BLAST Results

Query Summary

Your job contains 1 sequence.

Parameters
Threshold: 0.001
Maximum number of alignments shown: 100
BLAST filter: on

Query Sequence

>psy5165
MELEEAIRLYEVNHEPELVIHGNLWTWQWWNKFWRTWAPVPTLFGITIFIVWQYSRKLQH
RELVRKKRSYCKFLHISFTLHCYFIIFSEVFITYIKPDITYDRLQEEVKEMCKFSTDQVF
TVKWVDEEGDPCLISTQMELEEAIRLYEVNHEPELVIHGKSTYLISLHG

High Scoring Gene Products

Symbol, full name Information P value
prkci
Protein kinase C subspecies lambda/iota
protein from Xenopus laevis 6.2e-20
prkci
protein kinase C, iota
gene_product from Danio rerio 1.3e-19
PRKCI
Uncharacterized protein
protein from Gallus gallus 1.7e-19
PRKCI
Protein kinase C iota type
protein from Homo sapiens 6.0e-19
PRKCI
Protein kinase C iota type
protein from Pongo abelii 6.0e-19
PRKCI
Uncharacterized protein
protein from Bos taurus 7.6e-19
PRKCI
Uncharacterized protein
protein from Canis lupus familiaris 8.3e-19
Prkci
protein kinase C, iota
protein from Mus musculus 1.3e-18
Prkci
protein kinase C, iota
gene from Rattus norvegicus 1.3e-18
aPKC
atypical protein kinase C
protein from Drosophila melanogaster 4.6e-18
PRKCZ
Uncharacterized protein
protein from Gallus gallus 6.2e-16
PRKCZ
Uncharacterized protein
protein from Sus scrofa 5.7e-14
PRKCZ
Protein kinase C zeta type
protein from Homo sapiens 3.9e-13
Prkcz
protein kinase C, zeta
gene from Rattus norvegicus 1.7e-12
PRKCZ
Uncharacterized protein
protein from Canis lupus familiaris 3.7e-12
PRKCZ
Uncharacterized protein
protein from Canis lupus familiaris 3.7e-12
prkcz
protein kinase C, zeta
gene_product from Danio rerio 1.3e-11
Prkcz
protein kinase C, zeta
protein from Mus musculus 2.1e-11
PRKCZ
Protein kinase C, zeta
protein from Bos taurus 2.7e-11
PRKCZ
Protein kinase C zeta type
protein from Oryctolagus cuniculus 1.5e-10
pkc-3
Protein kinase C-like 3
protein from Caenorhabditis briggsae 1.5e-10
pkc-3 gene from Caenorhabditis elegans 4.1e-10
pkc-3
Protein kinase C-like 3
protein from Caenorhabditis elegans 4.1e-10
PRKCZ
Protein kinase C zeta type
protein from Homo sapiens 2.2e-09
PRKCI
Uncharacterized protein
protein from Sus scrofa 6.9e-05

The BLAST search returned 1 gene product which did not match your query constraints. Please see the full BLAST report below for the details.

Back to top

Raw Blast Data

BLASTP 2.0MP-WashU [04-May-2006] [linux26-i686-ILP32F64 2006-05-09T11:47:08]

Copyright (C) 1996-2006 Washington University, Saint Louis, Missouri USA.
All Rights Reserved.

Reference:  Gish, W. (1996-2006) http://blast.wustl.edu

Query=  psy5165
        (169 letters)

Database:  go_20130330-seqdb.fasta
           368,745 sequences; 169,044,731 total letters.
Searching....10....20....30....40....50....60....70....80....90....100% done

                                                                     Smallest
                                                                       Sum
                                                              High  Probability
Sequences producing High-scoring Segment Pairs:              Score  P(N)      N

UNIPROTKB|Q91569 - symbol:prkci "Protein kinase C subspec...   245  6.2e-20   1
ZFIN|ZDB-GENE-011105-1 - symbol:prkci "protein kinase C, ...   242  1.3e-19   1
UNIPROTKB|E1BWA3 - symbol:PRKCI "Uncharacterized protein"...   241  1.7e-19   1
UNIPROTKB|P41743 - symbol:PRKCI "Protein kinase C iota ty...   236  6.0e-19   1
UNIPROTKB|Q5R4K9 - symbol:PRKCI "Protein kinase C iota ty...   236  6.0e-19   1
UNIPROTKB|F1MQ96 - symbol:PRKCI "Uncharacterized protein"...   236  7.6e-19   1
UNIPROTKB|F1PG28 - symbol:PRKCI "Uncharacterized protein"...   236  8.3e-19   1
MGI|MGI:99260 - symbol:Prkci "protein kinase C, iota" spe...   233  1.3e-18   1
RGD|620961 - symbol:Prkci "protein kinase C, iota" specie...   233  1.3e-18   1
FB|FBgn0261854 - symbol:aPKC "atypical protein kinase C" ...   228  4.6e-18   1
UNIPROTKB|E1BQN6 - symbol:PRKCZ "Uncharacterized protein"...   208  6.2e-16   1
UNIPROTKB|I3LU84 - symbol:PRKCZ "Uncharacterized protein"...   187  5.7e-14   1
UNIPROTKB|Q05513 - symbol:PRKCZ "Protein kinase C zeta ty...   182  3.9e-13   1
UNIPROTKB|F1M9W5 - symbol:Prkcz "Protein kinase C zeta ty...   176  1.7e-12   1
RGD|3399 - symbol:Prkcz "protein kinase C, zeta" species:...   176  1.7e-12   1
UNIPROTKB|F6XMN6 - symbol:PRKCZ "Uncharacterized protein"...   173  3.7e-12   1
UNIPROTKB|E2R2T7 - symbol:PRKCZ "Uncharacterized protein"...   173  3.7e-12   1
ZFIN|ZDB-GENE-070511-1 - symbol:prkcz "protein kinase C, ...   168  1.3e-11   1
MGI|MGI:97602 - symbol:Prkcz "protein kinase C, zeta" spe...   166  2.1e-11   1
UNIPROTKB|A0JNH7 - symbol:PRKCZ "Uncharacterized protein"...   165  2.7e-11   1
UNIPROTKB|O19111 - symbol:PRKCZ "Protein kinase C zeta ty...   158  1.5e-10   1
UNIPROTKB|A8WUG4 - symbol:pkc-3 "Protein kinase C-like 3"...   158  1.5e-10   1
WB|WBGene00004034 - symbol:pkc-3 species:6239 "Caenorhabd...   154  4.1e-10   1
UNIPROTKB|Q19266 - symbol:pkc-3 "Protein kinase C-like 3"...   154  4.1e-10   1
UNIPROTKB|D6REZ8 - symbol:PRKCZ "Protein kinase C zeta ty...   137  2.2e-09   1
UNIPROTKB|F1SH28 - symbol:PRKCI "Uncharacterized protein"...   115  6.9e-05   1


>UNIPROTKB|Q91569 [details] [associations]
            symbol:prkci "Protein kinase C subspecies lambda/iota"
            species:8355 "Xenopus laevis" [GO:0004674 "protein serine/threonine
            kinase activity" evidence=ISS] [GO:0005543 "phospholipid binding"
            evidence=ISS] [GO:0005634 "nucleus" evidence=ISS] [GO:0005829
            "cytosol" evidence=ISS] [GO:0045216 "cell-cell junction
            organization" evidence=ISS] InterPro:IPR000270 InterPro:IPR000719
            InterPro:IPR000961 InterPro:IPR002219 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR012233
            InterPro:IPR017441 InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130
            Pfam:PF00433 Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
            PROSITE:PS51285 SMART:SM00109 SMART:SM00133 SMART:SM00220
            SMART:SM00666 GO:GO:0005829 GO:GO:0005524 GO:GO:0005634
            GO:GO:0005543 GO:GO:0035556 GO:GO:0046872 SUPFAM:SSF56112
            GO:GO:0004674 GO:GO:0008270 HOVERGEN:HBG108317 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:0045216 HSSP:P31751 KO:K06069 CTD:5584
            EMBL:U12588 RefSeq:NP_001084068.1 UniGene:Xl.967
            ProteinModelPortal:Q91569 SMR:Q91569 MINT:MINT-1205123
            GeneID:399287 KEGG:xla:399287 Xenbase:XB-GENE-864810 Uniprot:Q91569
        Length = 588

 Score = 245 (91.3 bits), Expect = 6.2e-20, P = 6.2e-20
 Identities = 41/70 (58%), Positives = 56/70 (80%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT+ +P IT+D L  EV++MC F  DQ FT+KW+DEEGDPC +S+Q+ELEEA RLYE
Sbjct:    28 DIMITHFEPSITFDGLCNEVRDMCSFENDQPFTMKWIDEEGDPCTVSSQLELEEAFRLYE 87

Query:   149 VNHEPELVIH 158
             +N + EL+IH
Sbjct:    88 LNKDSELLIH 97


>ZFIN|ZDB-GENE-011105-1 [details] [associations]
            symbol:prkci "protein kinase C, iota" species:7955
            "Danio rerio" [GO:0004672 "protein kinase activity" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA;ISS] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0006468 "protein phosphorylation" evidence=IEA] [GO:0035556
            "intracellular signal transduction" evidence=IEA] [GO:0016772
            "transferase activity, transferring phosphorus-containing groups"
            evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA]
            [GO:0016332 "establishment or maintenance of polarity of embryonic
            epithelium" evidence=IMP] [GO:0035050 "embryonic heart tube
            development" evidence=IMP] [GO:0001841 "neural tube formation"
            evidence=IGI] [GO:0060041 "retina development in camera-type eye"
            evidence=IMP] [GO:0031226 "intrinsic to plasma membrane"
            evidence=IDA] [GO:0042476 "odontogenesis" evidence=IMP] [GO:0004697
            "protein kinase C activity" evidence=IEA] [GO:0060042 "retina
            morphogenesis in camera-type eye" evidence=IGI;IMP] [GO:0007097
            "nuclear migration" evidence=IGI;IMP] [GO:0048699 "generation of
            neurons" evidence=IGI;IMP] [GO:0007420 "brain development"
            evidence=IMP] [GO:0007405 "neuroblast proliferation" evidence=IMP]
            [GO:0007507 "heart development" evidence=IMP] [GO:0005829 "cytosol"
            evidence=ISS] [GO:0005634 "nucleus" evidence=ISS] [GO:0045216
            "cell-cell junction organization" evidence=ISS] [GO:0005543
            "phospholipid binding" evidence=ISS] [GO:0007502 "digestive tract
            mesoderm development" evidence=IMP] [GO:0008078 "mesodermal cell
            migration" evidence=IMP] [GO:0000132 "establishment of mitotic
            spindle orientation" evidence=IMP] [GO:0048546 "digestive tract
            morphogenesis" evidence=IMP] [GO:0001738 "morphogenesis of a
            polarized epithelium" evidence=IMP] [GO:0034332 "adherens junction
            organization" evidence=IMP] [GO:0034334 "adherens junction
            maintenance" evidence=IMP] [GO:0005915 "zonula adherens"
            evidence=IDA] [GO:0016740 "transferase activity" evidence=IEA]
            [GO:0016301 "kinase activity" evidence=IEA] [GO:0000166 "nucleotide
            binding" evidence=IEA] [GO:0016310 "phosphorylation" evidence=IEA]
            [GO:0046872 "metal ion binding" evidence=IEA] [GO:0007275
            "multicellular organismal development" evidence=IEA] [GO:0045217
            "cell-cell junction maintenance" evidence=IMP] [GO:0021744 "dorsal
            motor nucleus of vagus nerve development" evidence=IMP] [GO:0045199
            "maintenance of epithelial cell apical/basal polarity"
            evidence=IMP] InterPro:IPR000270 InterPro:IPR000719
            InterPro:IPR000961 InterPro:IPR002219 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR012233
            InterPro:IPR017441 InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130
            Pfam:PF00433 Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
            PROSITE:PS51285 SMART:SM00109 SMART:SM00133 SMART:SM00220
            SMART:SM00666 ZFIN:ZDB-GENE-011105-1 GO:GO:0005829 GO:GO:0005524
            GO:GO:0005634 GO:GO:0000132 GO:GO:0005543 GO:GO:0035556
            GO:GO:0046872 eggNOG:COG0515 SUPFAM:SSF56112 GO:GO:0004674
            GO:GO:0008270 GO:GO:0031226 GO:GO:0007405 GO:GO:0001738
            HOGENOM:HOG000233033 HOVERGEN:HBG108317 GO:GO:0042476 GO:GO:0045199
            GO:GO:0008078 InterPro:IPR020454 PRINTS:PR00008 GO:GO:0005915
            GO:GO:0007097 GO:GO:0048546 GO:GO:0001841 GO:GO:0016332
            GO:GO:0045217 GO:GO:0035050 GO:GO:0004697 GO:GO:0034334
            GO:GO:0060042 GeneTree:ENSGT00700000104096 KO:K06069 OMA:RVKAYYK
            EMBL:AF390109 EMBL:BC047164 IPI:IPI00497308 RefSeq:NP_571930.2
            UniGene:Dr.2532 ProteinModelPortal:Q90XF2 SMR:Q90XF2 STRING:Q90XF2
            PRIDE:Q90XF2 Ensembl:ENSDART00000015723 GeneID:117507
            KEGG:dre:117507 CTD:5584 InParanoid:Q90XF2 OrthoDB:EOG4T782V
            NextBio:20796967 ArrayExpress:Q90XF2 Bgee:Q90XF2 GO:GO:0007502
            GO:GO:0021744 Uniprot:Q90XF2
        Length = 588

 Score = 242 (90.2 bits), Expect = 1.3e-19, P = 1.3e-19
 Identities = 39/70 (55%), Positives = 57/70 (81%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT+ +P I+Y+ L  EV++MC    DQ+FT+KW+DEEGDPC +S+Q+ELEEA+RLYE
Sbjct:    28 DIMITHFEPSISYEGLCNEVRDMCSMDNDQLFTMKWIDEEGDPCTVSSQLELEEALRLYE 87

