Diaphorina citri psyllid: psy516


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80
MPAEAATGKLPKPQLRNLLQSSIKVALVQGAVIAFGTAVAWKVLIMDPHKKAISEFYKTYDGEKDFERMKKAGLFEEYTL
ccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccccccccc
************PQLRNLLQSSIKVALVQGAVIAFGTAVAWKVLIMDPHKKAISEFYKTYDGEKDFERMKKAGLFEEYT*
xxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPAEAATGKLPKPQLRNLLQSSIKVALVQGAVIAFGTAVAWKVLIMDPHKKAISEFYKTYDGEKDFERMKKAGLFEEYTL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Cytochrome c oxidase subunit 6C This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.confidentA1XQT2
Cytochrome c oxidase subunit 6C This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.confidentP04038
Cytochrome c oxidase subunit 6C This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.confidentP09669

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044281 [BP]small molecule metabolic processprobableGO:0044710, GO:0008150, GO:0008152
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005751 [CC]mitochondrial respiratory chain complex IVprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043231, GO:0043234, GO:0032991, GO:0045277, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0022904 [BP]respiratory electron transport chainprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0022900, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0004129 [MF]cytochrome-c oxidase activityprobableGO:0022891, GO:0022890, GO:0022892, GO:0005215, GO:0008324, GO:0022857, GO:0015075, GO:0003824, GO:0015077, GO:0016676, GO:0016675, GO:0003674, GO:0015078, GO:0015002, GO:0016491

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1V54, chain I
Confidence level:very confident
Coverage over the Query: 8-79
View the alignment between query and template
View the model in PyMOL