), Positives = 43/68 (63%)
Query: 10 LPKPQLRNLLQSSIKVALVQGAVIAFGTAVAWKVLIMDPHKKAISEFYKTYDGEKDFERM 69
L KPQ+R LL ++ +V +++ G A +K + + KKA ++FY+ YD KDFE M
Sbjct: 4 LAKPQMRGLLARRLRFHIVGAFMVSLGFATFYKFAVAEKRKKAYADFYRNYDSMKDFEEM 63
Query: 70 KKAGLFEE 77
+KAG+F+
Sbjct: 64 RKAGIFQS 71
>pdb|2H9A|A Chain A, Corrinoid Iron-Sulfur Protein
pdb|2YCL|A Chain A, Complete Structure Of The Corrinoid,Iron-Sulfur Protein
Including The N-Terminal Domain With A 4fe-4s Cluster
Length = 445
Score = 27.3 bits (59), Expect = 2.1, Method: Compositional matrix adjust.
Identities = 13/25 (52%), Positives = 18/25 (72%), Gaps = 2/25 (8%)
Query: 37 TAVAWKVLIMDPHKKAISE--FYKT 59
TA+ +K LI+DP + ISE FY+T
Sbjct: 221 TALGYKNLILDPQPENISEGLFYQT 245
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.318 0.133 0.380
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,301,855
Number of Sequences: 62578
Number of extensions: 69828
Number of successful extensions: 212
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 3
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 209
Number of HSP's gapped (non-prelim): 4
length of query: 80
length of database: 14,973,337
effective HSP length: 49
effective length of query: 31
effective length of database: 11,907,015
effective search space: 369117465
effective search space used: 369117465
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 45 (21.9 bits)