Query:   149 VNHEPELVIH 158
             +N + EL+IH
Sbjct:    88 LNKDSELIIH 97


>UNIPROTKB|E1BWA3 [details] [associations]
            symbol:PRKCI "Uncharacterized protein" species:9031 "Gallus
            gallus" [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0035556
            "intracellular signal transduction" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0004697 "protein kinase C activity"
            evidence=IEA] [GO:0005543 "phospholipid binding" evidence=IEA]
            [GO:0005634 "nucleus" evidence=IEA] [GO:0005829 "cytosol"
            evidence=IEA] [GO:0007015 "actin filament organization"
            evidence=IEA] [GO:0010976 "positive regulation of neuron projection
            development" evidence=IEA] [GO:0016324 "apical plasma membrane"
            evidence=IEA] [GO:0032869 "cellular response to insulin stimulus"
            evidence=IEA] [GO:0034351 "negative regulation of glial cell
            apoptotic process" evidence=IEA] [GO:0035089 "establishment of
            apical/basal cell polarity" evidence=IEA] [GO:0042462 "eye
            photoreceptor cell development" evidence=IEA] [GO:0043220
            "Schmidt-Lanterman incisure" evidence=IEA] [GO:0043524 "negative
            regulation of neuron apoptotic process" evidence=IEA] [GO:0045216
            "cell-cell junction organization" evidence=IEA] [GO:0046326
            "positive regulation of glucose import" evidence=IEA] [GO:0051092
            "positive regulation of NF-kappaB transcription factor activity"
            evidence=IEA] [GO:0060252 "positive regulation of glial cell
            proliferation" evidence=IEA] [GO:0090004 "positive regulation of
            establishment of protein localization to plasma membrane"
            evidence=IEA] [GO:2000353 "positive regulation of endothelial cell
            apoptotic process" evidence=IEA] InterPro:IPR000270
            InterPro:IPR000719 InterPro:IPR000961 InterPro:IPR002219
            InterPro:IPR002290 InterPro:IPR008271 InterPro:IPR011009
            InterPro:IPR012233 InterPro:IPR017441 InterPro:IPR017892
            Pfam:PF00069 Pfam:PF00130 Pfam:PF00433 Pfam:PF00564
            PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS00479
            PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285 SMART:SM00109
            SMART:SM00133 SMART:SM00220 SMART:SM00666 GO:GO:0005829
            GO:GO:0005524 GO:GO:0005634 GO:GO:0007015 GO:GO:0005543
            GO:GO:0035556 GO:GO:0046872 GO:GO:0016324 SUPFAM:SSF56112
            GO:GO:0008270 GO:GO:0043524 GO:GO:0046326 GO:GO:0051092
            GO:GO:2000353 GO:GO:0090004 GO:GO:0043220 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:0045216 GO:GO:0004697 GO:GO:0035089
            GeneTree:ENSGT00700000104096 OMA:RVKAYYK GO:GO:0034351
            EMBL:AADN02021026 IPI:IPI00818490 ProteinModelPortal:E1BWA3
            Ensembl:ENSGALT00000039316 ArrayExpress:E1BWA3 Uniprot:E1BWA3
        Length = 599

 Score = 241 (89.9 bits), Expect = 1.7e-19, P = 1.7e-19
 Identities = 39/70 (55%), Positives = 57/70 (81%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ ITY +P I+++ L  EV++MC F  +Q+FT+KW+DEEGDPC +S+Q+ELEEA RLYE
Sbjct:    38 DIMITYFEPSISFEGLCSEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYE 97

Query:   149 VNHEPELVIH 158
             +N + EL+IH
Sbjct:    98 LNKDSELLIH 107


>UNIPROTKB|P41743 [details] [associations]
            symbol:PRKCI "Protein kinase C iota type" species:9606
            "Homo sapiens" [GO:0008270 "zinc ion binding" evidence=IEA]
            [GO:0035556 "intracellular signal transduction" evidence=IEA]
            [GO:0007015 "actin filament organization" evidence=IEA] [GO:0016324
            "apical plasma membrane" evidence=IEA] [GO:0016477 "cell migration"
            evidence=IEA] [GO:0019904 "protein domain specific binding"
            evidence=IEA] [GO:0031252 "cell leading edge" evidence=IEA]
            [GO:0035089 "establishment of apical/basal cell polarity"
            evidence=IEA] [GO:0042462 "eye photoreceptor cell development"
            evidence=IEA] [GO:0043220 "Schmidt-Lanterman incisure"
            evidence=IEA] [GO:0048194 "Golgi vesicle budding" evidence=IEA]
            [GO:0070555 "response to interleukin-1" evidence=IEA] [GO:0005768
            "endosome" evidence=IEA] [GO:0005634 "nucleus" evidence=IDA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IDA;TAS] [GO:0005524 "ATP binding" evidence=TAS]
            [GO:0005543 "phospholipid binding" evidence=IDA] [GO:0045216
            "cell-cell junction organization" evidence=IMP;TAS] [GO:0046903
            "secretion" evidence=NAS] [GO:0006612 "protein targeting to
            membrane" evidence=NAS] [GO:0000133 "polarisome" evidence=TAS]
            [GO:0045197 "establishment or maintenance of epithelial cell
            apical/basal polarity" evidence=TAS] [GO:0005829 "cytosol"
            evidence=IDA;TAS] [GO:0016192 "vesicle-mediated transport"
            evidence=TAS] [GO:0007010 "cytoskeleton organization" evidence=NAS]
            [GO:0016044 "cellular membrane organization" evidence=NAS]
            [GO:0006468 "protein phosphorylation" evidence=IDA] [GO:0005515
            "protein binding" evidence=IPI] [GO:0010976 "positive regulation of
            neuron projection development" evidence=IMP] [GO:0043524 "negative
            regulation of neuron apoptotic process" evidence=IDA] [GO:0051092
            "positive regulation of NF-kappaB transcription factor activity"
            evidence=IDA] [GO:0004672 "protein kinase activity" evidence=IDA]
            [GO:2000353 "positive regulation of endothelial cell apoptotic
            process" evidence=IMP] [GO:0034351 "negative regulation of glial
            cell apoptotic process" evidence=IMP] [GO:0060252 "positive
            regulation of glial cell proliferation" evidence=IMP] [GO:0005886
            "plasma membrane" evidence=TAS] [GO:0034329 "cell junction
            assembly" evidence=TAS] [GO:0048011 "neurotrophin TRK receptor
            signaling pathway" evidence=TAS] [GO:0070830 "tight junction
            assembly" evidence=TAS] [GO:0090004 "positive regulation of
            establishment of protein localization to plasma membrane"
            evidence=ISS] [GO:0046326 "positive regulation of glucose import"
            evidence=ISS] [GO:0032869 "cellular response to insulin stimulus"
            evidence=ISS] [GO:0004697 "protein kinase C activity" evidence=ISS]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR012233 InterPro:IPR017441
            InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130 Pfam:PF00433
            Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285
            SMART:SM00109 SMART:SM00133 SMART:SM00220 SMART:SM00666
            GO:GO:0005829 GO:GO:0005886 GO:GO:0005524 GO:GO:0005634
            Pathway_Interaction_DB:insulin_glucose_pathway
            Reactome:REACT_111102 GO:GO:0048011
            Pathway_Interaction_DB:p75ntrpathway GO:GO:0007010 GO:GO:0010976
            GO:GO:0007015 GO:GO:0016192 GO:GO:0032869 GO:GO:0005543
            GO:GO:0035556 GO:GO:0046872 GO:GO:0006612
            Pathway_Interaction_DB:insulin_pathway GO:GO:0016324 eggNOG:COG0515
            EMBL:CH471052 GO:GO:0005768 SUPFAM:SSF56112 GO:GO:0008270
            GO:GO:0043524 GO:GO:0046326 Pathway_Interaction_DB:trkrpathway
            Reactome:REACT_111155 Pathway_Interaction_DB:tnfpathway
            GO:GO:0051092 GO:GO:2000353 HOGENOM:HOG000233033 HOVERGEN:HBG108317
            GO:GO:0090004 GO:GO:0043220 GO:GO:0046903 GO:GO:0016044
            GO:GO:0070830 InterPro:IPR020454 PRINTS:PR00008 GO:GO:0000133
            Pathway_Interaction_DB:il1pathway GO:GO:0045197 GO:GO:0042462
            GO:GO:0004697 GO:GO:0060252 GO:GO:0035089 BRENDA:2.7.11.13
            KO:K06069 OMA:RVKAYYK GO:GO:0034351 CTD:5584 OrthoDB:EOG4T782V
            EMBL:L18964 EMBL:L33881 EMBL:BC022016 IPI:IPI00016639 PIR:A49509
            RefSeq:NP_002731.4 UniGene:Hs.478199 PDB:1VD2 PDB:1WMH PDB:1ZRZ
            PDB:3A8W PDB:3A8X PDBsum:1VD2 PDBsum:1WMH PDBsum:1ZRZ PDBsum:3A8W
            PDBsum:3A8X ProteinModelPortal:P41743 SMR:P41743 IntAct:P41743
            MINT:MINT-5004219 STRING:P41743 PhosphoSite:P41743 DMDM:239938658
            PaxDb:P41743 PRIDE:P41743 DNASU:5584 Ensembl:ENST00000295797
            GeneID:5584 KEGG:hsa:5584 UCSC:uc003fgs.2 GeneCards:GC03P169940
            HGNC:HGNC:9404 HPA:HPA026574 MIM:600539 neXtProt:NX_P41743
            PharmGKB:PA33768 InParanoid:P41743 BindingDB:P41743
            ChEMBL:CHEMBL2598 ChiTaRS:PRKCI EvolutionaryTrace:P41743
            GenomeRNAi:5584 NextBio:21656 Bgee:P41743 CleanEx:HS_PRKCI
            Genevestigator:P41743 Uniprot:P41743
        Length = 596

 Score = 236 (88.1 bits), Expect = 6.0e-19, P = 6.0e-19
 Identities = 38/70 (54%), Positives = 57/70 (81%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT+ +P I+++ L  EV++MC F  +Q+FT+KW+DEEGDPC +S+Q+ELEEA RLYE
Sbjct:    35 DIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYE 94

Query:   149 VNHEPELVIH 158
             +N + EL+IH
Sbjct:    95 LNKDSELLIH 104


>UNIPROTKB|Q5R4K9 [details] [associations]
            symbol:PRKCI "Protein kinase C iota type" species:9601
            "Pongo abelii" [GO:0004672 "protein kinase activity" evidence=ISS]
            [GO:0005634 "nucleus" evidence=ISS] [GO:0005829 "cytosol"
            evidence=ISS] [GO:0010976 "positive regulation of neuron projection
            development" evidence=ISS] [GO:0034351 "negative regulation of
            glial cell apoptotic process" evidence=ISS] [GO:0043524 "negative
            regulation of neuron apoptotic process" evidence=ISS] [GO:0051092
            "positive regulation of NF-kappaB transcription factor activity"
            evidence=ISS] [GO:0060252 "positive regulation of glial cell
            proliferation" evidence=ISS] [GO:2000353 "positive regulation of
            endothelial cell apoptotic process" evidence=ISS]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR012233 InterPro:IPR017441
            InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130 Pfam:PF00433
            Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285
            SMART:SM00109 SMART:SM00133 SMART:SM00220 SMART:SM00666
            GO:GO:0005829 GO:GO:0005524 GO:GO:0005634 GO:GO:0010976
            GO:GO:0016020 GO:GO:0035556 GO:GO:0046872 GO:GO:0005768
            SUPFAM:SSF56112 GO:GO:0008270 GO:GO:0043524 GO:GO:0004672
            GO:GO:0051092 GO:GO:2000353 HOVERGEN:HBG108317 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:0004697 GO:GO:0060252 KO:K06069 GO:GO:0034351
            CTD:5584 EMBL:CR861237 RefSeq:NP_001126946.1 UniGene:Pab.1649
            ProteinModelPortal:Q5R4K9 PRIDE:Q5R4K9 GeneID:100173964
            KEGG:pon:100173964 InParanoid:Q5R4K9 Uniprot:Q5R4K9
        Length = 596

 Score = 236 (88.1 bits), Expect = 6.0e-19, P = 6.0e-19
 Identities = 38/70 (54%), Positives = 57/70 (81%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT+ +P I+++ L  EV++MC F  +Q+FT+KW+DEEGDPC +S+Q+ELEEA RLYE
Sbjct:    35 DIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYE 94

Query:   149 VNHEPELVIH 158
             +N + EL+IH
Sbjct:    95 LNKDSELLIH 104


>UNIPROTKB|F1MQ96 [details] [associations]
            symbol:PRKCI "Uncharacterized protein" species:9913 "Bos
            taurus" [GO:2000353 "positive regulation of endothelial cell
            apoptotic process" evidence=IEA] [GO:0090004 "positive regulation
            of establishment of protein localization to plasma membrane"
            evidence=IEA] [GO:0060252 "positive regulation of glial cell
            proliferation" evidence=IEA] [GO:0051092 "positive regulation of
            NF-kappaB transcription factor activity" evidence=IEA] [GO:0046326
            "positive regulation of glucose import" evidence=IEA] [GO:0045216
            "cell-cell junction organization" evidence=IEA] [GO:0043524
            "negative regulation of neuron apoptotic process" evidence=IEA]
            [GO:0043220 "Schmidt-Lanterman incisure" evidence=IEA] [GO:0042462
            "eye photoreceptor cell development" evidence=IEA] [GO:0035089
            "establishment of apical/basal cell polarity" evidence=IEA]
            [GO:0034351 "negative regulation of glial cell apoptotic process"
            evidence=IEA] [GO:0032869 "cellular response to insulin stimulus"
            evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IEA]
            [GO:0010976 "positive regulation of neuron projection development"
            evidence=IEA] [GO:0007015 "actin filament organization"
            evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0005634
            "nucleus" evidence=IEA] [GO:0005543 "phospholipid binding"
            evidence=IEA] [GO:0004697 "protein kinase C activity" evidence=IEA]
            [GO:0046872 "metal ion binding" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0035556 "intracellular signal
            transduction" evidence=IEA] InterPro:IPR000270 InterPro:IPR000719
            InterPro:IPR000961 InterPro:IPR002219 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130 Pfam:PF00433
            Pfam:PF00564 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS00479
            PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285 SMART:SM00109
            SMART:SM00133 SMART:SM00220 SMART:SM00666 GO:GO:0005829
            GO:GO:0005524 GO:GO:0005634 GO:GO:0010976 GO:GO:0007015
            GO:GO:0005543 GO:GO:0035556 GO:GO:0046872 GO:GO:0016324
            SUPFAM:SSF56112 GO:GO:0043524 GO:GO:0046326 GO:GO:0051092
            GO:GO:2000353 GO:GO:0090004 GO:GO:0043220 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:0045216 GO:GO:0042462 GO:GO:0004697
            GO:GO:0060252 GO:GO:0035089 GeneTree:ENSGT00700000104096
            OMA:RVKAYYK GO:GO:0034351 EMBL:DAAA02002201 EMBL:DAAA02002202
            IPI:IPI00924236 Ensembl:ENSBTAT00000061563 ArrayExpress:F1MQ96
            Uniprot:F1MQ96
        Length = 672

