Query         psy5287
Match_columns 65
No_of_seqs    109 out of 161
Neff          3.6 
Searched_HMMs 46136
Date          Fri Aug 16 22:42:24 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5287.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5287hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01200 Ribosomal_S28e:  Ribos 100.0 5.3E-42 1.2E-46  212.1   7.1   65    1-65      1-69  (69)
  2 cd04457 S1_S28E S1_S28E: S28E, 100.0   1E-40 2.2E-45  202.2   6.6   60    6-65      1-60  (60)
  3 PTZ00085 40S ribosomal protein 100.0 2.2E-39 4.8E-44  202.5   7.5   63    3-65      8-73  (73)
  4 PRK04007 rps28e 30S ribosomal  100.0 2.3E-39 4.9E-44  201.1   7.4   62    4-65      5-68  (70)
  5 KOG3502|consensus              100.0 2.7E-40 5.7E-45  203.2   0.3   64    1-65      1-66  (66)
  6 COG2053 RPS28A Ribosomal prote 100.0 4.4E-35 9.5E-40  181.4   6.0   61    5-65      5-67  (69)
  7 KOG0187|consensus               72.2     2.7 5.8E-05   29.2   1.7   20   42-62     62-81  (134)
  8 TIGR00008 infA translation ini  67.9      25 0.00054   21.4   5.2   43    5-56      6-55  (68)
  9 COG0361 InfA Translation initi  60.4      39 0.00085   21.1   5.3   45    5-58      8-59  (75)
 10 cd05793 S1_IF1A S1_IF1A: Trans  59.9      36 0.00077   20.8   4.8   46    6-60      2-53  (77)
 11 PF01176 eIF-1a:  Translation i  58.4     7.7 0.00017   22.6   1.6   43    6-57      5-53  (65)
 12 PF00833 Ribosomal_S17e:  Ribos  53.4     4.2   9E-05   27.6  -0.1   21   41-62     61-81  (121)
 13 TIGR03635 S17_bact 30S ribosom  53.3      18 0.00039   22.0   2.7   23   35-57     38-60  (71)
 14 TIGR00074 hypC_hupF hydrogenas  51.9      38 0.00081   20.9   4.0   40    6-54      5-44  (76)
 15 cd03701 IF2_IF5B_II IF2_IF5B_I  51.3      12 0.00027   23.2   1.8   25   40-64     65-89  (95)
 16 PLN00208 translation initiatio  50.7      63  0.0014   22.4   5.4   42    5-55     33-80  (145)
 17 PF11213 DUF3006:  Protein of u  49.4      15 0.00032   21.8   1.9   13   42-54     30-42  (71)
 18 PF13533 Biotin_lipoyl_2:  Biot  49.1      12 0.00025   20.6   1.3   17   45-61     23-39  (50)
 19 PTZ00329 eukaryotic translatio  48.1      70  0.0015   22.5   5.3   43    5-56     33-81  (155)
 20 PTZ00154 40S ribosomal protein  46.8      11 0.00023   26.2   1.0   24   38-62     58-81  (134)
 21 CHL00142 rps17 ribosomal prote  45.6      24 0.00052   22.2   2.5   24   35-58     40-63  (84)
 22 PRK05610 rpsQ 30S ribosomal pr  44.3      30 0.00064   21.7   2.7   23   35-57     43-65  (84)
 23 PF07892 DUF1667:  Protein of u  44.0      11 0.00025   23.8   0.8   13   41-53     56-68  (82)
 24 PF14801 GCD14_N:  tRNA methylt  43.9      14 0.00031   22.0   1.2   15   43-57      3-17  (54)
 25 PF00018 SH3_1:  SH3 domain;  I  43.3      14  0.0003   19.6   1.0   14   45-58     15-28  (48)
 26 cd03702 IF2_mtIF2_II This fami  43.1      18  0.0004   22.7   1.7   24   41-64     66-89  (95)
 27 cd03440 hot_dog The hotdog fol  42.3      19  0.0004   18.0   1.4   15   41-55     53-67  (100)
 28 cd03451 FkbR2 FkbR2 is a Strep  42.1      17 0.00037   22.6   1.4   15   40-54     86-100 (146)
 29 COG1096 Predicted RNA-binding   41.9      64  0.0014   23.4   4.5   43    5-53     67-126 (188)
 30 PRK12442 translation initiatio  41.8      94   0.002   20.0   5.2   42    5-55      8-56  (87)
 31 PRK13692 (3R)-hydroxyacyl-ACP   40.4      18 0.00039   24.2   1.4   14   41-54     92-105 (159)
 32 PF11584 Toxin_ToxA:  Proteinac  39.4      30 0.00064   23.2   2.3   43   13-55     28-87  (118)
 33 COG0186 RpsQ Ribosomal protein  39.1      18 0.00039   23.2   1.2   12   46-57     56-67  (87)
 34 TIGR03028 EpsE polysaccharide   38.8      31 0.00066   24.3   2.4   13   45-57    225-237 (239)
 35 COG1607 Acyl-CoA hydrolase [Li  37.8      36 0.00078   23.6   2.6   27   20-55     53-79  (157)
 36 PRK10413 hydrogenase 2 accesso  37.2   1E+02  0.0023   19.2   4.9   41    6-54      5-51  (82)
 37 PRK10694 acyl-CoA esterase; Pr  36.3      23  0.0005   23.1   1.4   14   41-54     63-76  (133)
 38 cd04456 S1_IF1A_like S1_IF1A_l  35.8   1E+02  0.0023   18.8   5.1   44    6-58      2-51  (78)
 39 PF12791 RsgI_N:  Anti-sigma fa  34.0      85  0.0018   17.2   3.9   31   29-59      9-39  (56)
 40 PF04149 DUF397:  Domain of unk  33.9      90  0.0019   17.9   3.5   38   18-61     12-49  (56)
 41 cd03708 GTPBP_III Domain III o  33.4   1E+02  0.0022   17.8   4.8   28    6-33     34-61  (87)
 42 PRK04424 fatty acid biosynthes  32.4      28 0.00061   23.8   1.4   14   41-54    134-147 (185)
 43 cd03452 MaoC_C MaoC_C  The C-t  32.2      30 0.00066   22.1   1.4   14   41-54     84-97  (142)
