Diaphorina citri psyllid: psy5188


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------11
MIALRNYIWDLQFDILIQLILTKEVMCEELKLKKLECEAWGFRLTGGRDFGTPLTVLRVTGTSVAEEGGMEVGDMIVSINGQCTQAMTHVEAQQHIIGSGNTLTLQILR
ccccccccccccccEEEcEEccccEEEEEEEEEEcccccccEEEEccccccccEEEEEEccccHHHccccccccEEEEEccEEcccccHHHHHHHHHHcccEEEEEEEc
**ALRNYIWDLQFDILIQLILTKEVMCEELKLKKLECEAWGFRLTGGRDFGTPLTVLRVTGTSVAEEGGMEVGDMIVSINGQCTQAMTHVEAQQHIIGSGNTLTLQILR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIALRNYIWDLQFDILIQLILTKEVMCEELKLKKLECEAWGFRLTGGRDFGTPLTVLRVTGTSVAEEGGMEVGDMIVSINGQCTQAMTHVEAQQHIIGSGNTLTLQILR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
PDZ and LIM domain protein 4 confidentP50479
PDZ and LIM domain protein 4 confidentP70271
PDZ and LIM domain protein 4 confidentP36202

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0030036 [BP]actin cytoskeleton organizationprobableGO:0006996, GO:0007010, GO:0030029, GO:0009987, GO:0016043, GO:0044763, GO:0071840, GO:0008150, GO:0044699
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0016020 [CC]membraneprobableGO:0005575
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005929 [CC]ciliumprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0042995, GO:0043227, GO:0043226
GO:0005925 [CC]focal adhesionprobableGO:0070161, GO:0005575, GO:0005912, GO:0005924, GO:0030054, GO:0030055
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0043296 [CC]apical junction complexprobableGO:0005575, GO:0030054, GO:0005911
GO:0022607 [BP]cellular component assemblyprobableGO:0044085, GO:0008150, GO:0071840, GO:0016043
GO:0030154 [BP]cell differentiationprobableGO:0032502, GO:0048869, GO:0009987, GO:0044763, GO:0008150, GO:0044699
GO:0030018 [CC]Z discprobableGO:0005737, GO:0005575, GO:0043229, GO:0043232, GO:0044464, GO:0031674, GO:0005623, GO:0005622, GO:0030016, GO:0030017, GO:0044444, GO:0043228, GO:0043292, GO:0044424, GO:0043226, GO:0044422, GO:0044449
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0042805 [MF]actinin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0005080 [MF]protein kinase C bindingprobableGO:0019899, GO:0019901, GO:0019900, GO:0003674, GO:0005488, GO:0005515
GO:0044456 [CC]synapse partprobableGO:0005575, GO:0045202

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2PKT, chain A
Confidence level:very confident
Coverage over the Query: 29-109
View the alignment between query and template
View the model in PyMOL
Template: 4FLN, chain A
Confidence level:probable
Coverage over the Query: 4-107
View the alignment between query and template
View the model in PyMOL