Diaphorina citri psyllid: psy5246


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------12
MFAKKTTRLLSNNVTGAAGKCVHNKNPRNLERLRIARKPQGYHLDRLGREYWHTLYFTTTKKHITGQIVHNNGNVVVSASTNEWALKKHLYNTNDICAYSNLARVLAQRCLETGISEIT
cccccccccccccccccccccccccccccHHHHHHHcccccccccccccccEEEEEEEEccccEEEEEEEccccEEEEEEcccHHHHHHccccccHHHHHHHHHHHHHHHHHccccccc
******************GKCVHNKNPRNLERLRIARKPQGYHLDRLGREYWHTLYFTTTKKHITGQIVHNNGNVVVSASTNEWALKKHLYNTNDICAYSNLARVLAQRCLETGISEIT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFAKKTTRLLSNNVTGAAGKCVHNKNPRNLERLRIARKPQGYHLDRLGREYWHTLYFTTTKKHITGQIVHNNGNVVVSASTNEWALKKHLYNTNDICAYSNLARVLAQRCLETGISEIT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
39S ribosomal protein L18, mitochondrial Together with thiosulfate sulfurtransferase (TST), acts as a mitochondrial import factor for the cytosolic 5S rRNA. The precursor form shows RNA chaperone activity; is able to fold the 5S rRNA into an import-competent conformation that is recognized by rhodanese (TST). Both the cytoplasmic and mitochondrial forms are able to bind to the helix IV-loop D in the gamma domain of the 5S rRNA.confidentQ9CQL5
39S ribosomal protein L18, mitochondrial Together with thiosulfate sulfurtransferase (TST), acts as a mitochondrial import factor for the cytosolic 5S rRNA. The precursor form shows RNA chaperone activity; is able to fold the 5S rRNA into an import-competent conformation that is recognized by rhodanese (TST). Both the cytoplasmic and mitochondrial forms are able to bind to the helix IV-loop D in the gamma domain of the 5S rRNA.confidentQ3ZBR7
39S ribosomal protein L18, mitochondrial Together with thiosulfate sulfurtransferase (TST), acts as a mitochondrial import factor for the cytosolic 5S rRNA. The precursor form shows RNA chaperone activity; is able to fold the 5S rRNA into an import-competent conformation that is recognized by rhodanese (TST). Both the cytoplasmic and mitochondrial forms are able to bind to the helix IV-loop D in the gamma domain of the 5S rRNA.confidentQ9H0U6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035928 [BP]rRNA import into mitochondrionprobableGO:0015931, GO:0051029, GO:0044699, GO:0071705, GO:0071702, GO:0006403, GO:0006810, GO:0009987, GO:0044765, GO:0044763, GO:0051649, GO:0006839, GO:0051236, GO:0051234, GO:0051179, GO:0051641, GO:0050658, GO:0033036, GO:0046907, GO:0050657, GO:0008150, GO:0035927
GO:0008097 [MF]5S rRNA bindingprobableGO:0097159, GO:0019843, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BBO, chain Q
Confidence level:very confident
Coverage over the Query: 25-119
View the alignment between query and template
View the model in PyMOL