 44 CHL00036 ycf4 photosystem I as  32.1      63  0.0014   23.4   3.1   43   22-64    124-173 (184)
 45 PRK07217 replication factor A;  31.6 2.1E+02  0.0046   22.1   6.1   48    6-56     87-138 (311)
 46 PF12961 DUF3850:  Domain of Un  31.2      47   0.001   20.6   2.1   25   35-59     18-42  (72)
 47 cd03455 SAV4209 SAV4209 is a S  29.6      34 0.00074   21.0   1.3   15   40-54     74-88  (123)
 48 PRK02542 photosystem I assembl  29.5      74  0.0016   23.1   3.1   43   22-64    128-177 (188)
 49 TIGR03000 plancto_dom_1 Planct  29.5      96  0.0021   19.4   3.3   30   24-54     44-73  (75)
 50 smart00652 eIF1a eukaryotic tr  29.3 1.4E+02  0.0031   18.3   5.2   45    5-58      6-56  (83)
 51 cd03446 MaoC_like MoaC_like     28.3      39 0.00085   20.8   1.4   14   41-54     86-99  (140)
 52 cd00174 SH3 Src homology 3 dom  28.1      41 0.00089   16.7   1.3   13   45-57     17-29  (54)
 53 cd03441 R_hydratase_like (R)-h  27.6      40 0.00088   19.9   1.3   14   42-55     77-90  (127)
 54 CHL00010 infA translation init  27.0 1.5E+02  0.0032   17.8   5.3   41    6-55      9-56  (78)
 55 cd01288 FabZ FabZ is a 17kD be  27.0      42 0.00091   20.2   1.3   13   42-54     84-96  (131)
 56 PF08402 TOBE_2:  TOBE domain;   26.7 1.1E+02  0.0024   16.3   4.2   45    7-55     19-66  (75)
 57 smart00326 SH3 Src homology 3   26.7      45 0.00098   16.7   1.3   13   46-58     21-33  (58)
 58 PRK14699 replication factor A;  26.0 2.4E+02  0.0053   22.6   5.7   50    5-56     71-134 (484)
 59 cd03449 R_hydratase (R)-hydrat  25.9      47   0.001   19.7   1.4   15   40-54     77-91  (128)
 60 PF02392 Ycf4:  Ycf4;  InterPro  25.5      97  0.0021   22.3   3.1   43   22-64    121-170 (180)
 61 KOG2716|consensus               25.4      24 0.00052   25.9   0.1   18   46-64     64-81  (230)
 62 cd03453 SAV4209_like SAV4209_l  25.2      47   0.001   20.5   1.4   15   41-55     76-90  (127)
 63 TIGR00523 eIF-1A eukaryotic/ar  25.2 1.9E+02  0.0042   18.5   5.4   41    5-54     20-66  (99)
 64 PF14604 SH3_9:  Variant SH3 do  25.0      42 0.00091   18.2   1.0   13   45-57     14-26  (49)
 65 cd04091 mtEFG1_II_like mtEFG1_  24.9      37 0.00079   19.7   0.8   22   37-58     17-38  (81)
 66 cd03703 aeIF5B_II aeIF5B_II: T  24.8   2E+02  0.0044   18.8   4.4   26   38-64     79-104 (110)
 67 cd03691 BipA_TypA_II BipA_TypA  24.6 1.5E+02  0.0033   17.0   3.7   21   37-57     18-38  (86)
 68 PF09874 DUF2101:  Predicted me  24.5   1E+02  0.0022   22.7   3.2   46    6-60    145-196 (206)
 69 PRK06386 replication factor A;  24.4 3.3E+02  0.0071   21.2   6.1   48    6-56    122-174 (358)
 70 cd03447 FAS_MaoC FAS_MaoC, the  24.3      49  0.0011   21.0   1.3   14   41-54     76-89  (126)
 71 COG3365 Uncharacterized protei  24.2      43 0.00093   22.8   1.1   18   38-55     22-39  (118)
 72 PRK08572 rps17p 30S ribosomal   23.6      85  0.0018   20.7   2.4   22   36-57     67-89  (108)
 73 PF11095 Gemin7:  Gem-associate  23.5 1.6E+02  0.0034   18.6   3.5   30   25-54     36-76  (80)
 74 PRK00006 fabZ (3R)-hydroxymyri  23.4      52  0.0011   20.8   1.3   14   42-55     98-111 (147)
 75 COG0298 HypC Hydrogenase matur  23.1 2.2E+02  0.0047   18.3   4.4   38    6-54      5-47  (82)
 76 PRK10409 hydrogenase assembly   23.1 2.1E+02  0.0045   18.2   4.1   41    6-54      5-50  (90)
 77 PF08817 YukD:  WXG100 protein   22.8      50  0.0011   19.4   1.1   11   45-55     69-79  (79)
 78 PF07653 SH3_2:  Variant SH3 do  22.6      40 0.00086   18.3   0.6   12   46-57     18-30  (55)
 79 PF01455 HupF_HypC:  HupF/HypC   22.3      77  0.0017   18.9   1.9   42    6-54      5-46  (68)
 80 PRK13691 (3R)-hydroxyacyl-ACP   22.1      57  0.0012   22.0   1.4   13   42-54     93-105 (166)
 81 PF05550 Peptidase_C53:  Pestiv  22.0      99  0.0021   22.2   2.6   26    5-30    109-135 (168)
 82 TIGR00413 rlpA rare lipoprotei  21.8 1.6E+02  0.0035   21.6   3.7   35   24-58     37-72  (208)
 83 PTZ00241 40S ribosomal protein  21.7      53  0.0011   23.2   1.2   13   45-57    116-128 (158)
 84 PF04280 Tim44:  Tim44-like dom  21.4 2.1E+02  0.0046   17.8   3.9   39    6-49     77-115 (147)
 85 cd03450 NodN NodN (nodulation   21.0      57  0.0012   21.5   1.2   14   41-54     93-106 (149)
 86 PF03061 4HBT:  Thioesterase su  20.9      77  0.0017   17.0   1.5   15   40-54     38-52  (79)
 87 TIGR01750 fabZ beta-hydroxyacy  20.2      68  0.0015   20.0   1.4   14   41-54     93-106 (140)
 88 PRK11536 6-N-hydroxylaminopuri  20.0      58  0.0013   23.6   1.1   16   43-58    151-166 (223)