 Score = 236 (88.1 bits), Expect = 7.6e-19, P = 7.6e-19
 Identities = 38/70 (54%), Positives = 57/70 (81%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT+ +P I+++ L  EV++MC F  +Q+FT+KW+DEEGDPC +S+Q+ELEEA RLYE
Sbjct:   111 DIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYE 170

Query:   149 VNHEPELVIH 158
             +N + EL+IH
Sbjct:   171 LNKDSELLIH 180


>UNIPROTKB|F1PG28 [details] [associations]
            symbol:PRKCI "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0046872 "metal ion binding" evidence=IEA]
            [GO:0005524 "ATP binding" evidence=IEA] [GO:0004674 "protein
            serine/threonine kinase activity" evidence=IEA] [GO:0035556
            "intracellular signal transduction" evidence=IEA]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR017441 InterPro:IPR017892
            Pfam:PF00069 Pfam:PF00130 Pfam:PF00433 Pfam:PF00564 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
            PROSITE:PS51285 SMART:SM00109 SMART:SM00133 SMART:SM00220
            SMART:SM00666 GO:GO:0005524 GO:GO:0035556 GO:GO:0046872
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0005622 InterPro:IPR020454
            PRINTS:PR00008 GeneTree:ENSGT00700000104096 OMA:TPPYKPR
            EMBL:AAEX03017373 Ensembl:ENSCAFT00000023541 Uniprot:F1PG28
        Length = 703

 Score = 236 (88.1 bits), Expect = 8.3e-19, P = 8.3e-19
 Identities = 38/70 (54%), Positives = 57/70 (81%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT+ +P I+++ L  EV++MC F  +Q+FT+KW+DEEGDPC +S+Q+ELEEA RLYE
Sbjct:   142 DIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYE 201

Query:   149 VNHEPELVIH 158
             +N + EL+IH
Sbjct:   202 LNKDSELLIH 211


>MGI|MGI:99260 [details] [associations]
            symbol:Prkci "protein kinase C, iota" species:10090 "Mus
            musculus" [GO:0000166 "nucleotide binding" evidence=IEA]
            [GO:0004672 "protein kinase activity" evidence=ISO] [GO:0004674
            "protein serine/threonine kinase activity" evidence=ISO]
            [GO:0004697 "protein kinase C activity" evidence=ISO;IDA]
            [GO:0005524 "ATP binding" evidence=ISO] [GO:0005543 "phospholipid
            binding" evidence=ISO] [GO:0005634 "nucleus" evidence=ISO;IDA]
            [GO:0005737 "cytoplasm" evidence=IDA] [GO:0005768 "endosome"
            evidence=IEA] [GO:0005829 "cytosol" evidence=ISO] [GO:0005886
            "plasma membrane" evidence=ISO] [GO:0005923 "tight junction"
            evidence=ISO] [GO:0006468 "protein phosphorylation"
            evidence=ISO;IDA] [GO:0007015 "actin filament organization"
            evidence=IMP] [GO:0007275 "multicellular organismal development"
            evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA]
            [GO:0010976 "positive regulation of neuron projection development"
            evidence=ISO] [GO:0016020 "membrane" evidence=IEA] [GO:0016301
            "kinase activity" evidence=IEA] [GO:0016310 "phosphorylation"
            evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IDA]
            [GO:0016477 "cell migration" evidence=ISO] [GO:0016740 "transferase
            activity" evidence=IEA] [GO:0016772 "transferase activity,
            transferring phosphorus-containing groups" evidence=IEA]
            [GO:0019904 "protein domain specific binding" evidence=ISO]
            [GO:0031252 "cell leading edge" evidence=ISO] [GO:0032869 "cellular
            response to insulin stimulus" evidence=ISO;IMP] [GO:0034351
            "negative regulation of glial cell apoptotic process" evidence=ISO]
            [GO:0034613 "cellular protein localization" evidence=ISO]
            [GO:0035089 "establishment of apical/basal cell polarity"
            evidence=IMP] [GO:0035556 "intracellular signal transduction"
            evidence=IEA] [GO:0042462 "eye photoreceptor cell development"
            evidence=IMP] [GO:0043220 "Schmidt-Lanterman incisure"
            evidence=IDA] [GO:0043234 "protein complex" evidence=ISO]
            [GO:0043434 "response to peptide hormone stimulus" evidence=ISO]
            [GO:0043524 "negative regulation of neuron apoptotic process"
            evidence=ISO] [GO:0045177 "apical part of cell" evidence=IDA]
            [GO:0045216 "cell-cell junction organization" evidence=ISO]
            [GO:0046326 "positive regulation of glucose import" evidence=IMP]
            [GO:0046872 "metal ion binding" evidence=IEA] [GO:0048194 "Golgi
            vesicle budding" evidence=ISO] [GO:0051092 "positive regulation of
            NF-kappaB transcription factor activity" evidence=ISO] [GO:0060252
            "positive regulation of glial cell proliferation" evidence=ISO]
            [GO:0070555 "response to interleukin-1" evidence=ISO] [GO:0090004
            "positive regulation of establishment of protein localization to
            plasma membrane" evidence=IMP] [GO:2000353 "positive regulation of
            endothelial cell apoptotic process" evidence=ISO]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR012233 InterPro:IPR017441
            InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130 Pfam:PF00433
            Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285
            SMART:SM00109 SMART:SM00133 SMART:SM00220 SMART:SM00666
            MGI:MGI:99260 GO:GO:0005829 GO:GO:0005524 GO:GO:0005634
            GO:GO:0010976 GO:GO:0007015 GO:GO:0032869 GO:GO:0005543
            GO:GO:0035556 GO:GO:0046872 GO:GO:0016324 eggNOG:COG0515
            GO:GO:0005768 SUPFAM:SSF56112 GO:GO:0008270 GO:GO:0043524
            GO:GO:0046326 GO:GO:0051092 GO:GO:2000353 HOGENOM:HOG000233033
            HOVERGEN:HBG108317 GO:GO:0090004 GO:GO:0043220 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:0045216 GO:GO:0042462 GO:GO:0004697
            GO:GO:0060252 GO:GO:0035089 BRENDA:2.7.11.13
            GeneTree:ENSGT00700000104096 KO:K06069 OMA:RVKAYYK GO:GO:0034351
            CTD:5584 OrthoDB:EOG4T782V EMBL:D28577 EMBL:BC021630
            IPI:IPI00121084 PIR:A53758 RefSeq:NP_032883.2 UniGene:Mm.291554
            PDB:4DC2 PDBsum:4DC2 ProteinModelPortal:Q62074 SMR:Q62074
            DIP:DIP-32555N IntAct:Q62074 STRING:Q62074 PhosphoSite:Q62074
            PaxDb:Q62074 PRIDE:Q62074 Ensembl:ENSMUST00000108249 GeneID:18759
            KEGG:mmu:18759 InParanoid:Q62074 NextBio:294941 Bgee:Q62074
            CleanEx:MM_PRKCI Genevestigator:Q62074
            GermOnline:ENSMUSG00000037643 Uniprot:Q62074
        Length = 595

 Score = 233 (87.1 bits), Expect = 1.3e-18, P = 1.3e-18
 Identities = 38/70 (54%), Positives = 56/70 (80%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT+ +P I+++ L  EV++MC F  +Q FT+KW+DEEGDPC +S+Q+ELEEA RLYE
Sbjct:    35 DIMITHFEPSISFEGLCSEVRDMCSFDNEQPFTMKWIDEEGDPCTVSSQLELEEAFRLYE 94

Query:   149 VNHEPELVIH 158
             +N + EL+IH
Sbjct:    95 LNKDSELLIH 104


>RGD|620961 [details] [associations]
            symbol:Prkci "protein kinase C, iota" species:10116 "Rattus
            norvegicus" [GO:0003674 "molecular_function" evidence=ND]
            [GO:0004672 "protein kinase activity" evidence=ISO;ISS] [GO:0004674
            "protein serine/threonine kinase activity" evidence=ISO]
            [GO:0004697 "protein kinase C activity" evidence=ISO;IDA]
            [GO:0005524 "ATP binding" evidence=IDA] [GO:0005543 "phospholipid
            binding" evidence=IEA;ISO] [GO:0005634 "nucleus" evidence=ISO;ISS]
            [GO:0005737 "cytoplasm" evidence=ISO] [GO:0005768 "endosome"
            evidence=IEA] [GO:0005829 "cytosol" evidence=ISO;ISS;IDA]
            [GO:0005886 "plasma membrane" evidence=IDA] [GO:0006468 "protein
            phosphorylation" evidence=ISO;IDA] [GO:0007015 "actin filament
            organization" evidence=IEA;ISO] [GO:0008270 "zinc ion binding"
            evidence=IEA] [GO:0010976 "positive regulation of neuron projection
            development" evidence=ISO;ISS] [GO:0016324 "apical plasma membrane"
            evidence=IEA;ISO] [GO:0016477 "cell migration" evidence=IMP]
            [GO:0019904 "protein domain specific binding" evidence=IPI]
            [GO:0031252 "cell leading edge" evidence=IDA] [GO:0032869 "cellular
            response to insulin stimulus" evidence=ISO;IMP] [GO:0034351
            "negative regulation of glial cell apoptotic process"
            evidence=ISO;ISS] [GO:0034613 "cellular protein localization"
            evidence=IMP] [GO:0035089 "establishment of apical/basal cell
            polarity" evidence=IEA;ISO] [GO:0035556 "intracellular signal
            transduction" evidence=IEA] [GO:0042462 "eye photoreceptor cell
            development" evidence=IEA;ISO] [GO:0043220 "Schmidt-Lanterman
            incisure" evidence=IEA;ISO] [GO:0043234 "protein complex"
            evidence=IDA] [GO:0043434 "response to peptide hormone stimulus"
            evidence=IDA] [GO:0043524 "negative regulation of neuron apoptotic
            process" evidence=ISO;ISS] [GO:0045177 "apical part of cell"
            evidence=ISO] [GO:0045216 "cell-cell junction organization"
            evidence=IEA;ISO] [GO:0046326 "positive regulation of glucose
            import" evidence=IEA;ISO] [GO:0048194 "Golgi vesicle budding"
            evidence=IDA] [GO:0051092 "positive regulation of NF-kappaB
            transcription factor activity" evidence=ISO;ISS] [GO:0060252
            "positive regulation of glial cell proliferation" evidence=ISO;ISS]
            [GO:0070555 "response to interleukin-1" evidence=IMP] [GO:0090004
            "positive regulation of establishment of protein localization to
            plasma membrane" evidence=IEA;ISO] [GO:2000353 "positive regulation
            of endothelial cell apoptotic process" evidence=ISO;ISS]
            [GO:0005923 "tight junction" evidence=IDA] InterPro:IPR000270
            InterPro:IPR000719 InterPro:IPR000961 InterPro:IPR002219
            InterPro:IPR002290 InterPro:IPR008271 InterPro:IPR011009
            InterPro:IPR012233 InterPro:IPR017441 InterPro:IPR017892
            Pfam:PF00069 Pfam:PF00130 Pfam:PF00433 Pfam:PF00564
            PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108 PROSITE:PS00479
            PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285 SMART:SM00109
            SMART:SM00133 SMART:SM00220 SMART:SM00666 RGD:620961 GO:GO:0005829
            GO:GO:0005886 GO:GO:0005524 GO:GO:0005634 GO:GO:0043234
            GO:GO:0031252 GO:GO:0010976 GO:GO:0034613 GO:GO:0016477
            GO:GO:0032869 GO:GO:0035556 GO:GO:0046872 eggNOG:COG0515
            GO:GO:0005768 SUPFAM:SSF56112 GO:GO:0008270 GO:GO:0043524
            GO:GO:0051092 GO:GO:0070555 GO:GO:2000353 HOGENOM:HOG000233033
            HOVERGEN:HBG108317 GO:GO:0048194 InterPro:IPR020454 PRINTS:PR00008
            GO:GO:0004697 GO:GO:0060252 GeneTree:ENSGT00700000104096 KO:K06069
            GO:GO:0034351 CTD:5584 OrthoDB:EOG4T782V EMBL:EU517502
            IPI:IPI00914259 RefSeq:NP_114448.1 UniGene:Rn.1388 PRIDE:F1M7Y5
            Ensembl:ENSRNOT00000012924 GeneID:84006 KEGG:rno:84006
            UCSC:RGD:620961 NextBio:616517 ArrayExpress:F1M7Y5 Uniprot:F1M7Y5
        Length = 596

 Score = 233 (87.1 bits), Expect = 1.3e-18, P = 1.3e-18
 Identities = 38/70 (54%), Positives = 56/70 (80%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT+ +P I+++ L  EV++MC F  +Q FT+KW+DEEGDPC +S+Q+ELEEA RLYE
Sbjct:    35 DIMITHFEPSISFEGLCSEVRDMCSFDNEQPFTMKWIDEEGDPCTVSSQLELEEAFRLYE 94

