BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= psy5246
(119 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|1P85|M Chain M, Real Space Refined Coordinates Of The 50s Subunit Fitted
Into The Low Resolution Cryo-Em Map Of The Ef-G.Gtp
State Of E. Coli 70s Ribosome
pdb|1P86|M Chain M, Real Space Refined Coordinates Of The 50s Subunit Fitted
Into The Low Resolution Cryo-Em Map Of The
Initiation-Like State Of E. Coli 70s Ribosome
pdb|2AW4|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli At 3.5 A Resolution. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2AWB|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli At 3.5 A Resolution. This File Contains
The 50s Subunit Of The Second 70s Ribosome. The Entire
Crystal Structure Contains Two 70s Ribosomes And Is
Described In Remark 400.
pdb|1VS6|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With The Antibiotic
Kasugamyin At 3.5a Resolution. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|1VS8|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With The Antibiotic
Kasugamyin At 3.5a Resolution. This File Contains The
50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2I2T|O Chain O, Crystal Structure Of Ribosome With Messenger Rna And The
Anticodon Stem-Loop Of P-Site Trna. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2I2V|O Chain O, Crystal Structure Of Ribosome With Messenger Rna And The
Anticodon Stem-Loop Of P-Site Trna. This File Contains
The 50s Subunit Of One 70s Ribosome. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2J28|O Chain O, Model Of E. Coli Srp Bound To 70s Rncs
pdb|2QOV|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin. This
File Contains The 50s Subunit Of The First 70s Ribosome.
The Entire Crystal Structure Contains Two 70s Ribosomes.
pdb|2QOX|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin. This
File Contains The 50s Subunit Of The Second 70s
Ribosome. The Entire Crystal Structure Contains Two 70s
Ribosomes.
pdb|2QOZ|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin And
Neomycin. This File Contains The 50s Subunit Of The
First 70s Ribosome, With Neomycin Bound. The Entire
Crystal Structure Contains Two 70s Ribosomes.
pdb|2QP1|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Spectinomycin And
Neomycin. This File Contains The 50s Subunit Of The
Second 70s Ribosome, With Neomycin Bound. The Entire
Crystal Structure Contains Two 70s Ribosomes.
pdb|2QAM|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Neomycin. This File
Contains The 50s Subunit Of The First 70s Ribosome, With
Neomycin Bound. The Entire Crystal Structure Contains
Two 70s Ribosomes And Is Described In Remark 400.
pdb|2QAO|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Neomycin. This File
Contains The 50s Subunit Of The Second 70s Ribosome,
With Neomycin Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QBA|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin. This File
Contains The 50s Subunit Of The First 70s Ribosome, With
Gentamicin Bound. The Entire Crystal Structure Contains
Two 70s Ribosomes And Is Described In Remark 400.
pdb|2QBC|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin. This File
Contains The 50s Subunit Of The Second 70s Ribosome,
With Gentamicin Bound. The Entire Crystal Structure
Contains Two 70s Ribosomes And Is Described In Remark
400.
pdb|2QBE|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Ribosome Recycling
Factor (Rrf). This File Contains The 50s Subunit Of The
First 70s Ribosome, With Rrf Bound. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2QBG|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Ribosome Recycling
Factor (Rrf). This File Contains The 50s Subunit Of The
Second 70s Ribosome, With Rrf Bound. The Entire Crystal
Structure Contains Two 70s Ribosomes And Is Described In
Remark 400.
pdb|2QBI|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin And Ribosome
Recycling Factor (Rrf). This File Contains The 50s
Subunit Of The First 70s Ribosome, With Gentamicin And
Rrf Bound. The Entire Crystal Structure Contains Two 70s
Ribosomes And Is Described In Remark 400.
pdb|2QBK|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Gentamicin And Ribosome
Recycling Factor (Rrf). This File Contains The 50s
Subunit Of The Second 70s Ribosome, With Gentamicin And
Rrf Bound. The Entire Crystal Structure Contains Two 70s
Ribosomes And Is Described In Remark 400.
pdb|2Z4L|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Paromomycin And
Ribosome Recycling Factor (Rrf). This File Contains The
50s Subunit Of The First 70s Ribosome, With Paromomycin
And Rrf Bound. The Entire Crystal Structure Contains Two
70s Ribosomes And Is Described In Remark 400.