No 1  
>PF01200 Ribosomal_S28e:  Ribosomal protein S28e;  InterPro: IPR000289 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ].  A number of eukaryotic and archaebacterial ribosomal proteins can be grouped on the basis of sequence similarities. Examples are:  Mammalian S28 [] Plant S28 [] Fungi S33 [] Archaebacterial S28e.   These proteins have from 64 to 78 amino acids and a highly conserved C-terminal region.; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 3IZ6_Y 2XZN_1 2XZM_1 1NY4_A 1NE3_A 3U5C_c 3U5G_c 3O30_R 3O2Z_R 3IZB_Y.
Probab=100.00  E-value=5.3e-42  Score=212.12  Aligned_cols=65  Identities=77%  Similarity=1.137  Sum_probs=52.2

Q ss_pred             CCc---cceEEEEEEeccccCCcCcEEEEEEEEcCCCC-cEEEecccCccccCcEEeeehhHHHHhhcC
Q psy5287           1 MDK---QVVLARVIKTLGRTGSQGQCTQVKVEFIGDQN-RTIIRNVKGPVREGDILTLLESEREARRLR   65 (65)
Q Consensus         1 md~---~~~~A~V~kVlGRtGs~G~~tqVrve~l~~~~-r~i~RnVkGPVr~GDil~LlEseREarrlr   65 (65)
                      ||+   ++++|+|+||||||||+|+||||||+||++++ |+|+||||||||+||||+|+||||||||||
T Consensus         1 m~~~~~~~~~A~V~kVlgRtGs~G~~tQVrv~~l~~~~gR~i~RNVkGPVr~GDil~LlEtEREArrlr   69 (69)
T PF01200_consen    1 MDTSVQPIKLARVIKVLGRTGSRGQVTQVRVEFLDGDKGRSIIRNVKGPVREGDILTLLETEREARRLR   69 (69)
T ss_dssp             --S---SSEEEEEEEEECCCTSSSSEEEEEEEESSSSSS-EEEEEECSTTSTT-EEEESSSS-------
T ss_pred             CCcccCCceeEEEEEEcccccCcccEEEEEEEEecCCcceEEeecccCCcccCcEEEEeehhhhhhhcC
Confidence            664   69999999999999999999999999999876 999999999999999999999999999997


No 2  
>cd04457 S1_S28E S1_S28E: S28E, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. S28E protein is a component of the 30S ribosomal subunit. S28E is highly conserved among archaea and eukaryotes. S28E may control precursor RNA splicing and turnover in mRNA maturation process but its function in the ribosome is largely unknown. The structure contains an OB-fold found in many oligosaccharide and nucleic acid binding proteins. This implies that S28E might be involved in protein synthesis.
Probab=100.00  E-value=1e-40  Score=202.22  Aligned_cols=60  Identities=77%  Similarity=1.143  Sum_probs=58.6

Q ss_pred             eEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCccccCcEEeeehhHHHHhhcC
Q psy5287           6 VLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGPVREGDILTLLESEREARRLR   65 (65)
Q Consensus         6 ~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGPVr~GDil~LlEseREarrlr   65 (65)
                      ++|+|+||+|||||+|+||||||+||+|++|+|+||||||||+||||+|+|||||||+||
T Consensus         1 ~~A~V~kvlGRtG~~G~~tQVrv~~l~d~~r~i~RNVKGPVr~GDIl~L~EteREArrlr   60 (60)
T cd04457           1 KLAEVIKVLGRTGSRGEVTQVRVEFMDDKGRSIIRNVKGPVREGDILMLLETEREARRLR   60 (60)
T ss_pred             CceEEEEEeccccCcCcEEEEEEEEeeCCCcEEEEeccCCcccCcEEeehhhhhhhhhcC
Confidence            479999999999999999999999999999999999999999999999999999999996


No 3  
>PTZ00085 40S ribosomal protein S28; Provisional
Probab=100.00  E-value=2.2e-39  Score=202.47  Aligned_cols=63  Identities=70%  Similarity=1.090  Sum_probs=60.4

Q ss_pred             ccceEEEEEEeccccCCcCcEEEEEEEEcCCC---CcEEEecccCccccCcEEeeehhHHHHhhcC
Q psy5287           3 KQVVLARVIKTLGRTGSQGQCTQVKVEFIGDQ---NRTIIRNVKGPVREGDILTLLESEREARRLR   65 (65)
Q Consensus         3 ~~~~~A~V~kVlGRtGs~G~~tqVrve~l~~~---~r~i~RnVkGPVr~GDil~LlEseREarrlr   65 (65)
                      .++++|+|+||||||||+|+||||||+||+++   +|+|+||||||||+||||+|+|||||||+||
T Consensus         8 ~~~~~A~VikVlGRTG~~G~~tQVrv~~l~~~~d~~r~i~RNVkGPVr~GDIl~L~EteREAr~lr   73 (73)
T PTZ00085          8 EQPKLAKVIKVLGRTGSRGGVTQVRVQLMGEEGDAGRTLIRNVKGPVREGDILSLMETEREARRLR   73 (73)
T ss_pred             cCceeEEEEEEeccccCcccEEEEEEEEccCCcccCcEEEEeccCCcccCcEEeehhhhhhhhhcC
Confidence            36899999999999999999999999999976   6999999999999999999999999999997


No 4  
>PRK04007 rps28e 30S ribosomal protein S28e; Validated
Probab=100.00  E-value=2.3e-39  Score=201.10  Aligned_cols=62  Identities=55%  Similarity=0.793  Sum_probs=59.6

Q ss_pred             cceEEEEEEeccccCCcCcEEEEEEEEcCCC--CcEEEecccCccccCcEEeeehhHHHHhhcC
Q psy5287           4 QVVLARVIKTLGRTGSQGQCTQVKVEFIGDQ--NRTIIRNVKGPVREGDILTLLESEREARRLR   65 (65)
Q Consensus         4 ~~~~A~V~kVlGRtGs~G~~tqVrve~l~~~--~r~i~RnVkGPVr~GDil~LlEseREarrlr   65 (65)
                      ..++|+|+||||||||+|++|||||+||+++  +|+|+||||||||+||||+|+|||||||+|+
T Consensus         5 ~~~~A~VikVlGRTG~~G~~tQVrv~~l~~~~~~R~i~RNVkGPVR~GDIl~L~EteREAr~l~   68 (70)
T PRK04007          5 EGTPAEVIEIIGRTGMTGEVTQVKCRILEGRDKGRIITRNVKGPVRVGDILMLRETEREARKLG   68 (70)
T ss_pred             cCceEEEEEEeccccccccEEEEEEEEecCCCcCcEEEEeccCCcccCcEEEEhhhhhHHHhhc
Confidence            5789999999999999999999999999965  8999999999999999999999999999985


No 5  
>KOG3502|consensus
Probab=100.00  E-value=2.7e-40  Score=203.25  Aligned_cols=64  Identities=81%  Similarity=1.194  Sum_probs=61.9

Q ss_pred             CCc--cceEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCccccCcEEeeehhHHHHhhcC
Q psy5287           1 MDK--QVVLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGPVREGDILTLLESEREARRLR   65 (65)
Q Consensus         1 md~--~~~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGPVr~GDil~LlEseREarrlr   65 (65)
                      ||+  |+++|+|+||||||||+|+|||||||||+ .+|+|+||||||||+||||+|+||||||||||
T Consensus         1 m~~~~~~~larVtkVlGRTgsqGq~tqvrvef~~-~~RsIirnVKgPvr~gdil~lleserEarrlr   66 (66)
T KOG3502|consen    1 MDSKQPIKLARVTKVLGRTGSQGQCTQVRVEFMD-TSRSIIRNVKGPVREGDILTLLESEREARRLR   66 (66)
T ss_pred             CCccchhhHhhhhhhhcccCCCCcEEEEEEEecc-ccHHHHHhccCCccccchhhhhhchhhHhhcC
Confidence            787  79999999999999999999999999998 78999999999999999999999999999997


No 6  
>COG2053 RPS28A Ribosomal protein S28E/S33 [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=4.4e-35  Score=181.43  Aligned_cols=61  Identities=66%  Similarity=0.944  Sum_probs=58.7