Query:   149 VNHEPELVIH 158
             +N + EL+IH
Sbjct:    95 LNKDSELLIH 104


>FB|FBgn0261854 [details] [associations]
            symbol:aPKC "atypical protein kinase C" species:7227
            "Drosophila melanogaster" [GO:0004697 "protein kinase C activity"
            evidence=NAS] [GO:0006468 "protein phosphorylation"
            evidence=IEA;NAS] [GO:0004674 "protein serine/threonine kinase
            activity" evidence=IDA;NAS] [GO:0045186 "zonula adherens assembly"
            evidence=NAS;TAS] [GO:0016332 "establishment or maintenance of
            polarity of embryonic epithelium" evidence=IMP;NAS] [GO:0045179
            "apical cortex" evidence=IDA;NAS] [GO:0045197 "establishment or
            maintenance of epithelial cell apical/basal polarity"
            evidence=IMP;NAS;TAS] [GO:0045196 "establishment or maintenance of
            neuroblast polarity" evidence=IMP;NAS] [GO:0007294
            "germarium-derived oocyte fate determination" evidence=IMP]
            [GO:0007613 "memory" evidence=IMP] [GO:0035003 "subapical complex"
            evidence=TAS] [GO:0055059 "asymmetric neuroblast division"
            evidence=IGI] [GO:0007043 "cell-cell junction assembly"
            evidence=NAS] [GO:0016324 "apical plasma membrane"
            evidence=NAS;TAS] [GO:0045176 "apical protein localization"
            evidence=NAS] [GO:0045167 "asymmetric protein localization involved
            in cell fate determination" evidence=IPI] [GO:0007309 "oocyte axis
            specification" evidence=TAS] [GO:0007163 "establishment or
            maintenance of cell polarity" evidence=NAS] [GO:0001738
            "morphogenesis of a polarized epithelium" evidence=TAS] [GO:0030011
            "maintenance of cell polarity" evidence=IMP] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0035556 "intracellular signal
            transduction" evidence=IEA] [GO:0008270 "zinc ion binding"
            evidence=IEA] [GO:0005938 "cell cortex" evidence=TAS] [GO:0007416
            "synapse assembly" evidence=IMP] [GO:0005515 "protein binding"
            evidence=IPI] [GO:0016327 "apicolateral plasma membrane"
            evidence=IDA] [GO:0007423 "sensory organ development" evidence=IMP]
            [GO:0007314 "oocyte anterior/posterior axis specification"
            evidence=IGI] [GO:0002052 "positive regulation of neuroblast
            proliferation" evidence=IMP] [GO:0046667 "compound eye retinal cell
            programmed cell death" evidence=IDA] [GO:0016334 "establishment or
            maintenance of polarity of follicular epithelium" evidence=IMP]
            [GO:0090163 "establishment of epithelial cell planar polarity"
            evidence=IGI;IMP] [GO:0003382 "epithelial cell morphogenesis"
            evidence=IGI;IMP] [GO:0010592 "positive regulation of lamellipodium
            assembly" evidence=IMP] [GO:0051491 "positive regulation of
            filopodium assembly" evidence=IMP] [GO:0060446 "branching involved
            in open tracheal system development" evidence=IMP] [GO:0035011
            "melanotic encapsulation of foreign target" evidence=IMP]
            [GO:0000132 "establishment of mitotic spindle orientation"
            evidence=IMP] InterPro:IPR000270 InterPro:IPR000719
            InterPro:IPR000961 InterPro:IPR002219 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR012233
            InterPro:IPR017441 InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130
            Pfam:PF00433 Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
            PROSITE:PS51285 SMART:SM00109 SMART:SM00133 SMART:SM00220
            SMART:SM00666 EMBL:AE013599 GO:GO:0005524 GO:GO:0045167
            GO:GO:0000132 GO:GO:0007294 GO:GO:0035556 GO:GO:0046872
            GO:GO:0016324 GO:GO:0007613 SUPFAM:SSF56112 GO:GO:0004674
            GO:GO:0008270 GO:GO:0003382 GO:GO:0045179 GO:GO:0007416
            GO:GO:0001738 InterPro:IPR020454 PRINTS:PR00008 GO:GO:0016327
            GO:GO:0046667 GO:GO:0045186 GO:GO:0002052 GO:GO:0030011
            GO:GO:0007314 GO:GO:0035003 GO:GO:0045176 GO:GO:0060446
            GO:GO:0035011 GO:GO:0045197 GO:GO:0016332 GO:GO:0016334
            GO:GO:0004697 GO:GO:0045196 GO:GO:0090163
            GeneTree:ENSGT00700000104096 KO:K06069 OMA:RVKAYYK UniGene:Dm.1507
            GeneID:47594 KEGG:dme:Dmel_CG42783 CTD:47594 FlyBase:FBgn0261854
            GenomeRNAi:47594 NextBio:839044 RefSeq:NP_001036545.1
            ProteinModelPortal:Q0E974 SMR:Q0E974 IntAct:Q0E974 STRING:Q0E974
            PRIDE:Q0E974 EnsemblMetazoa:FBtr0303431 UCSC:CG10261-RD
            PhylomeDB:Q0E974 Bgee:Q0E974 Uniprot:Q0E974
        Length = 608

 Score = 228 (85.3 bits), Expect = 4.6e-18, P = 4.6e-18
 Identities = 40/70 (57%), Positives = 55/70 (78%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT I  +I+Y+ L  E++ +C+F  DQ FT+KWVDEE DPC IST+MEL+EAIRLYE
Sbjct:    40 QIIITTINKNISYEELCYEIRNICRFPLDQPFTIKWVDEENDPCTISTKMELDEAIRLYE 99

Query:   149 VNHEPELVIH 158
             +N + +LVIH
Sbjct:   100 MNFDSQLVIH 109


>UNIPROTKB|E1BQN6 [details] [associations]
            symbol:PRKCZ "Uncharacterized protein" species:9031 "Gallus
            gallus" [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0035556
            "intracellular signal transduction" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0000226 "microtubule cytoskeleton
            organization" evidence=IEA] [GO:0004674 "protein serine/threonine
            kinase activity" evidence=IEA] [GO:0005635 "nuclear envelope"
            evidence=IEA] [GO:0005923 "tight junction" evidence=IEA]
            [GO:0016324 "apical plasma membrane" evidence=IEA] [GO:0016363
            "nuclear matrix" evidence=IEA] [GO:0018105 "peptidyl-serine
            phosphorylation" evidence=IEA] [GO:0031333 "negative regulation of
            protein complex assembly" evidence=IEA] [GO:0032753 "positive
            regulation of interleukin-4 production" evidence=IEA] [GO:0035748
            "myelin sheath abaxonal region" evidence=IEA] [GO:0043234 "protein
            complex" evidence=IEA] [GO:0045179 "apical cortex" evidence=IEA]
            [GO:0045630 "positive regulation of T-helper 2 cell
            differentiation" evidence=IEA] [GO:0046627 "negative regulation of
            insulin receptor signaling pathway" evidence=IEA] [GO:0050732
            "negative regulation of peptidyl-tyrosine phosphorylation"
            evidence=IEA] [GO:0070374 "positive regulation of ERK1 and ERK2
            cascade" evidence=IEA] [GO:0072659 "protein localization to plasma
            membrane" evidence=IEA] [GO:2000553 "positive regulation of
            T-helper 2 cell cytokine production" evidence=IEA] [GO:2000664
            "positive regulation of interleukin-5 secretion" evidence=IEA]
            [GO:2000667 "positive regulation of interleukin-13 secretion"
            evidence=IEA] [GO:2001181 "positive regulation of interleukin-10
            secretion" evidence=IEA] InterPro:IPR000270 InterPro:IPR000719
            InterPro:IPR000961 InterPro:IPR002219 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR012233
            InterPro:IPR017441 InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130
            Pfam:PF00433 Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
            PROSITE:PS51285 SMART:SM00109 SMART:SM00133 SMART:SM00220
            SMART:SM00666 GO:GO:0005524 GO:GO:0005635 GO:GO:0043234
            GO:GO:0000226 GO:GO:0035556 GO:GO:0046872 GO:GO:0031333
            GO:GO:0016324 SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0008270
            GO:GO:0070374 GO:GO:0018105 GO:GO:0045179 GO:GO:0005923
            GO:GO:0072659 GO:GO:0016363 GO:GO:0046627 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:2001181 GO:GO:0032753 GO:GO:0045630
            GO:GO:0035748 GO:GO:2000667 GO:GO:2000664
            GeneTree:ENSGT00700000104096 KO:K06069 GO:GO:0050732 CTD:5590
            OMA:RCHVLVP GO:GO:2000553 EMBL:AADN02040874 IPI:IPI00580360
            RefSeq:XP_417561.3 ProteinModelPortal:E1BQN6
            Ensembl:ENSGALT00000001938 GeneID:419399 KEGG:gga:419399
            Uniprot:E1BQN6
        Length = 592

 Score = 208 (78.3 bits), Expect = 6.2e-16, P = 6.2e-16
 Identities = 38/70 (54%), Positives = 50/70 (71%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT +   I+YD L +EV+EMC    +Q  T+KW+D+EGDPC IS+QMELEEA RLY 
Sbjct:    25 DILITNLDAYISYDELCDEVREMCNLQQEQPITLKWIDDEGDPCTISSQMELEEAFRLYC 84

Query:   149 VNHEPELVIH 158
              N E  L+IH
Sbjct:    85 QNREEGLIIH 94


>UNIPROTKB|I3LU84 [details] [associations]
            symbol:PRKCZ "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:2001181 "positive regulation of interleukin-10
            secretion" evidence=IEA] [GO:2000667 "positive regulation of
            interleukin-13 secretion" evidence=IEA] [GO:2000664 "positive
            regulation of interleukin-5 secretion" evidence=IEA] [GO:2000553
            "positive regulation of T-helper 2 cell cytokine production"
            evidence=IEA] [GO:0072659 "protein localization to plasma membrane"
            evidence=IEA] [GO:0070374 "positive regulation of ERK1 and ERK2
            cascade" evidence=IEA] [GO:0050732 "negative regulation of
            peptidyl-tyrosine phosphorylation" evidence=IEA] [GO:0046627
            "negative regulation of insulin receptor signaling pathway"
            evidence=IEA] [GO:0045630 "positive regulation of T-helper 2 cell
            differentiation" evidence=IEA] [GO:0045179 "apical cortex"
            evidence=IEA] [GO:0043234 "protein complex" evidence=IEA]
            [GO:0035748 "myelin sheath abaxonal region" evidence=IEA]
            [GO:0032753 "positive regulation of interleukin-4 production"
            evidence=IEA] [GO:0031333 "negative regulation of protein complex
            assembly" evidence=IEA] [GO:0018105 "peptidyl-serine
            phosphorylation" evidence=IEA] [GO:0016363 "nuclear matrix"
            evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IEA]
            [GO:0005923 "tight junction" evidence=IEA] [GO:0005635 "nuclear
            envelope" evidence=IEA] [GO:0004674 "protein serine/threonine
            kinase activity" evidence=IEA] [GO:0000226 "microtubule
            cytoskeleton organization" evidence=IEA] [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA]
            [GO:0035556 "intracellular signal transduction" evidence=IEA]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR002219
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR017441
            Pfam:PF00069 Pfam:PF00130 Pfam:PF00564 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
            SMART:SM00109 SMART:SM00666 GO:GO:0005524 GO:GO:0005635
            GO:GO:0043234 GO:GO:0000226 GO:GO:0035556 GO:GO:0046872
            GO:GO:0031333 GO:GO:0016324 SUPFAM:SSF56112 GO:GO:0004674
            GO:GO:0070374 GO:GO:0018105 GO:GO:0045179 GO:GO:0005923
            GO:GO:0072659 GO:GO:0016363 GO:GO:0046627 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:2001181 GO:GO:0032753 GO:GO:0045630
            GO:GO:0035748 GO:GO:2000667 GO:GO:2000664
            GeneTree:ENSGT00700000104096 GO:GO:0050732 GO:GO:2000553
            EMBL:FP565922 Ensembl:ENSSSCT00000032230 OMA:DEVESWP Uniprot:I3LU84
        Length = 422

 Score = 187 (70.9 bits), Expect = 5.7e-14, P = 5.7e-14
 Identities = 35/70 (50%), Positives = 46/70 (65%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT +    T++ L EEV+EMC  S D   T+KWVD EGDPC +S+QMELEEA RL  
Sbjct:    25 DILITSLDSATTFEELCEEVREMCCLSRDHPLTLKWVDSEGDPCTVSSQMELEEAFRLSS 84

