Query         psy5195
Match_columns 334
No_of_seqs    2 out of 4
Neff          1.2 
Searched_HMMs 46136
Date          Fri Aug 16 19:45:42 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5195.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5195hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1923|consensus               55.0     9.8 0.00021   40.6   2.8   20  260-279   299-318 (830)
  2 PF07538 ChW:  Clostridial hydr  52.8      12 0.00026   25.0   2.0   17   17-33     18-34  (36)
  3 KOG0921|consensus               52.4      20 0.00044   39.6   4.6   40  151-198  1155-1194(1282)
  4 PF12881 NUT_N:  NUT protein N   44.6      36 0.00079   33.2   4.6   51  254-304    19-74  (328)
  5 PF13003 MRL1:  Ribosomal prote  26.7      30 0.00064   30.0   0.8   15   26-40     92-106 (133)
  6 KOG2675|consensus               26.5      44 0.00096   34.0   2.1   12  277-288   257-268 (480)
  7 KOG0921|consensus               23.8      88  0.0019   35.0   3.8   49   87-139  1198-1246(1282)
  8 PHA01732 proline-rich protein   23.4      83  0.0018   26.3   2.8    9  257-265    10-18  (94)
  9 PF05385 Adeno_E4:  Mastadenovi  22.9      42 0.00091   28.5   1.0    9  264-272     3-11  (109)
 10 PF10480 ICAP-1_inte_bdg:  Beta  22.3      45 0.00097   30.7   1.2   15  163-177   140-154 (200)

No 1  
>KOG1923|consensus
Probab=55.03  E-value=9.8  Score=40.60  Aligned_cols=20  Identities=45%  Similarity=0.835  Sum_probs=11.0

Q ss_pred             CCCCCCCCCCCCcCCCCCCC
Q psy5195         260 PPAPVPYIPPPPVITPPVLP  279 (334)
Q Consensus       260 ppapvpyippppvitppvlp  279 (334)
                      +|.|++.+||||.+.|||.|
T Consensus       299 ~p~~~~~~pPppp~~ppv~~  318 (830)
T KOG1923|consen  299 SPLRLRCSPPPPPPFPPVGP  318 (830)
T ss_pred             CCCCCCCCCCCCCCCCCCCC
Confidence            34455556666665555554


No 2  
>PF07538 ChW:  Clostridial hydrophobic W;  InterPro: IPR006637 This hydrophobic repeat is found in a number of Chlostridium proteins. It contains a conserved tryptophan residue.
Probab=52.84  E-value=12  Score=25.03  Aligned_cols=17  Identities=47%  Similarity=0.600  Sum_probs=14.8

Q ss_pred             EEecceeeeEEEEEEee
Q psy5195          17 HLTGIGLAVQAFYINLT   33 (334)
Q Consensus        17 hltgiglavqafyinlt   33 (334)
                      --+|.++.+|||-|+||
T Consensus        18 Gt~G~~~rlEai~i~L~   34 (36)
T PF07538_consen   18 GTTGQGLRLEAIKIKLT   34 (36)
T ss_pred             ccCCCCcEEEEEEEEEe
Confidence            35788999999999997


No 3  
>KOG0921|consensus
Probab=52.36  E-value=20  Score=39.62  Aligned_cols=40  Identities=30%  Similarity=0.431  Sum_probs=29.9

Q ss_pred             eeeccccccCCCcceeecCCCCCccceeecCCcccccCCcccccCccc
Q psy5195         151 FSTSYNKHESGNKATYYDDGLGHGGSIQYGSKDHRSRDGVGNAFGGAY  198 (334)
Q Consensus       151 fstsy~k~esgnkatyyddglghgg~iqyg~kd~r~rdg~g~afgg~y  198 (334)
                      =||.|.+----+|-.+||.|.-.-        ..-+|.|-+.-+||||
T Consensus      1155 ~StrygDGp~PPKmaryDnG~~~n--------~SgyRRGgssysgGGY 1194 (1282)
T KOG0921|consen 1155 DSTRYGDGPGPPKMARYDNGPSNN--------NSGYRRGGSSYSGGGY 1194 (1282)
T ss_pred             ccccccCCCCCcccccccCCCccC--------ccccccCCCCCCCCCc
Confidence            388999988889999999984322        1235777777788877