Q ss_pred             ceEEEEEEeccccCCcCcEEEEEEEEcC--CCCcEEEecccCccccCcEEeeehhHHHHhhcC
Q psy5287           5 VVLARVIKTLGRTGSQGQCTQVKVEFIG--DQNRTIIRNVKGPVREGDILTLLESEREARRLR   65 (65)
Q Consensus         5 ~~~A~V~kVlGRtGs~G~~tqVrve~l~--~~~r~i~RnVkGPVr~GDil~LlEseREarrlr   65 (65)
                      .++|+|++||||||++|++|||+|+||+  |++|+|+||||||||+||||+|+|||||||+|+
T Consensus         5 ~~~aeVi~vlgRTG~~GevtQVk~ril~grdkgRiitRNV~GPVrvgDIl~L~EteREAr~l~   67 (69)
T COG2053           5 ATPAEVIEVLGRTGMTGEVTQVKVRILEGRDKGRIITRNVKGPVRVGDILMLLETEREARRLR   67 (69)
T ss_pred             ccchheeeeecccCccCcEEEEEEEEeecCCcCcEEeeeccCCcccccEEeehhhhhhhhhhc
Confidence            4679999999999999999999999999  789999999999999999999999999999985


No 7  
>KOG0187|consensus
Probab=72.19  E-value=2.7  Score=29.19  Aligned_cols=20  Identities=60%  Similarity=0.835  Sum_probs=17.4

Q ss_pred             ccCccccCcEEeeehhHHHHh
Q psy5287          42 VKGPVREGDILTLLESEREAR   62 (65)
Q Consensus        42 VkGPVr~GDil~LlEseREar   62 (65)
                      -||||| |=-+-|.|.|||-|
T Consensus        62 qkGpvR-GISiKLQEEERErr   81 (134)
T KOG0187|consen   62 QKGPVR-GISIKLQEEERERR   81 (134)
T ss_pred             HcCCcc-ceeEeecHHHHHhh
Confidence            489998 88899999999965


No 8  
>TIGR00008 infA translation initiation factor IF-1. This family consists of translation initiation factor IF-1 as found in bacteria and chloroplasts. This protein, about 70 residues in length, consists largely of an S1 RNA binding domain (pfam00575).
Probab=67.89  E-value=25  Score=21.44  Aligned_cols=43  Identities=19%  Similarity=0.362  Sum_probs=31.4

Q ss_pred             ceEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCccc-------cCcEEeeeh
Q psy5287           5 VVLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGPVR-------EGDILTLLE   56 (65)
Q Consensus         5 ~~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGPVr-------~GDil~LlE   56 (65)
                      ...+.|++.|+       -+..+|++.+  +..++-.+.|-.|       +||.+.+.=
T Consensus         6 e~~G~V~e~L~-------~~~f~V~l~n--g~~vla~i~GKmr~~rI~I~~GD~V~Ve~   55 (68)
T TIGR00008         6 EMEGKVTESLP-------NAMFRVELEN--GHEVLAHISGKIRMHYIRILPGDKVKVEL   55 (68)
T ss_pred             EEEEEEEEECC-------CCEEEEEECC--CCEEEEEecCcchhccEEECCCCEEEEEE
Confidence            35688999988       4467777743  6788888888755       799987643


No 9  
>COG0361 InfA Translation initiation factor 1 (IF-1) [Translation, ribosomal structure and biogenesis]
Probab=60.43  E-value=39  Score=21.09  Aligned_cols=45  Identities=20%  Similarity=0.298  Sum_probs=30.7

Q ss_pred             ceEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCc-------cccCcEEeeehhH
Q psy5287           5 VVLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGP-------VREGDILTLLESE   58 (65)
Q Consensus         5 ~~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGP-------Vr~GDil~LlEse   58 (65)
                      ...|.|++.||       -+.++|++.+  +...+--+.|-       +++||++.+.=|+
T Consensus         8 e~~g~V~e~L~-------~~~f~v~~ed--g~~~~ahI~GKmr~~~i~I~~GD~V~Ve~~~   59 (75)
T COG0361           8 EMEGTVIEMLP-------NGRFRVELEN--GHERLAHISGKMRKNRIRILPGDVVLVELSP   59 (75)
T ss_pred             EEEEEEEEecC-------CCEEEEEecC--CcEEEEEccCcchheeEEeCCCCEEEEEecc
Confidence            45799999998       5677888655  34444455554       5569999876444


No 10 
>cd05793 S1_IF1A S1_IF1A: Translation initiation factor IF1A, also referred to as eIF1A in eukaryotes and aIF1A in archaea, S1-like RNA-binding domain. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. IF1A is essential for translation initiation. eIF1A acts synergistically with eIF1 to mediate assembly of ribosomal initiation complexes at the initiation codon and maintain the accuracy of this process by recognizing and destabilizing aberrant preinitiation complexes from the mRNA. Without eIF1A and eIF1, 43S ribosomal preinitiation complexes can bind to the cap-proximal region, but are unable to reach the initiation codon. eIF1a also enhances the formation of 5'-terminal complexes in the presence of other translation initiation factors. This protein family is only found in eukaryotes and archaea.
Probab=59.87  E-value=36  Score=20.76  Aligned_cols=46  Identities=22%  Similarity=0.392  Sum_probs=29.6

Q ss_pred             eEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCc------cccCcEEeeehhHHH
Q psy5287           6 VLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGP------VREGDILTLLESERE   60 (65)
Q Consensus         6 ~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGP------Vr~GDil~LlEseRE   60 (65)
                      ..|+|++.+|       -...+|++.+  +..++-.+.|-      +++||.+.+..++.+
T Consensus         2 ~~g~V~~~~g-------~~~~~V~~~~--g~~~la~i~gK~rk~iwI~~GD~V~Ve~~~~d   53 (77)
T cd05793           2 EYGQVEKMLG-------NGRLEVRCFD--GKKRLCRIRGKMRKRVWINEGDIVLVAPWDFQ   53 (77)
T ss_pred             EEEEEEEEcC-------CCEEEEEECC--CCEEEEEEchhhcccEEEcCCCEEEEEecccc
Confidence            4689999998       3345555544  34555555555      568999888665543


No 11 
>PF01176 eIF-1a:  Translation initiation factor 1A / IF-1;  InterPro: IPR006196  The S1 domain of around 70 amino acids, originally identified in ribosomal protein S1, is found in a large number of RNA-associated proteins. It has been shown that S1 proteins bind RNA through their S1 domains with some degree of sequence specificity. This type of S1 domain is found in translation initiation factor 1.  The solution structure of one S1 RNA-binding domain from Escherichia coli polynucleotide phosphorylase has been determined []. It displays some similarity with the cold shock domain (CSD) (IPR002059 from INTERPRO). Both the S1 and the CSD domain consist of an antiparallel beta barrel of the same topology with 5 beta strands. This fold is also shared by many other proteins of unrelated function and is known as the OB fold. However, the S1 and CSD fold can be distinguished from the other OB folds by the presence of a short 3(10) helix at the end of strand 3. This unique feature is likely to form a part of the DNA/RNA-binding site.  This entry is specific for bacterial, chloroplastic and eukaryotic IF-1 type S1 domains.; GO: 0003723 RNA binding, 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 1JT8_A 3I4O_A 1AH9_A 1ZO1_W 1D7Q_A 2OQK_A 2DGY_A 1HR0_W.
Probab=58.37  E-value=7.7  Score=22.60  Aligned_cols=43  Identities=26%  Similarity=0.402  Sum_probs=25.0