Query:   149 VNHEPELVIH 158
                +  L+IH
Sbjct:    85 QRRDEGLIIH 94


>UNIPROTKB|Q05513 [details] [associations]
            symbol:PRKCZ "Protein kinase C zeta type" species:9606
            "Homo sapiens" [GO:0008270 "zinc ion binding" evidence=IEA]
            [GO:0006954 "inflammatory response" evidence=IEA] [GO:0004697
            "protein kinase C activity" evidence=IEA] [GO:0000226 "microtubule
            cytoskeleton organization" evidence=IEA] [GO:0001954 "positive
            regulation of cell-matrix adhesion" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0005635 "nuclear envelope" evidence=IEA]
            [GO:0005829 "cytosol" evidence=IEA] [GO:0005923 "tight junction"
            evidence=IEA] [GO:0007616 "long-term memory" evidence=IEA]
            [GO:0008284 "positive regulation of cell proliferation"
            evidence=IEA] [GO:0008286 "insulin receptor signaling pathway"
            evidence=IEA] [GO:0015459 "potassium channel regulator activity"
            evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IEA]
            [GO:0016363 "nuclear matrix" evidence=IEA] [GO:0016477 "cell
            migration" evidence=IEA] [GO:0019901 "protein kinase binding"
            evidence=IEA] [GO:0019904 "protein domain specific binding"
            evidence=IEA] [GO:0031252 "cell leading edge" evidence=IEA]
            [GO:0031532 "actin cytoskeleton reorganization" evidence=IEA]
            [GO:0031584 "activation of phospholipase D activity" evidence=IEA]
            [GO:0032148 "activation of protein kinase B activity" evidence=IEA]
            [GO:0035748 "myelin sheath abaxonal region" evidence=IEA]
            [GO:0043066 "negative regulation of apoptotic process"
            evidence=IEA] [GO:0043234 "protein complex" evidence=IEA]
            [GO:0043274 "phospholipase binding" evidence=IEA] [GO:0045121
            "membrane raft" evidence=IEA] [GO:0045179 "apical cortex"
            evidence=IEA] [GO:0046326 "positive regulation of glucose import"
            evidence=IEA] [GO:0047496 "vesicle transport along microtubule"
            evidence=IEA] [GO:0048471 "perinuclear region of cytoplasm"
            evidence=IEA] [GO:0051291 "protein heterooligomerization"
            evidence=IEA] [GO:0051346 "negative regulation of hydrolase
            activity" evidence=IEA] [GO:0060081 "membrane hyperpolarization"
            evidence=IEA] [GO:0070528 "protein kinase C signaling cascade"
            evidence=IEA] [GO:0071889 "14-3-3 protein binding" evidence=IEA]
            [GO:0072659 "protein localization to plasma membrane" evidence=IEA]
            [GO:0005768 "endosome" evidence=IEA] [GO:0005515 "protein binding"
            evidence=IPI] [GO:0005911 "cell-cell junction" evidence=IDA]
            [GO:0004672 "protein kinase activity" evidence=IDA] [GO:0006468
            "protein phosphorylation" evidence=IDA] [GO:0070374 "positive
            regulation of ERK1 and ERK2 cascade" evidence=IMP] [GO:0032753
            "positive regulation of interleukin-4 production" evidence=ISS]
            [GO:0045630 "positive regulation of T-helper 2 cell
            differentiation" evidence=ISS] [GO:2000553 "positive regulation of
            T-helper 2 cell cytokine production" evidence=ISS] [GO:2000664
            "positive regulation of interleukin-5 secretion" evidence=ISS]
            [GO:2000667 "positive regulation of interleukin-13 secretion"
            evidence=ISS] [GO:2001181 "positive regulation of interleukin-10
            secretion" evidence=ISS] [GO:0030010 "establishment of cell
            polarity" evidence=ISS] [GO:0046628 "positive regulation of insulin
            receptor signaling pathway" evidence=ISS] [GO:0051092 "positive
            regulation of NF-kappaB transcription factor activity"
            evidence=ISS] [GO:0060291 "long-term synaptic potentiation"
            evidence=ISS] [GO:2000463 "positive regulation of excitatory
            postsynaptic membrane potential" evidence=ISS] [GO:0005886 "plasma
            membrane" evidence=TAS] [GO:0016020 "membrane" evidence=TAS]
            [GO:0005737 "cytoplasm" evidence=TAS] [GO:0007165 "signal
            transduction" evidence=TAS] [GO:0007179 "transforming growth factor
            beta receptor signaling pathway" evidence=TAS] [GO:0007596 "blood
            coagulation" evidence=TAS] [GO:0030054 "cell junction"
            evidence=TAS] [GO:0030168 "platelet activation" evidence=TAS]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IDA] [GO:0043560 "insulin receptor substrate binding"
            evidence=IC] [GO:0046627 "negative regulation of insulin receptor
            signaling pathway" evidence=IMP] [GO:0050732 "negative regulation
            of peptidyl-tyrosine phosphorylation" evidence=IMP] [GO:0031333
            "negative regulation of protein complex assembly" evidence=IMP]
            [GO:0018105 "peptidyl-serine phosphorylation" evidence=IDA]
            Reactome:REACT_604 InterPro:IPR000270 InterPro:IPR000719
            InterPro:IPR000961 InterPro:IPR002219 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR012233
            InterPro:IPR017441 InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130
            Pfam:PF00433 Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
            PROSITE:PS51285 SMART:SM00109 SMART:SM00133 SMART:SM00220
            SMART:SM00666 GO:GO:0005886 GO:GO:0005524 GO:GO:0005737
            GO:GO:0005635 Pathway_Interaction_DB:insulin_glucose_pathway
            Pathway_Interaction_DB:nfat_3pathway Reactome:REACT_111102
            Pathway_Interaction_DB:igf1_pathway
            Pathway_Interaction_DB:p75ntrpathway GO:GO:0043066 GO:GO:0043234
            GO:GO:0030168 GO:GO:0000226 GO:GO:0035556 GO:GO:0046872
            Pathway_Interaction_DB:insulin_pathway GO:GO:0031333 GO:GO:0016324
            eggNOG:COG0515 GO:GO:0005768 GO:GO:0060291 SUPFAM:SSF56112
            GO:GO:0004674 GO:GO:0008270 GO:GO:0006954 GO:GO:0070374
            GO:GO:0018105 GO:GO:0005911 Pathway_Interaction_DB:trkrpathway
            GO:GO:0045179 GO:GO:0005923 GO:GO:0007179
            Pathway_Interaction_DB:tnfpathway GO:GO:0051092 GO:GO:0072659
            Pathway_Interaction_DB:ceramidepathway GO:GO:0016363
            HOGENOM:HOG000233033 HOVERGEN:HBG108317
            Pathway_Interaction_DB:amb2_neutrophils_pathway
            Pathway_Interaction_DB:il2_pi3kpathway
            Pathway_Interaction_DB:txa2pathway GO:GO:0046627 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:0030010 GO:GO:2001181
            Pathway_Interaction_DB:il1pathway GO:GO:0032753 GO:GO:0045630
            GO:GO:0035748 GO:GO:0004697 GO:GO:2000463 GO:GO:0046628
            EMBL:AL590822 GO:GO:2000667 GO:GO:2000664 EMBL:AL391845
            GO:GO:0043560 BRENDA:2.7.11.13 KO:K06069 GO:GO:0050732
            OrthoDB:EOG4T782V EMBL:L14283 EMBL:BT007082 EMBL:AK290995
            EMBL:AK294649 EMBL:AL162271 EMBL:AL645703 EMBL:BC008058
            EMBL:BC014270 EMBL:Z15108 IPI:IPI00013749 PIR:JN0877
            RefSeq:NP_001028753.1 RefSeq:NP_001028754.1 RefSeq:NP_001229803.1
            RefSeq:NP_002735.3 UniGene:Hs.496255 ProteinModelPortal:Q05513
            SMR:Q05513 IntAct:Q05513 MINT:MINT-5004464 STRING:Q05513
            PhosphoSite:Q05513 DMDM:68067736 PRIDE:Q05513 DNASU:5590
            Ensembl:ENST00000378567 Ensembl:ENST00000400920
            Ensembl:ENST00000400921 GeneID:5590 KEGG:hsa:5590 UCSC:uc001aiq.3
            CTD:5590 GeneCards:GC01P001982 H-InvDB:HIX0000049
            H-InvDB:HIX0029201 HGNC:HGNC:9412 HPA:CAB004533 HPA:HPA021851
            MIM:176982 neXtProt:NX_Q05513 PharmGKB:PA33775 InParanoid:Q05513
            OMA:RCHVLVP PhylomeDB:Q05513 BindingDB:Q05513 ChEMBL:CHEMBL3438
            ChiTaRS:PRKCZ GenomeRNAi:5590 NextBio:21684 PMAP-CutDB:Q05513
            ArrayExpress:Q05513 Bgee:Q05513 CleanEx:HS_PRKCZ
            Genevestigator:Q05513 GermOnline:ENSG00000067606 GO:GO:2000553
            Uniprot:Q05513
        Length = 592

 Score = 182 (69.1 bits), Expect = 3.9e-13, P = 3.9e-13
 Identities = 33/70 (47%), Positives = 46/70 (65%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++FIT +    T++ L EEV++MC+       T+KWVD EGDPC +S+QMELEEA RL  
Sbjct:    25 DIFITSVDAATTFEELCEEVRDMCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLAR 84

Query:   149 VNHEPELVIH 158
                +  L+IH
Sbjct:    85 QCRDEGLIIH 94


>UNIPROTKB|F1M9W5 [details] [associations]
            symbol:Prkcz "Protein kinase C zeta type" species:10116
            "Rattus norvegicus" [GO:0004674 "protein serine/threonine kinase
            activity" evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0035556
            "intracellular signal transduction" evidence=IEA]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR012233 InterPro:IPR017441
            InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130 Pfam:PF00433
            Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285
            SMART:SM00109 SMART:SM00133 SMART:SM00220 SMART:SM00666 RGD:3399
            GO:GO:0005524 GO:GO:0005635 GO:GO:0043234 GO:GO:0000226
            GO:GO:0035556 GO:GO:0046872 GO:GO:0031333 GO:GO:0016324
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0008270 GO:GO:0070374
            GO:GO:0018105 GO:GO:0045179 GO:GO:0005923 GO:GO:0072659
            GO:GO:0016363 GO:GO:0046627 InterPro:IPR020454 PRINTS:PR00008
            GO:GO:2001181 GO:GO:0032753 GO:GO:0045630 GO:GO:0035748
            GO:GO:2000667 GO:GO:2000664 GeneTree:ENSGT00700000104096
            GO:GO:0050732 GO:GO:2000553 IPI:IPI00212818 PRIDE:F1M9W5
            Ensembl:ENSRNOT00000021285 ArrayExpress:F1M9W5 Uniprot:F1M9W5
        Length = 577

 Score = 176 (67.0 bits), Expect = 1.7e-12, P = 1.7e-12
 Identities = 33/70 (47%), Positives = 44/70 (62%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT + P  T+  L EEV++MC        T+KWVD EGDPC +S+QMELEEA RL  
Sbjct:    10 DILITSVDPTTTFQDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLAC 69

Query:   149 VNHEPELVIH 158
                +  L+IH
Sbjct:    70 QGRDEVLIIH 79


>RGD|3399 [details] [associations]
            symbol:Prkcz "protein kinase C, zeta" species:10116 "Rattus
          norvegicus" [GO:0000226 "microtubule cytoskeleton organization"
          evidence=IEA;ISO] [GO:0001954 "positive regulation of cell-matrix
          adhesion" evidence=IMP] [GO:0004672 "protein kinase activity"
          evidence=ISO;TAS] [GO:0004674 "protein serine/threonine kinase
          activity" evidence=ISO;IDA] [GO:0004697 "protein kinase C activity"
          evidence=IDA] [GO:0005515 "protein binding" evidence=IPI] [GO:0005524
          "ATP binding" evidence=IDA] [GO:0005634 "nucleus" evidence=ISO]
          [GO:0005635 "nuclear envelope" evidence=IEA;ISO] [GO:0005737
          "cytoplasm" evidence=ISO;IDA] [GO:0005768 "endosome" evidence=IEA]
          [GO:0005829 "cytosol" evidence=IDA;TAS] [GO:0005886 "plasma membrane"
          evidence=ISO;IDA] [GO:0005911 "cell-cell junction" evidence=ISO;ISS]
          [GO:0005923 "tight junction" evidence=IEA;ISO] [GO:0005938 "cell
          cortex" evidence=ISO] [GO:0006468 "protein phosphorylation"
          evidence=ISO;IDA] [GO:0006954 "inflammatory response" evidence=IEA]
          [GO:0007165 "signal transduction" evidence=IDA] [GO:0007166 "cell
          surface receptor signaling pathway" evidence=IMP] [GO:0007616
          "long-term memory" evidence=IMP] [GO:0008270 "zinc ion binding"
          evidence=IEA] [GO:0008284 "positive regulation of cell proliferation"
          evidence=IMP] [GO:0008286 "insulin receptor signaling pathway"
          evidence=IMP] [GO:0015459 "potassium channel regulator activity"
          evidence=IMP] [GO:0016324 "apical plasma membrane" evidence=IEA;ISO]
          [GO:0016363 "nuclear matrix" evidence=IEA;ISO] [GO:0016477 "cell
          migration" evidence=IMP] [GO:0018105 "peptidyl-serine
          phosphorylation" evidence=ISO;IDA] [GO:0019901 "protein kinase
          binding" evidence=IPI] [GO:0019904 "protein domain specific binding"
          evidence=IPI] [GO:0030010 "establishment of cell polarity"
          evidence=IMP] [GO:0031252 "cell leading edge" evidence=IDA]
          [GO:0031333 "negative regulation of protein complex assembly"
          evidence=IEA;ISO] [GO:0031532 "actin cytoskeleton reorganization"
          evidence=IMP] [GO:0031584 "activation of phospholipase D activity"
          evidence=IMP] [GO:0032148 "activation of protein kinase B activity"
          evidence=IMP] [GO:0032753 "positive regulation of interleukin-4
          production" evidence=ISO;ISS] [GO:0032869 "cellular response to
          insulin stimulus" evidence=IMP] [GO:0034613 "cellular protein
          localization" evidence=IMP] [GO:0035556 "intracellular signal
          transduction" evidence=IDA] [GO:0035748 "myelin sheath abaxonal
          region" evidence=IEA;ISO] [GO:0043066 "negative regulation of
          apoptotic process" evidence=IDA] [GO:0043231 "intracellular
          membrane-bounded organelle" evidence=IDA] [GO:0043234 "protein
          complex" evidence=ISO;IDA] [GO:0043274 "phospholipase binding"
          evidence=IPI] [GO:0045121 "membrane raft" evidence=IDA] [GO:0045179
          "apical cortex" evidence=IEA;ISO] [GO:0045630 "positive regulation of
          T-helper 2 cell differentiation" evidence=ISO;ISS] [GO:0046326
          "positive regulation of glucose import" evidence=IMP] [GO:0046627
          "negative regulation of insulin receptor signaling pathway"
          evidence=IEA;ISO] [GO:0046628 "positive regulation of insulin
          receptor signaling pathway" evidence=IMP] [GO:0047496 "vesicle
          transport along microtubule" evidence=IMP] [GO:0048471 "perinuclear
          region of cytoplasm" evidence=IDA] [GO:0050732 "negative regulation
          of peptidyl-tyrosine phosphorylation" evidence=IEA;ISO] [GO:0050806
          "positive regulation of synaptic transmission" evidence=IMP]
          [GO:0051092 "positive regulation of NF-kappaB transcription factor
          activity" evidence=IMP] [GO:0051222 "positive regulation of protein
          transport" evidence=IMP] [GO:0051291 "protein heterooligomerization"
          evidence=IPI] [GO:0051346 "negative regulation of hydrolase activity"
          evidence=IDA] [GO:0051899 "membrane depolarization" evidence=IMP]
          [GO:0060081 "membrane hyperpolarization" evidence=IMP] [GO:0060291
          "long-term synaptic potentiation" evidence=IMP] [GO:0070374 "positive
          regulation of ERK1 and ERK2 cascade" evidence=ISO;ISS;IMP]
          [GO:0070528 "protein kinase C signaling cascade" evidence=IMP]
          [GO:0071889 "14-3-3 protein binding" evidence=IPI] [GO:0072659
          "protein localization to plasma membrane" evidence=IEA;ISO]
          [GO:2000463 "positive regulation of excitatory postsynaptic membrane
          potential" evidence=IDA] [GO:2000553 "positive regulation of T-helper
          2 cell cytokine production" evidence=ISO;ISS] [GO:2000664 "positive
          regulation of interleukin-5 secretion" evidence=ISO;ISS] [GO:2000667
          "positive regulation of interleukin-13 secretion" evidence=ISO;ISS]
          [GO:2001181 "positive regulation of interleukin-10 secretion"
          evidence=ISO;ISS] [GO:0031941 "filamentous actin" evidence=IDA]
          Reactome:REACT_82403 InterPro:IPR000270 InterPro:IPR000719
          InterPro:IPR000961 InterPro:IPR002219 InterPro:IPR002290
          InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR012233
          InterPro:IPR017441 InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130
          Pfam:PF00433 Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107
          PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
          PROSITE:PS51285 SMART:SM00109 SMART:SM00133 SMART:SM00220
          SMART:SM00666 RGD:3399 GO:GO:0043231 GO:GO:0005829 GO:GO:0005886
          GO:GO:0005524 GO:GO:0005635 GO:GO:0048471 GO:GO:0008286 GO:GO:0051291
          GO:GO:0043066 GO:GO:0043234 GO:GO:0031252 GO:GO:0000226 GO:GO:0034613
          GO:GO:0016477 GO:GO:0046872 GO:GO:0031333 GO:GO:0016324
          eggNOG:COG0515 GO:GO:0008284 GO:GO:0070528 GO:GO:0005768
          GO:GO:0060291 SUPFAM:SSF56112 GO:GO:0008270 GO:GO:0006954
          GO:GO:0070374 GO:GO:0007616 GO:GO:0046326 GO:GO:0018105 GO:GO:0005911
          GO:GO:0045121 GO:GO:0015459 GO:GO:0045179 GO:GO:0005923 GO:GO:0031532
          GO:GO:0032148 GO:GO:0051092 GO:GO:0072659 GO:GO:0060081 GO:GO:0051346
          GO:GO:0016363 HOGENOM:HOG000233033 HOVERGEN:HBG108317 GO:GO:0046627
          InterPro:IPR020454 PRINTS:PR00008 GO:GO:0030010 GO:GO:0031584
          GO:GO:2001181 GO:GO:0001954 GO:GO:0032753 GO:GO:0045630 GO:GO:0047496
          GO:GO:0035748 GO:GO:0004697 GO:GO:2000463 GO:GO:0046628 GO:GO:2000667
          GO:GO:2000664 BRENDA:2.7.11.13 KO:K06069 GO:GO:0050732
          OrthoDB:EOG4T782V CTD:5590 GO:GO:2000553 EMBL:J04532 EMBL:M18332
          IPI:IPI00212818 PIR:A30314 RefSeq:NP_071952.1 UniGene:Rn.1109
          ProteinModelPortal:P09217 SMR:P09217 DIP:DIP-40867N IntAct:P09217
          MINT:MINT-125335 STRING:P09217 PhosphoSite:P09217 PRIDE:P09217
          GeneID:25522 KEGG:rno:25522 InParanoid:P09217 BindingDB:P09217
          ChEMBL:CHEMBL5379 NextBio:606991 ArrayExpress:P09217
          Genevestigator:P09217 GermOnline:ENSRNOG00000015480 Uniprot:P09217
        Length = 592