pdb|2Z4N|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Paromomycin And
Ribosome Recycling Factor (Rrf). This File Contains The
50s Subunit Of The Second 70s Ribosome, With Paromomycin
And Rrf Bound. The Entire Crystal Structure Contains Two
70s Ribosomes And Is Described In Remark 400.
pdb|2VHM|O Chain O, Structure Of Pdf Binding Helix In Complex With The
Ribosome (Part 1 Of 4)
pdb|2VHN|O Chain O, Structure Of Pdf Binding Helix In Complex With The
Ribosome. (Part 2 Of 4)
pdb|2RDO|O Chain O, 50s Subunit With Ef-G(Gdpnp) And Rrf Bound
pdb|3DF2|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Hygromycin B. This File
Contains The 50s Subunit Of The First 70s Ribosome. The
Entire Crystal Structure Contains Two 70s Ribosomes.
pdb|3DF4|O Chain O, Crystal Structure Of The Bacterial Ribosome From
Escherichia Coli In Complex With Hygromycin B. This File
Contains The 50s Subunit Of The Second 70s Ribosome. The
Entire Crystal Structure Contains Two 70s Ribosomes.
pdb|3BBX|O Chain O, The Hsp15 Protein Fitted Into The Low Resolution Cryo-Em
Map 50s.Nc-Trna.Hsp15 Complex
pdb|3E1B|H Chain H, Structure Of The 50s Subunit Of E. Coli Ribosome In
Pre-Accommodation State
pdb|3E1D|H Chain H, Structure Of The 50s Subunit Of E. Coli Ribosome In
Post-Accommodation State
pdb|3I1N|O Chain O, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1P|O Chain O, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1R|O Chain O, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I1T|O Chain O, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I20|O Chain O, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3I22|O Chain O, Crystal Structure Of The E. Coli 70s Ribosome In An
Intermediate State Of Ratcheting
pdb|3KCR|O Chain O, Ribosome-Secy Complex. This Entry 3kcr Contains 50s
Ribosomal Subnit. The 30s Ribosomal Subunit Can Be Found
In Pdb Entry 3kc4
pdb|1VT2|O Chain O, Crystal Structure Of The E. Coli Ribosome Bound To
Cem-101. This File Contains The 50s Subunit Of The
Second 70s Ribosome.
pdb|3ORB|O Chain O, Crystal Structure Of The E. Coli Ribosome Bound To
Cem-101. This File Contains The 50s Subunit Of The First
70s Ribosome Bound To Cem-101.
pdb|3IZT|P Chain P, Structural Insights Into Cognate Vs. Near-Cognate
Discrimination During Decoding. This Entry Contains The
Large Subunit Of A Ribosome Programmed With A
Near-Cognate Codon.
pdb|3IZU|P Chain P, Structural Insights Into Cognate Vs. Near-Cognate
Discrimination During Decoding. This Entry Contains The
Large Subunit Of A Ribosome Programmed With A Cognate
Codon
pdb|3J01|O Chain O, Structure Of The Ribosome-Secye Complex In The Membrane
Environment
pdb|3SGF|S Chain S, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
State On A Rotated Conformation Of The Ribosome
pdb|3UOS|S Chain S, Crystal Structure Of Release Factor Rf3 Trapped In The Gtp
State On A Rotated Conformation Of The Ribosome (Without
Viomycin)
pdb|3J0T|Q Chain Q, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class2 Of The Six
Classes)
pdb|3J0W|Q Chain Q, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 4a Of The Six
Classes)
pdb|3J0Y|Q Chain Q, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 4b Of The Six
Classes)
pdb|3J11|Q Chain Q, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 3 Of The Six
Classes)
pdb|3J12|Q Chain Q, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 5 Of The Six
Classes)
pdb|3J14|Q Chain Q, Structural Characterization Of Mrna-Trna Translocation
Intermediates (50s Ribosome Of Class 6 Of The Six
Classes)
pdb|4GAR|O Chain O, Allosteric Control Of The Ribosome By Small-Molecule
Antibiotics
pdb|4GAU|O Chain O, Allosteric Control Of The Ribosome By Small-Molecule
Antibiotics
Length = 117
Score = 36.2 bits (82), Expect = 0.005, Method: Compositional matrix adjust.