Q ss_pred             eEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccC------ccccCcEEeeehh
Q psy5287           6 VLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKG------PVREGDILTLLES   57 (65)
Q Consensus         6 ~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkG------PVr~GDil~LlEs   57 (65)
                      ..|+|++.+|       -..++|++.|+  ..++-.+.|      -++.||.+...-+
T Consensus         5 ~~~~V~~~lG-------~~~~~V~~~dg--~~~l~~i~gK~r~~iwI~~GD~V~V~~~   53 (65)
T PF01176_consen    5 VIGRVTEMLG-------NNLFEVECEDG--EERLARIPGKFRKRIWIKRGDFVLVEPS   53 (65)
T ss_dssp             EEEEEEEEES-------SSEEEEEETTS--EEEEEEE-HHHHTCC---TTEEEEEEES
T ss_pred             EEEEEEEECC-------CCEEEEEeCCC--CEEEEEeccceeeeEecCCCCEEEEEec
Confidence            5799999998       33566666553  344433333      3788999866544


No 12 
>PF00833 Ribosomal_S17e:  Ribosomal S17;  InterPro: IPR001210 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. A number of eukaryotic and archaebacterial ribosomal proteins can be grouped in this family of ribosomal proteins, S17e. They include, vertebrate, Drosophila and Neurospora crassa (crp-3) S17's as well as yeast S17a (RP51A) and S17b (RP51B) and archaebacterial S17e [, , ].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 1RQ6_A 2XZM_V 2XZN_V 3IZ6_Q 3IZB_Q 3O30_K 3O2Z_K 3U5G_R 3U5C_R.
Probab=53.41  E-value=4.2  Score=27.57  Aligned_cols=21  Identities=52%  Similarity=0.743  Sum_probs=17.7

Q ss_pred             cccCccccCcEEeeehhHHHHh
Q psy5287          41 NVKGPVREGDILTLLESEREAR   62 (65)
Q Consensus        41 nVkGPVr~GDil~LlEseREar   62 (65)
                      --+|||| |=-+.|.|.|||.|
T Consensus        61 iq~g~vr-gis~klqEeErerr   81 (121)
T PF00833_consen   61 IQRGPVR-GISIKLQEEERERR   81 (121)
T ss_dssp             HTSSSST-TCSSCCCCHHHHCC
T ss_pred             HHhcccc-ccchhhhHHHHHhh
Confidence            3489998 88899999999965


No 13 
>TIGR03635 S17_bact 30S ribosomal protein S17. This model describes the bacterial ribosomal small subunit protein S17, while excluding cytosolic eukaryotic homologs and archaeal homologs. The model finds many, but not, chloroplast and mitochondrial counterparts to bacterial S17.
Probab=53.26  E-value=18  Score=21.96  Aligned_cols=23  Identities=13%  Similarity=0.403  Sum_probs=18.0

Q ss_pred             CcEEEecccCccccCcEEeeehh
Q psy5287          35 NRTIIRNVKGPVREGDILTLLES   57 (65)
Q Consensus        35 ~r~i~RnVkGPVr~GDil~LlEs   57 (65)
                      .++....-.-..++||++.+.|+
T Consensus        38 kk~~aHD~~~~~k~GD~V~I~ec   60 (71)
T TIGR03635        38 KKYHAHDENNECKVGDVVRIIET   60 (71)
T ss_pred             EEEEEECCCCCCCCCCEEEEEEc
Confidence            45566666667999999999997


No 14 
>TIGR00074 hypC_hupF hydrogenase assembly chaperone HypC/HupF. An additional proposed function is to shuttle the iron atom that has been liganded at the HypC/HypD complex to the precursor of the large hydrogenase (HycE) subunit. PubMed:12441107.
Probab=51.91  E-value=38  Score=20.88  Aligned_cols=40  Identities=25%  Similarity=0.406  Sum_probs=23.0

Q ss_pred             eEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCccccCcEEee
Q psy5287           6 VLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGPVREGDILTL   54 (65)
Q Consensus         6 ~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGPVr~GDil~L   54 (65)
                      .|++|+++-|.+        -.|++-.- .|.+-=..-+++.+||.+.+
T Consensus         5 iP~~V~~i~~~~--------A~v~~~G~-~~~v~l~lv~~~~vGD~VLV   44 (76)
T TIGR00074         5 IPGQVVEIDENI--------ALVEFCGI-KRDVSLDLVGEVKVGDYVLV   44 (76)
T ss_pred             cceEEEEEcCCE--------EEEEcCCe-EEEEEEEeeCCCCCCCEEEE
Confidence            478999986621        44555322 22222222278999998864


No 15 
>cd03701 IF2_IF5B_II IF2_IF5B_II: This family represents the domain II of prokaryotic Initiation Factor 2 (IF2) and its archeal and eukaryotic homologue aeIF5B. IF2, the largest initiation factor is an essential GTP binding protein. In E. coli three natural forms of IF2 exist in the cell, IF2alpha, IF2beta1, and IF2beta2. Disruption of the eIF5B gene (FUN12) in yeast causes a severe slow-growth phenotype, associated with a defect in translation. eIF5B has a function analogous to prokaryotic IF2 in mediating the joining of the 60S ribosomal subunit. The eIF5B consists of three N-terminal domains  (I, II, II) connected by a long helix to domain IV. Domain I is a G domain, domain II and IV are beta-barrels and domain III has a novel alpha-beta-alpha sandwich fold. The G domain and the beta-barrel domain II display a similar structure and arrangement to the homologous domains in EF1A, eEF1A and aeIF2gamma.
Probab=51.27  E-value=12  Score=23.19  Aligned_cols=25  Identities=28%  Similarity=0.450  Sum_probs=21.0

Q ss_pred             ecccCccccCcEEeeehhHHHHhhc
Q psy5287          40 RNVKGPVREGDILTLLESEREARRL   64 (65)
Q Consensus        40 RnVkGPVr~GDil~LlEseREarrl   64 (65)
                      =-.++....||.+...++|.+|+++
T Consensus        65 ~g~~~~p~aGd~~~~~~~e~~a~~~   89 (95)
T cd03701          65 LGLKDVPKAGDGVLVVASEKEAKEI   89 (95)
T ss_pred             eeecCCccCCCEEEEeCCCHHHHHh
Confidence            3456677899999999999999875


