BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy5271
         (113 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2FUG|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 pdb|2FUG|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 pdb|2FUG|O Chain O, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 pdb|2FUG|X Chain X, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus
 pdb|3I9V|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 2 MolASU
 pdb|3I9V|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 2 MolASU
 pdb|3IAM|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Reduced, 2 MolASU,
           WITH BOUND NADH
 pdb|3IAM|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Reduced, 2 MolASU,
           WITH BOUND NADH
 pdb|3IAS|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           RE-Refined To 3.15 Angstrom Resolution
 pdb|3IAS|F Chain F, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           RE-Refined To 3.15 Angstrom Resolution
 pdb|3IAS|O Chain O, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           RE-Refined To 3.15 Angstrom Resolution
 pdb|3IAS|X Chain X, Crystal Structure Of The Hydrophilic Domain Of Respiratory
           Complex I From Thermus Thermophilus, Oxidized, 4 MolASU,
           RE-Refined To 3.15 Angstrom Resolution
 pdb|3M9S|6 Chain 6, Crystal Structure Of Respiratory Complex I From Thermus
           Thermophilus
 pdb|3M9S|F Chain F, Crystal Structure Of Respiratory Complex I From Thermus
           Thermophilus
 pdb|2YBB|6 Chain 6, Fitted Model For Bovine  Mitochondrial Supercomplex
           I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
 pdb|4HEA|6 Chain 6, Crystal Structure Of The Entire Respiratory Complex I From
           Thermus Thermophilus
 pdb|4HEA|G Chain G, Crystal Structure Of The Entire Respiratory Complex I From
           Thermus Thermophilus
          Length = 181

 Score = 69.7 bits (169), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 39/93 (41%), Positives = 52/93 (55%), Gaps = 8/93 (8%)

Query: 17  FLTPPR-----IEPGSTTCKASAVTTTSW--MLEPRWVISMGSCANXXXXXXXXXXXXXX 69
           F   PR     I  G  + K + V    W  M +P+WVISMG+CA+              
Sbjct: 68  FRASPRQADVMIVAGRLSKKMAPVMRRVWEQMPDPKWVISMGACASSGGMFNNYAIVQN- 126

Query: 70  CDRIIPVDIYVPGCPPTAEALMYGILQLQKKVK 102
            D ++PVD+YVPGCPP  EAL+Y ++QLQKKV+
Sbjct: 127 VDSVVPVDVYVPGCPPRPEALIYAVMQLQKKVR 159


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.325    0.136    0.446 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 2,845,723
Number of Sequences: 62578
Number of extensions: 74763
Number of successful extensions: 207
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 205
Number of HSP's gapped (non-prelim): 7
length of query: 113
length of database: 14,973,337
effective HSP length: 77
effective length of query: 36
effective length of database: 10,154,831
effective search space: 365573916
effective search space used: 365573916
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 45 (21.9 bits)