Identities = 22/61 (36%), Positives = 39/61 (63%), Gaps = 1/61 (1%)
Query: 60 TKKHITGQIVHNNGN-VVVSASTNEWALKKHLYNTNDICAYSNLARVLAQRCLETGISEI 118
T +HI Q++ NG+ V+V+AST E A+ + L T + A + + + +A+R LE GI ++
Sbjct: 31 TPRHIYAQVIAPNGSEVLVAASTVEKAIAEQLKYTGNKDAAAAVGKAVAERALEKGIKDV 90
Query: 119 T 119
+
Sbjct: 91 S 91
>pdb|3FIK|O Chain O, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
Consists Of The 50s Subunit.
pdb|2WWQ|O Chain O, E.Coli 70s Ribosome Stalled During Translation Of Tnac
Leader Peptide. This File Contains The 50s, The P-Site
Trna And The Tnac Leader Peptide (Part 2 Of 2).
pdb|3OFQ|O Chain O, Crystal Structure Of The E. Coli Ribosome Bound To
Erythromycin. This File Contains The 50s Subunit Of The
Second 70s Ribosome.
pdb|3OFR|O Chain O, Crystal Structure Of The E. Coli Ribosome Bound To
Erythromycin. This File Contains The 50s Subunit Of The
First 70s Ribosome With Erthromycin Bound.
pdb|3OFC|O Chain O, Crystal Structure Of The E. Coli Ribosome Bound To
Chloramphenicol. This File Contains The 50s Subunit Of
The First 70s Ribosome With Chloramphenicol Bound.
pdb|3OFD|O Chain O, Crystal Structure Of The E. Coli Ribosome Bound To
Chloramphenicol. This File Contains The 50s Subunit Of
The Second 70s Ribosome.
pdb|3OFZ|O Chain O, Crystal Structure Of The E. Coli Ribosome Bound To
Clindamycin. This File Contains The 50s Subunit Of The
First 70s Ribosome Bound To Clindamycin.
pdb|3OG0|O Chain O, Crystal Structure Of The E. Coli Ribosome Bound To
Clindamycin. This File Contains The 50s Subunit Of The
Second 70s Ribosome.
pdb|3OAS|O Chain O, Crystal Structure Of The E. Coli Ribosome Bound To
Telithromycin. This File Contains The 50s Subunit Of The
Second 70s Ribosome.
pdb|3OAT|O Chain O, Crystal Structure Of The E. Coli Ribosome Bound To
Telithromycin. This File Contains The 50s Subunit Of The
First 70s Ribosome With Telithromycin Bound.
pdb|3R8S|O Chain O, Structures Of The Bacterial Ribosome In Classical And
Hybrid States Of Trna Binding
pdb|3R8T|O Chain O, Structures Of The Bacterial Ribosome In Classical And
Hybrid States Of Trna Binding
pdb|3J19|O Chain O, Structure Of The Bacterial Ribosome Complexed By
Tmrna-Smpb And Ef-G During Translocation And Mld-Loading
(50s Subunit)
Length = 116
Score = 36.2 bits (82), Expect = 0.005, Method: Compositional matrix adjust.
Identities = 22/61 (36%), Positives = 39/61 (63%), Gaps = 1/61 (1%)
Query: 60 TKKHITGQIVHNNGN-VVVSASTNEWALKKHLYNTNDICAYSNLARVLAQRCLETGISEI 118
T +HI Q++ NG+ V+V+AST E A+ + L T + A + + + +A+R LE GI ++
Sbjct: 30 TPRHIYAQVIAPNGSEVLVAASTVEKAIAEQLKYTGNKDAAAAVGKAVAERALEKGIKDV 89
Query: 119 T 119
+
Sbjct: 90 S 90
>pdb|2GYA|M Chain M, Structure Of The 50s Subunit Of A Pre-Translocational E.