No 16 
>PLN00208 translation initiation factor (eIF); Provisional
Probab=50.73  E-value=63  Score=22.42  Aligned_cols=42  Identities=21%  Similarity=0.382  Sum_probs=27.2

Q ss_pred             ceEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCc------cccCcEEeee
Q psy5287           5 VVLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGP------VREGDILTLL   55 (65)
Q Consensus         5 ~~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGP------Vr~GDil~Ll   55 (65)
                      ..+|+|++.+|       -..++|++.+  +...+--+.|-      |++||+|.+.
T Consensus        33 q~~g~V~~~lG-------n~~~~V~c~d--G~~rLa~IpGKmRKrIWI~~GD~VlVe   80 (145)
T PLN00208         33 QEYAQVLRMLG-------NGRCEALCID--GTKRLCHIRGKMRKKVWIAAGDIILVG   80 (145)
T ss_pred             cEEEEEEEEcC-------CCEEEEEECC--CCEEEEEEeccceeeEEecCCCEEEEE
Confidence            46899999998       3355666554  34444444453      6788888763


No 17 
>PF11213 DUF3006:  Protein of unknown function (DUF3006);  InterPro: IPR021377  This family of proteins has no known function. 
Probab=49.42  E-value=15  Score=21.77  Aligned_cols=13  Identities=31%  Similarity=0.675  Sum_probs=10.5

Q ss_pred             ccCccccCcEEee
Q psy5287          42 VKGPVREGDILTL   54 (65)
Q Consensus        42 VkGPVr~GDil~L   54 (65)
                      .-..+++||+|.+
T Consensus        30 LP~~~keGDvl~i   42 (71)
T PF11213_consen   30 LPEGAKEGDVLEI   42 (71)
T ss_pred             CCCCCCcccEEEE
Confidence            4467999999977


No 18 
>PF13533 Biotin_lipoyl_2:  Biotin-lipoyl like
Probab=49.11  E-value=12  Score=20.62  Aligned_cols=17  Identities=35%  Similarity=0.610  Sum_probs=14.1

Q ss_pred             ccccCcEEeeehhHHHH
Q psy5287          45 PVREGDILTLLESEREA   61 (65)
Q Consensus        45 PVr~GDil~LlEseREa   61 (65)
                      .|+.||+|.-+++....
T Consensus        23 ~VkkGd~L~~ld~~~~~   39 (50)
T PF13533_consen   23 QVKKGDVLLVLDSPDLQ   39 (50)
T ss_pred             EEcCCCEEEEECcHHHH
Confidence            58999999999987653


No 19 
>PTZ00329 eukaryotic translation initiation factor 1A; Provisional
Probab=48.07  E-value=70  Score=22.45  Aligned_cols=43  Identities=19%  Similarity=0.333  Sum_probs=27.7

Q ss_pred             ceEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCc------cccCcEEeeeh
Q psy5287           5 VVLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGP------VREGDILTLLE   56 (65)
Q Consensus         5 ~~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGP------Vr~GDil~LlE   56 (65)
                      ..+|.|++.+|       -..++|++.+  +...+-.+.|=      |++||+|.+.-
T Consensus        33 q~~g~V~~~LG-------n~~f~V~c~d--G~~rLa~I~GKmRK~IWI~~GD~VlVel   81 (155)
T PTZ00329         33 QEYAQVLRMLG-------NGRLEAYCFD--GVKRLCHIRGKMRKRVWINIGDIILVSL   81 (155)
T ss_pred             cEEEEEEEEcC-------CCEEEEEECC--CCEEEEEeeccceeeEEecCCCEEEEec
Confidence            46899999998       3345555544  34444555554      66899888743


No 20 
>PTZ00154 40S ribosomal protein S17; Provisional
Probab=46.76  E-value=11  Score=26.21  Aligned_cols=24  Identities=58%  Similarity=0.745  Sum_probs=19.4

Q ss_pred             EEecccCccccCcEEeeehhHHHHh
Q psy5287          38 IIRNVKGPVREGDILTLLESEREAR   62 (65)
Q Consensus        38 i~RnVkGPVr~GDil~LlEseREar   62 (65)
                      +-|--+|||| |=-+-|.|.|||-|
T Consensus        58 mkri~~gpvr-gis~klqeeererr   81 (134)
T PTZ00154         58 MKRIQKGPVR-GISLKLQEEERERR   81 (134)
T ss_pred             HhhhccCCcc-ccceehhHHHHHHh
Confidence            3455689998 88899999999955


No 21 
>CHL00142 rps17 ribosomal protein S17; Validated
Probab=45.63  E-value=24  Score=22.22  Aligned_cols=24  Identities=13%  Similarity=0.314  Sum_probs=18.0

Q ss_pred             CcEEEecccCccccCcEEeeehhH
Q psy5287          35 NRTIIRNVKGPVREGDILTLLESE   58 (65)
Q Consensus        35 ~r~i~RnVkGPVr~GDil~LlEse   58 (65)
                      .++....-..-.++||++.+.||=
T Consensus        40 kk~~aHDe~n~~~~GD~V~I~e~R   63 (84)
T CHL00142         40 KKYLVHDEENECNIGDQVLIEETR   63 (84)
T ss_pred             EEEEEeCCCCCCCCCCEEEEEEcC
Confidence            455555555668999999999873


No 22 
>PRK05610 rpsQ 30S ribosomal protein S17; Reviewed
Probab=44.31  E-value=30  Score=21.67  Aligned_cols=23  Identities=13%  Similarity=0.393  Sum_probs=17.1

Q ss_pred             CcEEEecccCccccCcEEeeehh
Q psy5287          35 NRTIIRNVKGPVREGDILTLLES   57 (65)
Q Consensus        35 ~r~i~RnVkGPVr~GDil~LlEs   57 (65)
                      .++...+-.-.+++||++.+.|+
T Consensus        43 kk~~aHD~~n~~k~GD~V~I~e~   65 (84)
T PRK05610         43 KKYHAHDENNEAKIGDVVRIMET   65 (84)
T ss_pred             eEEEEECCCCCCCCCCEEEEEEc
Confidence            34555555556899999999997


No 23 
>PF07892 DUF1667:  Protein of unknown function (DUF1667);  InterPro: IPR012460 Hypothetical archaeal and bacterial proteins make up this family. A few proteins are annotated as being potential metal-binding proteins, and in fact the members of this family have four highly conserved cysteine residues, but no further literature evidence was found in this regard. ; PDB: 2JOV_A.
Probab=43.98  E-value=11  Score=23.77  Aligned_cols=13  Identities=46%  Similarity=0.928  Sum_probs=6.4

Q ss_pred             cccCccccCcEEe
Q psy5287          41 NVKGPVREGDILT   53 (65)
Q Consensus        41 nVkGPVr~GDil~   53 (65)
                      .|+-||+.||||.
T Consensus        56 ~v~aPV~~GdVi~   68 (82)
T PF07892_consen   56 EVKAPVKIGDVIV   68 (82)
T ss_dssp             EE-----SSEEEE
T ss_pred             EEcCCccCCCEEE
Confidence            4789999999985