 Score = 176 (67.0 bits), Expect = 1.7e-12, P = 1.7e-12
 Identities = 33/70 (47%), Positives = 44/70 (62%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT + P  T+  L EEV++MC        T+KWVD EGDPC +S+QMELEEA RL  
Sbjct:    25 DILITSVDPTTTFQDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLAC 84

Query:   149 VNHEPELVIH 158
                +  L+IH
Sbjct:    85 QGRDEVLIIH 94


>UNIPROTKB|F6XMN6 [details] [associations]
            symbol:PRKCZ "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:0005524 "ATP binding" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] [GO:0035556 "intracellular signal transduction"
            evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR012233 InterPro:IPR017441
            InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130 Pfam:PF00433
            Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285
            SMART:SM00109 SMART:SM00133 SMART:SM00220 SMART:SM00666
            GO:GO:0005524 GO:GO:0035556 GO:GO:0046872 SUPFAM:SSF56112
            GO:GO:0004674 GO:GO:0008270 GO:GO:0005622 InterPro:IPR020454
            PRINTS:PR00008 GeneTree:ENSGT00700000104096 KO:K06069 CTD:5590
            OMA:RCHVLVP Ensembl:ENSCAFT00000030810 EMBL:AAEX03003861
            RefSeq:XP_849092.1 GeneID:479577 KEGG:cfa:479577 Uniprot:F6XMN6
        Length = 591

 Score = 173 (66.0 bits), Expect = 3.7e-12, P = 3.7e-12
 Identities = 32/70 (45%), Positives = 45/70 (64%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT +   +T++ L +EV+EMC        T+KWVD EGDPC +S+QMELEEA RL  
Sbjct:    25 DILITSLDAAMTFEELCDEVREMCSLRQGHPLTLKWVDNEGDPCTVSSQMELEEAFRLAC 84

Query:   149 VNHEPELVIH 158
                +  L+IH
Sbjct:    85 QRRDEGLIIH 94


>UNIPROTKB|E2R2T7 [details] [associations]
            symbol:PRKCZ "Uncharacterized protein" species:9615 "Canis
            lupus familiaris" [GO:2001181 "positive regulation of
            interleukin-10 secretion" evidence=IEA] [GO:2000667 "positive
            regulation of interleukin-13 secretion" evidence=IEA] [GO:2000664
            "positive regulation of interleukin-5 secretion" evidence=IEA]
            [GO:2000553 "positive regulation of T-helper 2 cell cytokine
            production" evidence=IEA] [GO:0072659 "protein localization to
            plasma membrane" evidence=IEA] [GO:0070374 "positive regulation of
            ERK1 and ERK2 cascade" evidence=IEA] [GO:0050732 "negative
            regulation of peptidyl-tyrosine phosphorylation" evidence=IEA]
            [GO:0046627 "negative regulation of insulin receptor signaling
            pathway" evidence=IEA] [GO:0045630 "positive regulation of T-helper
            2 cell differentiation" evidence=IEA] [GO:0045179 "apical cortex"
            evidence=IEA] [GO:0043234 "protein complex" evidence=IEA]
            [GO:0035748 "myelin sheath abaxonal region" evidence=IEA]
            [GO:0032753 "positive regulation of interleukin-4 production"
            evidence=IEA] [GO:0031333 "negative regulation of protein complex
            assembly" evidence=IEA] [GO:0018105 "peptidyl-serine
            phosphorylation" evidence=IEA] [GO:0016363 "nuclear matrix"
            evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IEA]
            [GO:0005923 "tight junction" evidence=IEA] [GO:0005635 "nuclear
            envelope" evidence=IEA] [GO:0004674 "protein serine/threonine
            kinase activity" evidence=IEA] [GO:0000226 "microtubule
            cytoskeleton organization" evidence=IEA] [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0035556 "intracellular signal transduction"
            evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR012233 InterPro:IPR017441
            InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130 Pfam:PF00433
            Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285
            SMART:SM00109 SMART:SM00133 SMART:SM00220 SMART:SM00666
            GO:GO:0005524 GO:GO:0005635 GO:GO:0043234 GO:GO:0000226
            GO:GO:0035556 GO:GO:0046872 GO:GO:0031333 GO:GO:0016324
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0008270 GO:GO:0070374
            GO:GO:0018105 GO:GO:0045179 GO:GO:0005923 GO:GO:0072659
            GO:GO:0016363 GO:GO:0046627 InterPro:IPR020454 PRINTS:PR00008
            GO:GO:2001181 GO:GO:0032753 GO:GO:0045630 GO:GO:0035748
            GO:GO:2000667 GO:GO:2000664 GO:GO:0050732 GO:GO:2000553
            Ensembl:ENSCAFT00000030810 Uniprot:E2R2T7
        Length = 592

 Score = 173 (66.0 bits), Expect = 3.7e-12, P = 3.7e-12
 Identities = 32/70 (45%), Positives = 45/70 (64%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT +   +T++ L +EV+EMC        T+KWVD EGDPC +S+QMELEEA RL  
Sbjct:    26 DILITSLDAAMTFEELCDEVREMCSLRQGHPLTLKWVDNEGDPCTVSSQMELEEAFRLAC 85

Query:   149 VNHEPELVIH 158
                +  L+IH
Sbjct:    86 QRRDEGLIIH 95


>ZFIN|ZDB-GENE-070511-1 [details] [associations]
            symbol:prkcz "protein kinase C, zeta" species:7955
            "Danio rerio" [GO:0004672 "protein kinase activity" evidence=IEA]
            [GO:0004674 "protein serine/threonine kinase activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0006468
            "protein phosphorylation" evidence=IEA] [GO:0035556 "intracellular
            signal transduction" evidence=IEA] [GO:0016772 "transferase
            activity, transferring phosphorus-containing groups" evidence=IEA]
            [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0060042 "retina
            morphogenesis in camera-type eye" evidence=IGI] [GO:0048699
            "generation of neurons" evidence=IGI] [GO:0007097 "nuclear
            migration" evidence=IGI] [GO:0016310 "phosphorylation"
            evidence=IEA] [GO:0046872 "metal ion binding" evidence=IEA]
            [GO:0016740 "transferase activity" evidence=IEA] [GO:0016301
            "kinase activity" evidence=IEA] [GO:0000166 "nucleotide binding"
            evidence=IEA] InterPro:IPR000270 InterPro:IPR000719
            InterPro:IPR000961 InterPro:IPR002219 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR012233
            InterPro:IPR017441 InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130
            Pfam:PF00433 Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
            PROSITE:PS51285 SMART:SM00109 SMART:SM00133 SMART:SM00220
            SMART:SM00666 ZFIN:ZDB-GENE-070511-1 GO:GO:0005524 GO:GO:0035556
            GO:GO:0046872 SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0008270
            GO:GO:0005622 HOVERGEN:HBG108317 InterPro:IPR020454 PRINTS:PR00008
            GO:GO:0007097 GO:GO:0048699 GO:GO:0060042 KO:K06069 CTD:5590
            EMBL:DQ097196 IPI:IPI00507527 RefSeq:NP_001025262.1
            UniGene:Dr.88226 ProteinModelPortal:Q4JG04 SMR:Q4JG04 STRING:Q4JG04
            GeneID:555737 KEGG:dre:555737 InParanoid:Q4JG04 NextBio:20881137
            Uniprot:Q4JG04
        Length = 599

 Score = 168 (64.2 bits), Expect = 1.3e-11, P = 1.3e-11
 Identities = 30/70 (42%), Positives = 47/70 (67%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ I+ +   +TY  + +EV+EMC    +   T+KW+D+EGDPC IS+QMELEEA R+Y 
Sbjct:    25 DMLISDLDLALTYTEVCKEVREMCGVRKETPITLKWIDDEGDPCTISSQMELEEAFRIYS 84

Query:   149 VNHEPELVIH 158
              +    L++H
Sbjct:    85 RSRHSGLLLH 94


>MGI|MGI:97602 [details] [associations]
            symbol:Prkcz "protein kinase C, zeta" species:10090 "Mus
            musculus" [GO:0000166 "nucleotide binding" evidence=IEA]
            [GO:0000226 "microtubule cytoskeleton organization" evidence=IMP]
            [GO:0001954 "positive regulation of cell-matrix adhesion"
            evidence=ISO] [GO:0004672 "protein kinase activity"
            evidence=ISO;IDA] [GO:0004674 "protein serine/threonine kinase
            activity" evidence=ISO;IDA] [GO:0004697 "protein kinase C activity"
            evidence=ISO] [GO:0005515 "protein binding" evidence=IPI]
            [GO:0005524 "ATP binding" evidence=ISO] [GO:0005634 "nucleus"
            evidence=IDA] [GO:0005635 "nuclear envelope" evidence=IDA]
            [GO:0005737 "cytoplasm" evidence=ISO;IDA] [GO:0005768 "endosome"
            evidence=IEA] [GO:0005829 "cytosol" evidence=ISO] [GO:0005886
            "plasma membrane" evidence=ISO;IDA] [GO:0005911 "cell-cell
            junction" evidence=ISO] [GO:0005923 "tight junction" evidence=IDA]
            [GO:0005938 "cell cortex" evidence=IDA] [GO:0006468 "protein
            phosphorylation" evidence=ISO;IDA] [GO:0006954 "inflammatory
            response" evidence=IEA] [GO:0007165 "signal transduction"
            evidence=ISO] [GO:0007166 "cell surface receptor signaling pathway"
            evidence=ISO] [GO:0007616 "long-term memory" evidence=ISO]
            [GO:0008270 "zinc ion binding" evidence=IEA] [GO:0008284 "positive
            regulation of cell proliferation" evidence=ISO] [GO:0008286
            "insulin receptor signaling pathway" evidence=ISO] [GO:0015459
            "potassium channel regulator activity" evidence=ISO] [GO:0016301
            "kinase activity" evidence=IEA] [GO:0016310 "phosphorylation"
            evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IDA]
            [GO:0016363 "nuclear matrix" evidence=IDA] [GO:0016477 "cell
            migration" evidence=ISO] [GO:0016740 "transferase activity"
            evidence=IEA] [GO:0016772 "transferase activity, transferring
            phosphorus-containing groups" evidence=IEA] [GO:0018105
            "peptidyl-serine phosphorylation" evidence=ISO] [GO:0019901
            "protein kinase binding" evidence=ISO] [GO:0019904 "protein domain
            specific binding" evidence=ISO] [GO:0030010 "establishment of cell
            polarity" evidence=ISO] [GO:0030054 "cell junction" evidence=IEA]
            [GO:0031252 "cell leading edge" evidence=ISO] [GO:0031333 "negative
            regulation of protein complex assembly" evidence=ISO] [GO:0031532
            "actin cytoskeleton reorganization" evidence=ISO] [GO:0031584
            "activation of phospholipase D activity" evidence=ISO] [GO:0031941
            "filamentous actin" evidence=ISO] [GO:0032148 "activation of
            protein kinase B activity" evidence=ISO] [GO:0032753 "positive
            regulation of interleukin-4 production" evidence=IMP] [GO:0032869
            "cellular response to insulin stimulus" evidence=ISO] [GO:0034613
            "cellular protein localization" evidence=ISO] [GO:0035556
            "intracellular signal transduction" evidence=ISO] [GO:0035748
            "myelin sheath abaxonal region" evidence=IDA] [GO:0043066 "negative
            regulation of apoptotic process" evidence=ISO] [GO:0043231
            "intracellular membrane-bounded organelle" evidence=ISO]
            [GO:0043234 "protein complex" evidence=ISO;IDA] [GO:0043274
            "phospholipase binding" evidence=ISO] [GO:0045121 "membrane raft"
            evidence=ISO] [GO:0045179 "apical cortex" evidence=IDA] [GO:0045630
            "positive regulation of T-helper 2 cell differentiation"
            evidence=IMP] [GO:0046326 "positive regulation of glucose import"
            evidence=ISO] [GO:0046627 "negative regulation of insulin receptor
            signaling pathway" evidence=ISO] [GO:0046628 "positive regulation
            of insulin receptor signaling pathway" evidence=ISO] [GO:0046872
            "metal ion binding" evidence=IEA] [GO:0047496 "vesicle transport
            along microtubule" evidence=ISO] [GO:0048471 "perinuclear region of
            cytoplasm" evidence=ISO] [GO:0050732 "negative regulation of
            peptidyl-tyrosine phosphorylation" evidence=ISO] [GO:0050806
            "positive regulation of synaptic transmission" evidence=ISO]
            [GO:0051092 "positive regulation of NF-kappaB transcription factor
            activity" evidence=ISO] [GO:0051222 "positive regulation of protein
            transport" evidence=ISO] [GO:0051291 "protein
            heterooligomerization" evidence=ISO] [GO:0051346 "negative
            regulation of hydrolase activity" evidence=ISO] [GO:0051899
            "membrane depolarization" evidence=ISO] [GO:0060081 "membrane
            hyperpolarization" evidence=ISO] [GO:0060291 "long-term synaptic
            potentiation" evidence=ISO] [GO:0070374 "positive regulation of
            ERK1 and ERK2 cascade" evidence=ISO] [GO:0070528 "protein kinase C
            signaling cascade" evidence=ISO] [GO:0071889 "14-3-3 protein
            binding" evidence=ISO] [GO:0072659 "protein localization to plasma
            membrane" evidence=IMP] [GO:2000463 "positive regulation of
            excitatory postsynaptic membrane potential" evidence=ISO]
            [GO:2000553 "positive regulation of T-helper 2 cell cytokine
            production" evidence=IMP] [GO:2000664 "positive regulation of
            interleukin-5 secretion" evidence=IMP] [GO:2000667 "positive
            regulation of interleukin-13 secretion" evidence=IMP] [GO:2001181
            "positive regulation of interleukin-10 secretion" evidence=IMP]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR012233 InterPro:IPR017441
            InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130 Pfam:PF00433
            Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285
            SMART:SM00109 SMART:SM00133 SMART:SM00220 SMART:SM00666
            MGI:MGI:97602 GO:GO:0005524 GO:GO:0005635 GO:GO:0043234
            GO:GO:0000226 GO:GO:0035556 GO:GO:0046872 GO:GO:0031333
            GO:GO:0016324 eggNOG:COG0515 GO:GO:0005768 GO:GO:0060291
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0008270 GO:GO:0006954
            GO:GO:0070374 GO:GO:0018105 GO:GO:0045179 GO:GO:0005923
            GO:GO:0051092 GO:GO:0072659 GO:GO:0016363 HOGENOM:HOG000233033
            HOVERGEN:HBG108317 EMBL:CH466594 GO:GO:0046627 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:0030010 GO:GO:2001181 GO:GO:0032753
            GO:GO:0045630 GO:GO:0035748 GO:GO:0004697 GO:GO:2000463
            GO:GO:0046628 EMBL:AL670413 GO:GO:2000667 GO:GO:2000664
            EMBL:AL670227 BRENDA:2.7.11.13 GeneTree:ENSGT00700000104096
            KO:K06069 GO:GO:0050732 OrthoDB:EOG4T782V CTD:5590 OMA:RCHVLVP
            GO:GO:2000553 EMBL:M94632 IPI:IPI00133596 PIR:JC1480
            RefSeq:NP_032886.2 UniGene:Mm.28561 ProteinModelPortal:Q02956
            SMR:Q02956 IntAct:Q02956 MINT:MINT-98101 STRING:Q02956
            PhosphoSite:Q02956 PaxDb:Q02956 PRIDE:Q02956
            Ensembl:ENSMUST00000030922 GeneID:18762 KEGG:mmu:18762
            InParanoid:A2AD76 NextBio:294953 Bgee:Q02956 CleanEx:MM_PRKCZ
            Genevestigator:Q02956 GermOnline:ENSMUSG00000029053 Uniprot:Q02956
        Length = 592