Coli Ribosome Obtained By Fitting Atomic Models For Rna
And Protein Components Into Cryo-Em Map Emd-1056
pdb|2GYC|M Chain M, Structure Of The 50s Subunit Of A Secm-Stalled E. Coli
Ribosome Complex Obtained By Fitting Atomic Models For
Rna And Protein Components Into Cryo-Em Map Emd-1143
Length = 113
Score = 35.8 bits (81), Expect = 0.006, Method: Compositional matrix adjust.
Identities = 22/61 (36%), Positives = 39/61 (63%), Gaps = 1/61 (1%)
Query: 60 TKKHITGQIVHNNGN-VVVSASTNEWALKKHLYNTNDICAYSNLARVLAQRCLETGISEI 118
T +HI Q++ NG+ V+V+AST E A+ + L T + A + + + +A+R LE GI ++
Sbjct: 29 TPRHIYAQVIAPNGSEVLVAASTVEKAIAEQLKYTGNKDAAAAVGKAVAERALEKGIKDV 88
Query: 119 T 119
+
Sbjct: 89 S 89
>pdb|3BBO|Q Chain Q, Homology Model For The Spinach Chloroplast 50s Subunit
Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome
Length = 161
Score = 28.9 bits (63), Expect = 0.82, Method: Compositional matrix adjust.
Identities = 17/61 (27%), Positives = 36/61 (59%), Gaps = 3/61 (4%)
Query: 62 KHITGQIVHNNG-NVVVSASTNEWALKKHL-YNTND-ICAYSNLARVLAQRCLETGISEI 118
KH+ Q++ ++ + + SAST + ++ + L Y+++ I + V+A CLE GI+++
Sbjct: 75 KHLYVQVIDDSKMHTLASASTMQKSISEELDYSSSPTIEVAKKVGEVIASACLEKGITKV 134
Query: 119 T 119
Sbjct: 135 A 135
>pdb|3I3O|A Chain A, 2.06 Angstrom Resolution Crystal Structure Of A Short
Chain Dehydrogenase From Bacillus Anthracis Str. 'ames
Ancestor' In Complex With Nad-acetone
pdb|3I3O|B Chain B, 2.06 Angstrom Resolution Crystal Structure Of A Short
Chain Dehydrogenase From Bacillus Anthracis Str. 'ames
Ancestor' In Complex With Nad-acetone
pdb|3I3O|C Chain C, 2.06 Angstrom Resolution Crystal Structure Of A Short
Chain Dehydrogenase From Bacillus Anthracis Str. 'ames
Ancestor' In Complex With Nad-acetone
pdb|3I3O|D Chain D, 2.06 Angstrom Resolution Crystal Structure Of A Short
Chain Dehydrogenase From Bacillus Anthracis Str. 'ames
Ancestor' In Complex With Nad-acetone
pdb|3I3O|E Chain E, 2.06 Angstrom Resolution Crystal Structure Of A Short
Chain Dehydrogenase From Bacillus Anthracis Str. 'ames
Ancestor' In Complex With Nad-acetone
pdb|3I3O|F Chain F, 2.06 Angstrom Resolution Crystal Structure Of A Short
Chain Dehydrogenase From Bacillus Anthracis Str. 'ames
Ancestor' In Complex With Nad-acetone
pdb|3I3O|G Chain G, 2.06 Angstrom Resolution Crystal Structure Of A Short
Chain Dehydrogenase From Bacillus Anthracis Str. 'ames
Ancestor' In Complex With Nad-acetone
pdb|3I3O|H Chain H, 2.06 Angstrom Resolution Crystal Structure Of A Short
Chain Dehydrogenase From Bacillus Anthracis Str. 'ames
Ancestor' In Complex With Nad-acetone
Length = 291
Score = 28.5 bits (62), Expect = 0.88, Method: Compositional matrix adjust.