No 24 
>PF14801 GCD14_N:  tRNA methyltransferase complex GCD14 subunit N-term; PDB: 1I9G_A.
Probab=43.89  E-value=14  Score=22.02  Aligned_cols=15  Identities=40%  Similarity=0.849  Sum_probs=8.6

Q ss_pred             cCccccCcEEeeehh
Q psy5287          43 KGPVREGDILTLLES   57 (65)
Q Consensus        43 kGPVr~GDil~LlEs   57 (65)
                      .||.++||-+.|.+.
T Consensus         3 ~Gpf~~GdrVQlTD~   17 (54)
T PF14801_consen    3 RGPFRAGDRVQLTDP   17 (54)
T ss_dssp             --S--TT-EEEEEET
T ss_pred             cCCCCCCCEEEEccC
Confidence            599999999998764


No 25 
>PF00018 SH3_1:  SH3 domain;  InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. The crystal structure of the SH3 domain of the cytoskeletal protein spectrin, and the solution structures of SH3 domains of phospholipase C (PLC-y) and phosphatidylinositol 3-kinase p85 alpha-subunit, have been determined [, , ]. In spite of relatively limited sequence similarity, their overall structures are similar. The domains belong to the alpha+beta structural class, with 5 to 8 beta-strands forming 2 tightly-packed, anti-parallel beta-sheets arranged in a barrel-like structure, and intervening loops sometimes forming helices. Conserved aliphatic and aromatic residues form a hydrophobic core (A11, L23, A29, V34, W42, L52 and V59 in PLC-y []) and a hydrophobic pocket on the molecular surface (L12, F13, W53 and P55 in PLC-y). The conserved core is believed to stabilise the fold, while the pocket is thought to serve as a binding site for target proteins. Conserved carboxylic amino acids located in the loops, on the periphery of the pocket (D14 and E22), may be involved in protein-protein interactions via proline-rich regions. The N- and C-termini are packed in close proximity, indicating that they are independent structural modules.; GO: 0005515 protein binding; PDB: 1UHF_A 1W1F_A 1WA7_A 1SEM_A 1KFZ_A 2SEM_B 1K76_A 3SEM_B 1X2Q_A 2J06_B ....
Probab=43.30  E-value=14  Score=19.62  Aligned_cols=14  Identities=36%  Similarity=0.764  Sum_probs=10.5

Q ss_pred             ccccCcEEeeehhH
Q psy5287          45 PVREGDILTLLESE   58 (65)
Q Consensus        45 PVr~GDil~LlEse   58 (65)
                      ++++||+|.+++..
T Consensus        15 s~~~Gd~i~v~~~~   28 (48)
T PF00018_consen   15 SFKKGDIIEVLEKS   28 (48)
T ss_dssp             EB-TTEEEEEEEES
T ss_pred             eEECCCEEEEEEec
Confidence            47899999998753


No 26 
>cd03702 IF2_mtIF2_II This family represents the domain II of bacterial Initiation Factor 2 (IF2) and its eukaryotic mitochondrial homologue mtIF2. IF2, the largest initiation factor is an essential GTP binding protein. In E. coli three natural forms of IF2 exist in the cell, IF2alpha, IF2beta1, and IF2beta2.  Bacterial IF-2 is structurally and functionally related to eukaryotic mitochondrial mtIF-2.
Probab=43.14  E-value=18  Score=22.70  Aligned_cols=24  Identities=38%  Similarity=0.659  Sum_probs=19.3

Q ss_pred             cccCccccCcEEeeehhHHHHhhc
Q psy5287          41 NVKGPVREGDILTLLESEREARRL   64 (65)
Q Consensus        41 nVkGPVr~GDil~LlEseREarrl   64 (65)
                      -.++.--.||.+.-.++|.+|+++
T Consensus        66 G~~~~P~aGd~~~~~~se~~Ak~~   89 (95)
T cd03702          66 GLKGVPQAGDKFLVVESEKEAKEI   89 (95)
T ss_pred             CCCCCCCCCCEEEEeCCHHHHHHH
Confidence            344444779999999999999986


No 27 
>cd03440 hot_dog The hotdog fold was initially identified in the E. coli FabA (beta-hydroxydecanoyl-acyl carrier protein (ACP)-dehydratase) structure and subsequently in 4HBT (4-hydroxybenzoyl-CoA thioesterase) from Pseudomonas. A number of other seemingly unrelated proteins also share the hotdog fold.  These proteins have related, but distinct, catalytic activities that include metabolic roles such as thioester hydrolysis in fatty acid metabolism, and degradation of phenylacetic acid and the environmental pollutant 4-chlorobenzoate.  This superfamily also includes the PaaI-like protein FapR, a non-catalytic bacterial homolog involved in transcriptional regulation of fatty acid biosynthesis.
Probab=42.31  E-value=19  Score=18.02  Aligned_cols=15  Identities=47%  Similarity=0.638  Sum_probs=11.8

Q ss_pred             cccCccccCcEEeee
Q psy5287          41 NVKGPVREGDILTLL   55 (65)
Q Consensus        41 nVkGPVr~GDil~Ll   55 (65)
                      +.++|++.||.+.+.
T Consensus        53 ~~~~~~~~g~~v~~~   67 (100)
T cd03440          53 RFLRPVRPGDTLTVE   67 (100)
T ss_pred             EEecCCCCCCEEEEE
Confidence            567899999988763


No 28 
>cd03451 FkbR2 FkbR2 is a Streptomyces hygroscopicus protein with a hot dog fold that belongs to a conserved family of proteins found in prokaryotes and archaea but not in eukaryotes. FkbR2  has sequence similarity to (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  The function of FkbR2 is unknown.
Probab=42.07  E-value=17  Score=22.55  Aligned_cols=15  Identities=33%  Similarity=0.403  Sum_probs=12.1

Q ss_pred             ecccCccccCcEEee
Q psy5287          40 RNVKGPVREGDILTL   54 (65)
Q Consensus        40 RnVkGPVr~GDil~L   54 (65)
                      =+...||+.||.|++
T Consensus        86 ~~f~~pv~~GDtl~~  100 (146)
T cd03451          86 VRFPAPVFHGDTLYA  100 (146)
T ss_pred             EEecCCCCCCCEEEE
Confidence            356799999999974


No 29 
>COG1096 Predicted RNA-binding protein (consists of S1 domain and a Zn-ribbon domain) [Translation, ribosomal structure and biogenesis]
Probab=41.93  E-value=64  Score=23.36  Aligned_cols=43  Identities=21%  Similarity=0.355  Sum_probs=28.7

