Diaphorina citri psyllid: psy5271

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MVFIYRPFTASLQLTNFLTPPRIEPGSTTCKASAVTTTSWMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWYRR
ccccccccccccccccccccccEEEccccccccHHHHHcccccccEEEEcccccccccccEEccEEEccccEEEEcEEEcccccccHHHHHHHHHHHHHHHHHcccccHHHcc
*VFIYRPFTASLQLTNFLTPPRIEPGSTTCKASAVTTTSWMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWY**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFIYRPFTASLQLTNFLTPPRIEPGSTTCKASAVTTTSWMLEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPTAEALMYGILQLQKKVKRMKILQSWYRR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
NADH-quinone oxidoreductase subunit B NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.very confidentQ2W3I5
NADH-quinone oxidoreductase subunit B 2 NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.very confidentQ3J829
NADH-quinone oxidoreductase subunit B NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient.confidentA1WLP3

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0097060 [CC]synaptic membraneprobableGO:0005575, GO:0044456, GO:0016020, GO:0045202
GO:0022904 [BP]respiratory electron transport chainprobableGO:0044710, GO:0015980, GO:0009987, GO:0044237, GO:0022900, GO:0045333, GO:0008152, GO:0008150, GO:0006091, GO:0055114
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0000302 [BP]response to reactive oxygen speciesprobableGO:1901700, GO:0050896, GO:0006950, GO:0008150, GO:0042221, GO:0006979
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0003954 [MF]NADH dehydrogenase activityprobableGO:0003824, GO:0003674, GO:0016651, GO:0016491
GO:0043005 [CC]neuron projectionprobableGO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0005747 [CC]mitochondrial respiratory chain complex IprobableGO:0044464, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016020, GO:0005740, GO:0005739, GO:0044455, GO:0031967, GO:0031966, GO:0043234, GO:0045271, GO:0032991, GO:0043231, GO:0030964, GO:0019866, GO:0005623, GO:0005622, GO:0044446, GO:0005743, GO:0044444, GO:0005746, GO:0044429, GO:0044424, GO:0044425, GO:0070469, GO:0044422
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0032981 [BP]mitochondrial respiratory chain complex I assemblyprobableGO:0006996, GO:0033108, GO:0044699, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0097031, GO:0006461, GO:0010257, GO:0016043, GO:0065003, GO:0044085, GO:0044763, GO:0071840, GO:0034622, GO:0008150, GO:0009987, GO:0043623, GO:0007005

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.6.-.-Acting on NADH or NADPH.probable
1.6.99.-With other acceptors.probable
1.6.99.5NADH dehydrogenase (quinone).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3I9V, chain 6
Confidence level:very confident
Coverage over the Query: 22-112
View the alignment between query and template
View the model in PyMOL