 Score = 166 (63.5 bits), Expect = 2.1e-11, P = 2.1e-11
 Identities = 32/70 (45%), Positives = 43/70 (61%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT +    T+  L EEV++MC        T+KWVD EGDPC +S+QMELEEA RL  
Sbjct:    25 DILITSVDAMTTFKDLCEEVRDMCGLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLVC 84

Query:   149 VNHEPELVIH 158
                +  L+IH
Sbjct:    85 QGRDEVLIIH 94


>UNIPROTKB|A0JNH7 [details] [associations]
            symbol:PRKCZ "Uncharacterized protein" species:9913 "Bos
            taurus" [GO:2001181 "positive regulation of interleukin-10
            secretion" evidence=IEA] [GO:2000667 "positive regulation of
            interleukin-13 secretion" evidence=IEA] [GO:2000664 "positive
            regulation of interleukin-5 secretion" evidence=IEA] [GO:2000553
            "positive regulation of T-helper 2 cell cytokine production"
            evidence=IEA] [GO:0072659 "protein localization to plasma membrane"
            evidence=IEA] [GO:0070374 "positive regulation of ERK1 and ERK2
            cascade" evidence=IEA] [GO:0050732 "negative regulation of
            peptidyl-tyrosine phosphorylation" evidence=IEA] [GO:0046627
            "negative regulation of insulin receptor signaling pathway"
            evidence=IEA] [GO:0045630 "positive regulation of T-helper 2 cell
            differentiation" evidence=IEA] [GO:0045179 "apical cortex"
            evidence=IEA] [GO:0043234 "protein complex" evidence=IEA]
            [GO:0035748 "myelin sheath abaxonal region" evidence=IEA]
            [GO:0032753 "positive regulation of interleukin-4 production"
            evidence=IEA] [GO:0031333 "negative regulation of protein complex
            assembly" evidence=IEA] [GO:0018105 "peptidyl-serine
            phosphorylation" evidence=IEA] [GO:0016363 "nuclear matrix"
            evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IEA]
            [GO:0005923 "tight junction" evidence=IEA] [GO:0005635 "nuclear
            envelope" evidence=IEA] [GO:0004674 "protein serine/threonine
            kinase activity" evidence=IEA] [GO:0000226 "microtubule
            cytoskeleton organization" evidence=IEA] [GO:0005524 "ATP binding"
            evidence=IEA] [GO:0035556 "intracellular signal transduction"
            evidence=IEA] [GO:0008270 "zinc ion binding" evidence=IEA]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR012233 InterPro:IPR017441
            InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130 Pfam:PF00433
            Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285
            SMART:SM00109 SMART:SM00133 SMART:SM00220 SMART:SM00666
            GO:GO:0005524 GO:GO:0005635 GO:GO:0043234 GO:GO:0000226
            GO:GO:0035556 GO:GO:0046872 GO:GO:0031333 GO:GO:0016324
            eggNOG:COG0515 SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0008270
            GO:GO:0070374 GO:GO:0018105 GO:GO:0045179 GO:GO:0005923
            GO:GO:0072659 GO:GO:0016363 HOGENOM:HOG000233033 HOVERGEN:HBG108317
            GO:GO:0046627 InterPro:IPR020454 PRINTS:PR00008 GO:GO:2001181
            GO:GO:0032753 GO:GO:0045630 GO:GO:0035748 GO:GO:2000667
            GO:GO:2000664 GeneTree:ENSGT00700000104096 KO:K06069 GO:GO:0050732
            OrthoDB:EOG4T782V CTD:5590 OMA:RCHVLVP GO:GO:2000553
            EMBL:DAAA02043221 EMBL:DAAA02043222 EMBL:BC126688 IPI:IPI00693898
            RefSeq:NP_001071301.1 UniGene:Bt.15734 SMR:A0JNH7 STRING:A0JNH7
            Ensembl:ENSBTAT00000018768 GeneID:286877 KEGG:bta:286877
            InParanoid:A0JNH7 NextBio:20806524 Uniprot:A0JNH7
        Length = 594

 Score = 165 (63.1 bits), Expect = 2.7e-11, P = 2.7e-11
 Identities = 34/71 (47%), Positives = 44/71 (61%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++ IT +    T+D L  EV+EMC        T+KWVD EGDPC +S+QMELEEA RL  
Sbjct:    27 DLLITSLDSATTFDELCAEVREMCWLHPGHPLTLKWVDNEGDPCTVSSQMELEEAFRL-S 85

Query:   149 VNHEPE-LVIH 158
               H+ E L +H
Sbjct:    86 CQHKDEGLTLH 96


>UNIPROTKB|O19111 [details] [associations]
            symbol:PRKCZ "Protein kinase C zeta type" species:9986
            "Oryctolagus cuniculus" [GO:0004674 "protein serine/threonine
            kinase activity" evidence=ISS] [GO:0005886 "plasma membrane"
            evidence=ISS] [GO:0005911 "cell-cell junction" evidence=ISS]
            [GO:0030010 "establishment of cell polarity" evidence=ISS]
            [GO:0032753 "positive regulation of interleukin-4 production"
            evidence=ISS] [GO:0045630 "positive regulation of T-helper 2 cell
            differentiation" evidence=ISS] [GO:0046628 "positive regulation of
            insulin receptor signaling pathway" evidence=ISS] [GO:0051092
            "positive regulation of NF-kappaB transcription factor activity"
            evidence=ISS] [GO:0060291 "long-term synaptic potentiation"
            evidence=ISS] [GO:0070374 "positive regulation of ERK1 and ERK2
            cascade" evidence=ISS] [GO:2000463 "positive regulation of
            excitatory postsynaptic membrane potential" evidence=ISS]
            [GO:2000553 "positive regulation of T-helper 2 cell cytokine
            production" evidence=ISS] [GO:2000664 "positive regulation of
            interleukin-5 secretion" evidence=ISS] [GO:2000667 "positive
            regulation of interleukin-13 secretion" evidence=ISS] [GO:2001181
            "positive regulation of interleukin-10 secretion" evidence=ISS]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR012233 InterPro:IPR017441
            InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130 Pfam:PF00433
            Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285
            SMART:SM00109 SMART:SM00133 SMART:SM00220 SMART:SM00666
            GO:GO:0005886 GO:GO:0005524 GO:GO:0035556 GO:GO:0046872
            eggNOG:COG0515 GO:GO:0005768 GO:GO:0060291 SUPFAM:SSF56112
            GO:GO:0004674 GO:GO:0008270 GO:GO:0006954 GO:GO:0070374
            GO:GO:0005911 GO:GO:0051092 HOVERGEN:HBG108317 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:0030010 GO:GO:2001181 GO:GO:0032753
            GO:GO:0045630 GO:GO:0004697 GO:GO:2000463 GO:GO:0046628
            GO:GO:2000667 GO:GO:2000664 BRENDA:2.7.11.13 CTD:5590 GO:GO:2000553
            EMBL:U78768 RefSeq:NP_001076227.1 UniGene:Ocu.2166
            ProteinModelPortal:O19111 SMR:O19111 GeneID:100009538
            Uniprot:O19111
        Length = 591

 Score = 158 (60.7 bits), Expect = 1.5e-10, P = 1.5e-10
 Identities = 30/70 (42%), Positives = 44/70 (62%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             ++FIT +    T++ L EEV++MC        T+KWVD EGDP  +S+QMEL EA RL  
Sbjct:    25 DIFITSVDAATTFEELCEEVRDMCGLHQHHPLTLKWVDSEGDPRTVSSQMELGEAFRLAG 84

Query:   149 VNHEPELVIH 158
              + +  L++H
Sbjct:    85 QHRDDGLILH 94


>UNIPROTKB|A8WUG4 [details] [associations]
            symbol:pkc-3 "Protein kinase C-like 3" species:6238
            "Caenorhabditis briggsae" [GO:0004674 "protein serine/threonine
            kinase activity" evidence=ISS] [GO:0005886 "plasma membrane"
            evidence=ISS] [GO:0007163 "establishment or maintenance of cell
            polarity" evidence=ISS] [GO:0008406 "gonad development"
            evidence=ISS] [GO:0019904 "protein domain specific binding"
            evidence=ISS] [GO:0030864 "cortical actin cytoskeleton"
            evidence=ISS] InterPro:IPR000270 InterPro:IPR000719
            InterPro:IPR000961 InterPro:IPR002219 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR012233
            InterPro:IPR017441 InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130
            Pfam:PF00433 Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
            PROSITE:PS51285 SMART:SM00109 SMART:SM00133 SMART:SM00220
            SMART:SM00666 GO:GO:0005886 GO:GO:0005524 GO:GO:0019904
            GO:GO:0030154 GO:GO:0008406 GO:GO:0035556 GO:GO:0046872
            GO:GO:0007163 eggNOG:COG0515 SUPFAM:SSF56112 GO:GO:0004674
            GO:GO:0008270 GO:GO:0007506 GO:GO:0007338 GO:GO:0030864
            EMBL:HE601438 HOGENOM:HOG000233033 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:0007369 GO:GO:0004697 RefSeq:XP_002630700.1
            ProteinModelPortal:A8WUG4 SMR:A8WUG4 EnsemblMetazoa:CBG02381
            GeneID:8572216 KEGG:cbr:CBG02381 CTD:8572216 WormBase:CBG02381
            KO:K06069 OMA:RVKAYYK Uniprot:A8WUG4
        Length = 597

 Score = 158 (60.7 bits), Expect = 1.5e-10, P = 1.5e-10
 Identities = 30/70 (42%), Positives = 43/70 (61%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             +V + Y +P +  D     +++ CK    Q  TVKW+DE+GDP  I +QMEL+EA+R   
Sbjct:    22 QVVVLYARPPLILDDFFALLRDACKQHAKQDITVKWIDEDGDPISIDSQMELDEAVRCLN 81

Query:   149 VNHEPELVIH 158
             V+ E EL IH
Sbjct:    82 VSQEAELNIH 91


>WB|WBGene00004034 [details] [associations]
            symbol:pkc-3 species:6239 "Caenorhabditis elegans"
            [GO:0004672 "protein kinase activity" evidence=IEA;IDA] [GO:0005524
            "ATP binding" evidence=IEA] [GO:0006468 "protein phosphorylation"
            evidence=IEA] [GO:0004674 "protein serine/threonine kinase
            activity" evidence=IEA] [GO:0008270 "zinc ion binding"
            evidence=IEA] [GO:0004713 "protein tyrosine kinase activity"
            evidence=IEA] [GO:0009792 "embryo development ending in birth or
            egg hatching" evidence=IMP] [GO:0010171 "body morphogenesis"
            evidence=IMP] [GO:0040035 "hermaphrodite genitalia development"
            evidence=IMP] [GO:0040027 "negative regulation of vulval
            development" evidence=IMP] [GO:0000003 "reproduction" evidence=IMP]
            [GO:0006898 "receptor-mediated endocytosis" evidence=IMP]
            [GO:0005938 "cell cortex" evidence=IDA] [GO:0005829 "cytosol"
            evidence=IDA] [GO:0016020 "membrane" evidence=IDA] [GO:0016324
            "apical plasma membrane" evidence=IDA] [GO:0030864 "cortical actin
            cytoskeleton" evidence=IDA] [GO:0005515 "protein binding"
            evidence=IPI] [GO:0008105 "asymmetric protein localization"
            evidence=IMP] InterPro:IPR000270 InterPro:IPR000719
            InterPro:IPR000961 InterPro:IPR002219 InterPro:IPR002290
            InterPro:IPR008271 InterPro:IPR011009 InterPro:IPR012233
            InterPro:IPR017441 InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130
            Pfam:PF00433 Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
            PROSITE:PS51285 SMART:SM00109 SMART:SM00133 SMART:SM00220
            SMART:SM00666 GO:GO:0005829 GO:GO:0005524 GO:GO:0009792
            GO:GO:0006898 GO:GO:0030154 GO:GO:0008406 GO:GO:0035556
            GO:GO:0046872 GO:GO:0007163 GO:GO:0016324 eggNOG:COG0515
            SUPFAM:SSF56112 GO:GO:0004674 GO:GO:0008270 GO:GO:0010171
            GO:GO:0007506 GO:GO:0007338 GO:GO:0040035 GO:GO:0030864
            GO:GO:0008105 HOGENOM:HOG000233033 GO:GO:0040027 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:0007369 EMBL:FO081044 GO:GO:0004697
            GeneTree:ENSGT00700000104096 KO:K06069 EMBL:AB007320 EMBL:AF025666
            PIR:T16006 RefSeq:NP_495011.1 UniGene:Cel.19483
            ProteinModelPortal:Q19266 SMR:Q19266 DIP:DIP-24814N IntAct:Q19266
            MINT:MINT-1112545 STRING:Q19266 PaxDb:Q19266
            EnsemblMetazoa:F09E5.1.1 EnsemblMetazoa:F09E5.1.2 GeneID:173914
            KEGG:cel:CELE_F09E5.1 UCSC:F09E5.1.2 CTD:173914 WormBase:F09E5.1
            InParanoid:Q19266 OMA:TPPYKPR NextBio:881643 Uniprot:Q19266
        Length = 597