Identities = 12/55 (21%), Positives = 28/55 (50%), Gaps = 4/55 (7%)
Query: 27 PRNLERLRIARKPQGYHLDRLGREY----WHTLYFTTTKKHITGQIVHNNGNVVV 77
P + + ++++ + R G+ Y + ++ ++TGQ++H NG V+V
Sbjct: 235 PSSFDEKKVSQFGSNVPMQRPGQPYELAPAYVYLASSDSSYVTGQMIHVNGGVIV 289
>pdb|2UXQ|A Chain A, Isocitrate Dehydrogenase From The Psychrophilic Bacterium
Desulfotalea Psychrophila: Biochemical Properties And
Crystal Structure Analysis
pdb|2UXQ|B Chain B, Isocitrate Dehydrogenase From The Psychrophilic Bacterium
Desulfotalea Psychrophila: Biochemical Properties And
Crystal Structure Analysis
pdb|2UXQ|C Chain C, Isocitrate Dehydrogenase From The Psychrophilic Bacterium
Desulfotalea Psychrophila: Biochemical Properties And
Crystal Structure Analysis
pdb|2UXQ|D Chain D, Isocitrate Dehydrogenase From The Psychrophilic Bacterium
Desulfotalea Psychrophila: Biochemical Properties And
Crystal Structure Analysis
pdb|2UXR|A Chain A, Complex With Isocitrate And The Protein Isocitrate
Dehydrogenase From The Psychrophilic Bacterium
Desulfotalea Psychrophila
pdb|2UXR|B Chain B, Complex With Isocitrate And The Protein Isocitrate
Dehydrogenase From The Psychrophilic Bacterium
Desulfotalea Psychrophila
pdb|4AOV|A Chain A, Dpidh-Nadp. The Complex Structures Of Isocitrate
Dehydrogenase From Clostridium Thermocellum And
Desulfotalea Psychrophila, Support A New Active Site
Locking Mechanism
Length = 402
Score = 28.5 bits (62), Expect = 0.97, Method: Composition-based stats.
Identities = 13/53 (24%), Positives = 25/53 (47%)
Query: 62 KHITGQIVHNNGNVVVSASTNEWALKKHLYNTNDICAYSNLARVLAQRCLETG 114
+H+ G+ N ++ A T + L T D+CA+ + + C+E+G
Sbjct: 314 QHLKGERTSTNPVALIYAWTGALRKRGELDGTPDLCAFCDSLEAITIECIESG 366
>pdb|1UP3|A Chain A, Structure Of The Endoglucanase Cel6 From Mycobacterium
Tuberculosis In Complex With
Methyl-Cellobiosyl-4-Deoxy-4-Thio-Beta-D-Cellobioside
At 1.6 Angstrom
Length = 294
Score = 27.3 bits (59), Expect = 2.2, Method: Compositional matrix adjust.
Identities = 13/30 (43%), Positives = 15/30 (50%)
Query: 17 AAGKCVHNKNPRNLERLRIARKPQGYHLDR 46
AA N NP N E +A PQ Y LD+
Sbjct: 17 AAMVAARNANPPNAELTSVANTPQSYWLDQ 46
>pdb|1UOZ|A Chain A, Structure Of The Endoglucanase Cel6 From Mycobacterium
Tuberculosis In Complex With Thiocellopentaose At 1.1
Angstrom
Length = 315
Score = 27.3 bits (59), Expect = 2.3, Method: Compositional matrix adjust.
Identities = 13/30 (43%), Positives = 15/30 (50%)
Query: 17 AAGKCVHNKNPRNLERLRIARKPQGYHLDR 46
AA N NP N E +A PQ Y LD+
Sbjct: 38 AAMVAARNANPPNAELTSVANTPQSYWLDQ 67
>pdb|3IDO|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase From
Entamoeba Histolytica With A Phosphotyrosine Crude
Mimic Hepes Molecule In The Active Site
pdb|3IDO|B Chain B, Crystal Structure Of Protein Tyrosine Phosphatase From
Entamoeba Histolytica With A Phosphotyrosine Crude
Mimic Hepes Molecule In The Active Site
pdb|3ILY|A Chain A, Apo Crystal Structure Of Protein Tyrosine Phosphatase
From Entamoeba Histolytica Featuring A Disordered
Active Site
pdb|3ILY|B Chain B, Apo Crystal Structure Of Protein Tyrosine Phosphatase
From Entamoeba Histolytica Featuring A Disordered
Active Site
pdb|3JS5|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase From
Entamoeba Histolytica With Hepes In The Active Site.
High Resolution, Alternative Crystal Form With 1
Molecule In Asymmetric Unit
Length = 178
Score = 26.2 bits (56), Expect = 5.1, Method: Compositional matrix adjust.