No 4  
>PF12881 NUT_N:  NUT protein N terminus;  InterPro: IPR024309 This domain is found in the N-terminal region of Nuclear Testis (NUT) proteins. It is also found in FAM22, which are a family of uncharacterised mammalian proteins.
Probab=44.55  E-value=36  Score=33.19  Aligned_cols=51  Identities=39%  Similarity=0.773  Sum_probs=37.5

Q ss_pred             CCCCCCCCCCCCCC-----CCCCcCCCCCCCCCceeeeeccCCceeccccccCCCC
Q psy5195         254 PALPVLPPAPVPYI-----PPPPVITPPVLPQSPVISGVFSPNPVITKNYQPYPSH  304 (334)
Q Consensus       254 palpvlppapvpyi-----ppppvitppvlpqspvisgvfspnpvitknyqpypsh  304 (334)
                      .+||++||+|.|..     |+||.+|+...|.+|.+--.|---|+++-.=.+=|+-
T Consensus        19 ~aLPf~pp~pgP~~qp~wep~pP~~~~~fppg~PLvLsafP~tpLVagdgg~gpsg   74 (328)
T PF12881_consen   19 TALPFPPPAPGPPHQPPWEPPPPLMTAAFPPGNPLVLSAFPRTPLVAGDGGPGPSG   74 (328)
T ss_pred             ccCCCCCCCCCCCCCCCCCCCCCCcCCCCCCCCccccccCCCCccccCCCCCCCCC
Confidence            58999999998765     3467888888888888777777677777655554443


No 5  
>PF13003 MRL1:  Ribosomal protein L1;  InterPro: IPR024663 This entry represents a ribosomal protein L1 domain found mainly in chordates.
Probab=26.66  E-value=30  Score=30.04  Aligned_cols=15  Identities=40%  Similarity=0.660  Sum_probs=12.7

Q ss_pred             EEEEEEeeeeeeecc
Q psy5195          26 QAFYINLTLDTVMGG   40 (334)
Q Consensus        26 qafyinltldtvmgg   40 (334)
                      |.-|||||||..++=
T Consensus        92 Q~VYldL~Ldm~l~K  106 (133)
T PF13003_consen   92 QPVYLDLTLDMKLEK  106 (133)
T ss_pred             CcEEEeeeehhhhcc
Confidence            678999999988763


No 6  
>KOG2675|consensus
Probab=26.50  E-value=44  Score=34.02  Aligned_cols=12  Identities=8%  Similarity=-0.039  Sum_probs=6.4

Q ss_pred             CCCCCceeeeec
Q psy5195         277 VLPQSPVISGVF  288 (334)
Q Consensus       277 vlpqspvisgvf  288 (334)
                      .--++.-++.||
T Consensus       257 ~~~~k~~~~AlF  268 (480)
T KOG2675|consen  257 SDANKGGRGALF  268 (480)
T ss_pred             cccccccHHHHH
Confidence            333455566666


No 7  
>KOG0921|consensus
Probab=23.76  E-value=88  Score=35.00  Aligned_cols=49  Identities=37%  Similarity=0.691  Sum_probs=25.7