 Score = 154 (59.3 bits), Expect = 4.1e-10, P = 4.1e-10
 Identities = 30/70 (42%), Positives = 42/70 (60%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             +V + Y +P +  D     +K+ CK    Q  TVKW+DE+GDP  I +QMEL+EA+R   
Sbjct:    22 QVVVLYARPPLILDDFFALLKDACKQHKKQDITVKWIDEDGDPISIDSQMELDEAVRCLN 81

Query:   149 VNHEPELVIH 158
              + E EL IH
Sbjct:    82 SSQEAELNIH 91


>UNIPROTKB|Q19266 [details] [associations]
            symbol:pkc-3 "Protein kinase C-like 3" species:6239
            "Caenorhabditis elegans" [GO:0005515 "protein binding"
            evidence=IPI] [GO:0004674 "protein serine/threonine kinase
            activity" evidence=IDA] [GO:0008406 "gonad development"
            evidence=IMP] [GO:0019904 "protein domain specific binding"
            evidence=IPI] [GO:0007163 "establishment or maintenance of cell
            polarity" evidence=IGI] [GO:0030864 "cortical actin cytoskeleton"
            evidence=IDA] [GO:0005886 "plasma membrane" evidence=IDA]
            InterPro:IPR000270 InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR012233 InterPro:IPR017441
            InterPro:IPR017892 Pfam:PF00069 Pfam:PF00130 Pfam:PF00433
            Pfam:PF00564 PIRSF:PIRSF000554 PROSITE:PS00107 PROSITE:PS00108
            PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081 PROSITE:PS51285
            SMART:SM00109 SMART:SM00133 SMART:SM00220 SMART:SM00666
            GO:GO:0005829 GO:GO:0005524 GO:GO:0009792 GO:GO:0006898
            GO:GO:0030154 GO:GO:0008406 GO:GO:0035556 GO:GO:0046872
            GO:GO:0007163 GO:GO:0016324 eggNOG:COG0515 SUPFAM:SSF56112
            GO:GO:0004674 GO:GO:0008270 GO:GO:0010171 GO:GO:0007506
            GO:GO:0007338 GO:GO:0040035 GO:GO:0030864 GO:GO:0008105
            HOGENOM:HOG000233033 GO:GO:0040027 InterPro:IPR020454
            PRINTS:PR00008 GO:GO:0007369 EMBL:FO081044 GO:GO:0004697
            GeneTree:ENSGT00700000104096 KO:K06069 EMBL:AB007320 EMBL:AF025666
            PIR:T16006 RefSeq:NP_495011.1 UniGene:Cel.19483
            ProteinModelPortal:Q19266 SMR:Q19266 DIP:DIP-24814N IntAct:Q19266
            MINT:MINT-1112545 STRING:Q19266 PaxDb:Q19266
            EnsemblMetazoa:F09E5.1.1 EnsemblMetazoa:F09E5.1.2 GeneID:173914
            KEGG:cel:CELE_F09E5.1 UCSC:F09E5.1.2 CTD:173914 WormBase:F09E5.1
            InParanoid:Q19266 OMA:TPPYKPR NextBio:881643 Uniprot:Q19266
        Length = 597

 Score = 154 (59.3 bits), Expect = 4.1e-10, P = 4.1e-10
 Identities = 30/70 (42%), Positives = 42/70 (60%)

Query:    89 EVFITYIKPDITYDRLQEEVKEMCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYE 148
             +V + Y +P +  D     +K+ CK    Q  TVKW+DE+GDP  I +QMEL+EA+R   
Sbjct:    22 QVVVLYARPPLILDDFFALLKDACKQHKKQDITVKWIDEDGDPISIDSQMELDEAVRCLN 81

Query:   149 VNHEPELVIH 158
              + E EL IH
Sbjct:    82 SSQEAELNIH 91


>UNIPROTKB|D6REZ8 [details] [associations]
            symbol:PRKCZ "Protein kinase C zeta type" species:9606
            "Homo sapiens" [GO:0000226 "microtubule cytoskeleton organization"
            evidence=IEA] [GO:0001954 "positive regulation of cell-matrix
            adhesion" evidence=IEA] [GO:0004697 "protein kinase C activity"
            evidence=IEA] [GO:0005524 "ATP binding" evidence=IEA] [GO:0005635
            "nuclear envelope" evidence=IEA] [GO:0005829 "cytosol"
            evidence=IEA] [GO:0005923 "tight junction" evidence=IEA]
            [GO:0007616 "long-term memory" evidence=IEA] [GO:0008284 "positive
            regulation of cell proliferation" evidence=IEA] [GO:0008286
            "insulin receptor signaling pathway" evidence=IEA] [GO:0015459
            "potassium channel regulator activity" evidence=IEA] [GO:0016324
            "apical plasma membrane" evidence=IEA] [GO:0016363 "nuclear matrix"
            evidence=IEA] [GO:0016477 "cell migration" evidence=IEA]
            [GO:0019901 "protein kinase binding" evidence=IEA] [GO:0019904
            "protein domain specific binding" evidence=IEA] [GO:0030010
            "establishment of cell polarity" evidence=IEA] [GO:0031252 "cell
            leading edge" evidence=IEA] [GO:0031532 "actin cytoskeleton
            reorganization" evidence=IEA] [GO:0031584 "activation of
            phospholipase D activity" evidence=IEA] [GO:0032148 "activation of
            protein kinase B activity" evidence=IEA] [GO:0032753 "positive
            regulation of interleukin-4 production" evidence=IEA] [GO:0035748
            "myelin sheath abaxonal region" evidence=IEA] [GO:0043066 "negative
            regulation of apoptotic process" evidence=IEA] [GO:0043234 "protein
            complex" evidence=IEA] [GO:0043274 "phospholipase binding"
            evidence=IEA] [GO:0045121 "membrane raft" evidence=IEA] [GO:0045179
            "apical cortex" evidence=IEA] [GO:0045630 "positive regulation of
            T-helper 2 cell differentiation" evidence=IEA] [GO:0046326
            "positive regulation of glucose import" evidence=IEA] [GO:0046628
            "positive regulation of insulin receptor signaling pathway"
            evidence=IEA] [GO:0047496 "vesicle transport along microtubule"
            evidence=IEA] [GO:0048471 "perinuclear region of cytoplasm"
            evidence=IEA] [GO:0051092 "positive regulation of NF-kappaB
            transcription factor activity" evidence=IEA] [GO:0051291 "protein
            heterooligomerization" evidence=IEA] [GO:0051346 "negative
            regulation of hydrolase activity" evidence=IEA] [GO:0060081
            "membrane hyperpolarization" evidence=IEA] [GO:0060291 "long-term
            synaptic potentiation" evidence=IEA] [GO:0070528 "protein kinase C
            signaling cascade" evidence=IEA] [GO:0071889 "14-3-3 protein
            binding" evidence=IEA] [GO:0072659 "protein localization to plasma
            membrane" evidence=IEA] [GO:2000463 "positive regulation of
            excitatory postsynaptic membrane potential" evidence=IEA]
            [GO:2000553 "positive regulation of T-helper 2 cell cytokine
            production" evidence=IEA] [GO:2000664 "positive regulation of
            interleukin-5 secretion" evidence=IEA] [GO:2000667 "positive
            regulation of interleukin-13 secretion" evidence=IEA] [GO:2001181
            "positive regulation of interleukin-10 secretion" evidence=IEA]
            InterPro:IPR000270 Pfam:PF00564 GO:GO:0005635 GO:GO:0043234
            GO:GO:0000226 GO:GO:0016324 GO:GO:0004672 GO:GO:0045179
            GO:GO:0005923 GO:GO:0072659 GO:GO:0016363 GO:GO:2001181
            GO:GO:0032753 GO:GO:0045630 GO:GO:0035748 EMBL:AL590822
            GO:GO:2000667 GO:GO:2000664 EMBL:AL391845 EMBL:AL162271
            EMBL:AL645703 HGNC:HGNC:9412 ChiTaRS:PRKCZ GO:GO:2000553
            IPI:IPI00515054 ProteinModelPortal:D6REZ8 SMR:D6REZ8
            Ensembl:ENST00000503297 HOGENOM:HOG000206977 ArrayExpress:D6REZ8
            Bgee:D6REZ8 Uniprot:D6REZ8
        Length = 65

 Score = 137 (53.3 bits), Expect = 2.2e-09, P = 2.2e-09
 Identities = 25/48 (52%), Positives = 31/48 (64%)

Query:   111 MCKFSTDQVFTVKWVDEEGDPCLISTQMELEEAIRLYEVNHEPELVIH 158
             MC+       T+KWVD EGDPC +S+QMELEEA RL     +  L+IH
Sbjct:     1 MCRLHQQHPLTLKWVDSEGDPCTVSSQMELEEAFRLARQCRDEGLIIH 48


>UNIPROTKB|F1SH28 [details] [associations]
            symbol:PRKCI "Uncharacterized protein" species:9823 "Sus
            scrofa" [GO:2000353 "positive regulation of endothelial cell
            apoptotic process" evidence=IEA] [GO:0090004 "positive regulation
            of establishment of protein localization to plasma membrane"
            evidence=IEA] [GO:0060252 "positive regulation of glial cell
            proliferation" evidence=IEA] [GO:0051092 "positive regulation of
            NF-kappaB transcription factor activity" evidence=IEA] [GO:0046326
            "positive regulation of glucose import" evidence=IEA] [GO:0045216
            "cell-cell junction organization" evidence=IEA] [GO:0043524
            "negative regulation of neuron apoptotic process" evidence=IEA]
            [GO:0043220 "Schmidt-Lanterman incisure" evidence=IEA] [GO:0042462
            "eye photoreceptor cell development" evidence=IEA] [GO:0035089
            "establishment of apical/basal cell polarity" evidence=IEA]
            [GO:0034351 "negative regulation of glial cell apoptotic process"
            evidence=IEA] [GO:0032869 "cellular response to insulin stimulus"
            evidence=IEA] [GO:0016324 "apical plasma membrane" evidence=IEA]
            [GO:0010976 "positive regulation of neuron projection development"
            evidence=IEA] [GO:0007015 "actin filament organization"
            evidence=IEA] [GO:0005829 "cytosol" evidence=IEA] [GO:0005634
            "nucleus" evidence=IEA] [GO:0005543 "phospholipid binding"
            evidence=IEA] [GO:0004697 "protein kinase C activity" evidence=IEA]
            [GO:0046872 "metal ion binding" evidence=IEA] [GO:0005524 "ATP
            binding" evidence=IEA] [GO:0035556 "intracellular signal
            transduction" evidence=IEA] InterPro:IPR000719 InterPro:IPR000961
            InterPro:IPR002219 InterPro:IPR002290 InterPro:IPR008271
            InterPro:IPR011009 InterPro:IPR017441 InterPro:IPR017892
            Pfam:PF00069 Pfam:PF00130 Pfam:PF00433 PROSITE:PS00107
            PROSITE:PS00108 PROSITE:PS00479 PROSITE:PS50011 PROSITE:PS50081
            PROSITE:PS51285 SMART:SM00109 SMART:SM00133 SMART:SM00220
            GO:GO:0005829 GO:GO:0005524 GO:GO:0005634 GO:GO:0010976
            GO:GO:0007015 GO:GO:0005543 GO:GO:0035556 GO:GO:0046872
            GO:GO:0016324 SUPFAM:SSF56112 GO:GO:0043524 GO:GO:0046326
            GO:GO:0051092 GO:GO:2000353 GO:GO:0090004 GO:GO:0043220
            InterPro:IPR020454 PRINTS:PR00008 GO:GO:0045216 GO:GO:0042462
            GO:GO:0004697 GO:GO:0060252 GO:GO:0035089
            GeneTree:ENSGT00700000104096 OMA:RVKAYYK GO:GO:0034351
            EMBL:CU633686 Ensembl:ENSSSCT00000012856 Uniprot:F1SH28
        Length = 522

 Score = 115 (45.5 bits), Expect = 6.9e-05, P = 6.9e-05
 Identities = 20/30 (66%), Positives = 26/30 (86%)

Query:   129 GDPCLISTQMELEEAIRLYEVNHEPELVIH 158
             GDPC +S+Q+ELEEA RLYE+N + EL+IH
Sbjct:     1 GDPCTVSSQLELEEAFRLYELNKDSELLIH 30


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.325   0.140   0.467    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0      169       169   0.00082  108 3  11 22  0.48    31
                                                     31  0.47    34


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  26
  No. of states in DFA:  611 (65 KB)
  Total size of DFA:  190 KB (2106 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:01
  No. of threads or processors used:  24
  Search cpu time:  18.39u 0.12s 18.51t   Elapsed:  00:00:02
  Total cpu time:  18.39u 0.12s 18.51t   Elapsed:  00:00:03
  Start:  Thu Aug 15 13:47:59 2013   End:  Thu Aug 15 13:48:02 2013

Back to top