Identities = 11/41 (26%), Positives = 21/41 (51%)
Query: 9 LLSNNVTGAAGKCVHNKNPRNLERLRIARKPQGYHLDRLGR 49
L + +AG C +++ + R+R K +GY +D + R
Sbjct: 51 LTEKYICDSAGTCSYHEGQQADSRMRKVGKSRGYQVDSISR 91
>pdb|3JVI|A Chain A, Product State Mimic Crystal Structure Of Protein
Tyrosine Phosphatase From Entamoeba Histolytica
Length = 161
Score = 26.2 bits (56), Expect = 5.4, Method: Compositional matrix adjust.
Identities = 11/41 (26%), Positives = 21/41 (51%)
Query: 9 LLSNNVTGAAGKCVHNKNPRNLERLRIARKPQGYHLDRLGR 49
L + +AG C +++ + R+R K +GY +D + R
Sbjct: 34 LTEKYICDSAGTCSYHEGQQADSRMRKVGKSRGYQVDSISR 74
>pdb|3PVR|B Chain B, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex With
Benzoyl-Coa
pdb|3PVR|C Chain C, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex With
Benzoyl-Coa
pdb|3PVT|B Chain B, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex With
3- Hydroxybutanoyl-Coa
pdb|3PVT|C Chain C, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex With
3- Hydroxybutanoyl-Coa
pdb|3PVY|B Chain B, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex With
Coenzyme A
pdb|3PVY|C Chain C, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex With
Coenzyme A
pdb|3PW1|B Chain B, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex With
Phenylacetyl- Coa
pdb|3PW1|C Chain C, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex With
Phenylacetyl- Coa
pdb|3PW8|A Chain A, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex With
Acetyl-Coa
pdb|3PW8|B Chain B, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex With
Acetyl-Coa
pdb|3PWQ|A Chain A, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex
pdb|3PWQ|B Chain B, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex
pdb|3PWQ|E Chain E, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex
pdb|3PWQ|G Chain G, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex
pdb|3PWQ|I Chain I, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex
pdb|3PWQ|J Chain J, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex
pdb|3PWQ|K Chain K, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex
pdb|3PWQ|R Chain R, The Phenylacetyl-Coa Monooxygenase Paaac Subcomplex
Length = 259
Score = 25.8 bits (55), Expect = 7.4, Method: Compositional matrix adjust.
Identities = 14/68 (20%), Positives = 24/68 (35%), Gaps = 4/68 (5%)
Query: 16 GAAGKCVHNKNPRNLERLRIARKPQGYHLDRLGREY----WHTLYFTTTKKHITGQIVHN 71
G ++ R L + +P G D + R+Y WH FT + Q+
Sbjct: 74 GDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAI 133
Query: 72 NGNVVVSA 79
+ + A
Sbjct: 134 SAKAIKEA 141
>pdb|1OTK|A Chain A, Structural Genomics, Protein Paac
pdb|1OTK|B Chain B, Structural Genomics, Protein Paac
Length = 249
Score = 25.4 bits (54), Expect = 8.7, Method: Compositional matrix adjust.
Identities = 14/68 (20%), Positives = 24/68 (35%), Gaps = 4/68 (5%)
Query: 16 GAAGKCVHNKNPRNLERLRIARKPQGYHLDRLGREY----WHTLYFTTTKKHITGQIVHN 71
G ++ R L + +P G D + R+Y WH FT + Q+
Sbjct: 64 GDEDTLAFTRDERQFSNLLLVEQPNGNFADTIARQYFIDAWHVALFTRLMESRDPQLAAI 123
Query: 72 NGNVVVSA 79
+ + A
Sbjct: 124 SAKAIKEA 131
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.319 0.131 0.401
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,476,993
Number of Sequences: 62578
Number of extensions: 129072
Number of successful extensions: 302
Number of sequences better than 100.0: 17
Number of HSP's better than 100.0 without gapping: 12
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 287
Number of HSP's gapped (non-prelim): 17
length of query: 119
length of database: 14,973,337
effective HSP length: 81
effective length of query: 38
effective length of database: 9,904,519
effective search space: 376371722
effective search space used: 376371722
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 45 (21.9 bits)