Q ss_pred             cCCCccCCCCccccCCcccCCCCCccccccccccCCcccccceeecCCccccC
Q psy5195          87 YGDRGYGAGGYTDANGFYHGNLGTKNGYDVGHAYGGGKDIGLTNVQGGSYGDV  139 (334)
Q Consensus        87 ~g~~~~~a~gy~d~ngfy~~n~g~~ngydvg~~ygg~~d~g~t~v~gg~yg~i  139 (334)
                      |++.+|+.+||--.-+.||.|.|+-    |++-|=|+.--|..+-.||-|.+.
T Consensus      1198 ys~gGygsGGYGgsa~~~~~~~Gag----vg~GyrGvsrgGfrnnggGdyrnp 1246 (1282)
T KOG0921|consen 1198 YSGGGYGSGGYGGSAPSARANYGAG----VGNGYRGVSRGGFRNNGGGDYRNP 1246 (1282)
T ss_pred             CCCCCcCCCCCCCCCCCCCCCcccc----ccCCCccccCCccccCCCCCCCCC
Confidence            4555666666666656666665542    344444444444444455544433


No 8  
>PHA01732 proline-rich protein
Probab=23.43  E-value=83  Score=26.28  Aligned_cols=9  Identities=33%  Similarity=0.560  Sum_probs=3.6

Q ss_pred             CCCCCCCCC
Q psy5195         257 PVLPPAPVP  265 (334)
Q Consensus       257 pvlppapvp  265 (334)
                      |..||+|+|
T Consensus        10 p~ppPpPpP   18 (94)
T PHA01732         10 PEPPAPLPP   18 (94)
T ss_pred             CCCCCCCCC
Confidence            344444333


No 9  
>PF05385 Adeno_E4:  Mastadenovirus early E4 13 kDa protein;  InterPro: IPR008680 This family consists of Homo sapiens and simian mastadenovirus early E4 13 kDa proteins. Human adenovirus 9 (HAdV-9) is unique in eliciting exclusively estrogen-dependent mammary tumours in Rattus spp. and in not requiring viral E1 region transforming genes for tumorigenicity. E4 codes for an oncoprotein essential for tumourigenesis by Ad9 [].
Probab=22.92  E-value=42  Score=28.47  Aligned_cols=9  Identities=67%  Similarity=1.630  Sum_probs=4.8

Q ss_pred             CCCCCCCCc
Q psy5195         264 VPYIPPPPV  272 (334)
Q Consensus       264 vpyippppv  272 (334)
                      .|-+|||||
T Consensus         3 LP~LPpPPv   11 (109)
T PF05385_consen    3 LPSLPPPPV   11 (109)
T ss_pred             CCCCCCCCC
Confidence            445555555


No 10 
>PF10480 ICAP-1_inte_bdg:  Beta-1 integrin binding protein;  InterPro: IPR019517  ICAP-1 is a serine/threonine-rich protein that binds to the cytoplasmic domains of beta-1 integrins in a highly specific manner, binding to a NPXY sequence motif on the beta-1 integrin. The cytoplasmic domains of integrins are essential for cell adhesion, and the fact that phosphorylation of ICAP-1 by interaction with the cell-matrix implies an important role of ICAP-1 during integrin-dependent cell adhesion []. Over expression of ICAP-1 strongly reduces the integrin-mediated cell spreading on extracellular matrix and inhibits both Cdc42 and Rac1. In addition, ICAP-1 induces release of Cdc42 from cellular membranes and prevents the dissociation of GDP from this GTPase []. An additional function of ICAP-1 is to promote differentiation of osteoprogenitors by supporting their condensation through modulating the integrin high affinity state []. 
Probab=22.25  E-value=45  Score=30.72  Aligned_cols=15  Identities=47%  Similarity=0.984  Sum_probs=12.3

Q ss_pred             cceeecCCCCCccce
Q psy5195         163 KATYYDDGLGHGGSI  177 (334)
Q Consensus       163 katyyddglghgg~i  177 (334)
                      .+++||||||||=.+
T Consensus       140 r~V~YdDGlG~g~~l  154 (200)
T PF10480_consen  140 RMVCYDDGLGAGKNL  154 (200)
T ss_pred             EEEEEecCcCCcceE
Confidence            468899999998665


Done!