Q ss_pred             ceEEEEEEeccccCCcCcEEEEEEEEcCCCC-----------------cEEEecccCccccCcEEe
Q psy5287           5 VVLARVIKTLGRTGSQGQCTQVKVEFIGDQN-----------------RTIIRNVKGPVREGDILT   53 (65)
Q Consensus         5 ~~~A~V~kVlGRtGs~G~~tqVrve~l~~~~-----------------r~i~RnVkGPVr~GDil~   53 (65)
                      +.+|+|+.+      +++..+|++-..++..                 -....+++.-++.||||-
T Consensus        67 iV~grV~~v------~~~~a~V~i~~ve~~~r~~~~~~~~~ihvs~~~~~~~~~~~d~f~~GDivr  126 (188)
T COG1096          67 IVYGRVTDV------REQRALVRIVGVEGKERELATSGAADIHVSQVRDGYVEKLSDAFRIGDIVR  126 (188)
T ss_pred             EEEEEEeec------cceEEEEEEEEEecccccCCCCceeeEEEEecccccccccccccccccEEE
Confidence            456666655      3466777777666522                 234678889999999984


No 30 
>PRK12442 translation initiation factor IF-1; Reviewed
Probab=41.80  E-value=94  Score=19.99  Aligned_cols=42  Identities=21%  Similarity=0.197  Sum_probs=29.9

Q ss_pred             ceEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCccc-------cCcEEeee
Q psy5287           5 VVLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGPVR-------EGDILTLL   55 (65)
Q Consensus         5 ~~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGPVr-------~GDil~Ll   55 (65)
                      ...+.|+++|+       =+..+|++-  .+..++-.++|=+|       +||.+.+.
T Consensus         8 e~~G~V~e~Lp-------~~~frV~Le--nG~~vla~isGKmR~~rIrIl~GD~V~VE   56 (87)
T PRK12442          8 ELDGIVDEVLP-------DSRFRVTLE--NGVEVGAYASGRMRKHRIRILAGDRVTLE   56 (87)
T ss_pred             EEEEEEEEECC-------CCEEEEEeC--CCCEEEEEeccceeeeeEEecCCCEEEEE
Confidence            45688888887       235667663  46788888888755       58888764


No 31 
>PRK13692 (3R)-hydroxyacyl-ACP dehydratase subunit HadA; Provisional
Probab=40.40  E-value=18  Score=24.20  Aligned_cols=14  Identities=29%  Similarity=0.465  Sum_probs=11.7

Q ss_pred             cccCccccCcEEee
Q psy5287          41 NVKGPVREGDILTL   54 (65)
Q Consensus        41 nVkGPVr~GDil~L   54 (65)
                      +.+.||+.||.|+.
T Consensus        92 ~f~~PV~~GDtL~~  105 (159)
T PRK13692         92 KFEKPIVAGDKLYC  105 (159)
T ss_pred             EEeCCccCCCEEEE
Confidence            47799999999953


No 32 
>PF11584 Toxin_ToxA:  Proteinaceous host-selective toxin ToxA;  InterPro: IPR021635  ToxA is produced by particular Pyrenophora triticirepentis races and is a proteinaceous host-selective toxin. It is necessary and sufficient to cause cell death in sensitive wheat cultivars [].ToxA adopts a single-domain, beta-sandwich fold which has novel topology. The protein is directly involved in recognition events required for ToxA action. It is thought to be distantly related to FnIII proteins, gaining entry to the host via an integrin-like receptor []. ; PDB: 1ZLE_C 1ZLD_A.
Probab=39.36  E-value=30  Score=23.23  Aligned_cols=43  Identities=35%  Similarity=0.570  Sum_probs=30.7

Q ss_pred             eccccCCcCcEE---------------EEEEEEcC--CCCcEEEecccCccccCcEEeee
Q psy5287          13 TLGRTGSQGQCT---------------QVKVEFIG--DQNRTIIRNVKGPVREGDILTLL   55 (65)
Q Consensus        13 VlGRtGs~G~~t---------------qVrve~l~--~~~r~i~RnVkGPVr~GDil~Ll   55 (65)
                      +|||.|+-|...               .|||.+-.  -++|.|+-.+.-.|--||+-.|.
T Consensus        28 ilgrpgaigswelnnfitiglnrvnadtvrvnirntgrtnrliitqwdntvtrgdvyelf   87 (118)
T PF11584_consen   28 ILGRPGAIGSWELNNFITIGLNRVNADTVRVNIRNTGRTNRLIITQWDNTVTRGDVYELF   87 (118)
T ss_dssp             HTS-TT-EEEEE-SSSEEEEEEEESSSEEEEEEEESSS-EEEEEEEEEEETTTEEEEEEE
T ss_pred             EecCCCccceEEecceEEEeecccccceEEEEeccCCccceEEEEeecCceecccHHhhh
Confidence            489999887642               46777654  36688999999999999998764


No 33 
>COG0186 RpsQ Ribosomal protein S17 [Translation, ribosomal structure and biogenesis]
Probab=39.06  E-value=18  Score=23.24  Aligned_cols=12  Identities=33%  Similarity=0.681  Sum_probs=11.0

Q ss_pred             cccCcEEeeehh
Q psy5287          46 VREGDILTLLES   57 (65)
Q Consensus        46 Vr~GDil~LlEs   57 (65)
                      +++||++.+.||
T Consensus        56 ~k~GD~V~I~Et   67 (87)
T COG0186          56 AKVGDIVRIAET   67 (87)
T ss_pred             CCCCCEEEEEEc
Confidence            689999999997


No 34 
>TIGR03028 EpsE polysaccharide export protein EpsE. Sequences in this family of proteins are members of a polysaccharide export protein family (pfam02563) which includes the wza protein from E.coli. This family of proteins are homologous to the EpsE protein of the methanolan biosynthesis operon of Methylobacillus species strain 12S. The distribution of this protein appears to be restricted to a subset of exopolysaccharide operons containing a syntenic grouping of genes including a variant of the EpsH exosortase protein. Exosortase has been proposed to be involved in the targetting and processing of proteins containing the PEP-CTERM domain to the exopolysaccharide layer.
Probab=38.81  E-value=31  Score=24.25  Aligned_cols=13  Identities=31%  Similarity=0.419  Sum_probs=11.5

Q ss_pred             ccccCcEEeeehh
Q psy5287          45 PVREGDILTLLES   57 (65)
Q Consensus        45 PVr~GDil~LlEs   57 (65)
                      +++.||+|..-||
T Consensus       225 ~l~~gDii~V~~s  237 (239)
T TIGR03028       225 LVQPDDVIYVRES  237 (239)
T ss_pred             ccCCCCEEEEeCc
Confidence            5999999999876


No 35 
>COG1607 Acyl-CoA hydrolase [Lipid metabolism]
Probab=37.78  E-value=36  Score=23.61  Aligned_cols=27  Identities=37%  Similarity=0.566  Sum_probs=18.4

Q ss_pred             cCcEEEEEEEEcCCCCcEEEecccCccccCcEEeee
Q psy5287          20 QGQCTQVKVEFIGDQNRTIIRNVKGPVREGDILTLL   55 (65)
Q Consensus        20 ~G~~tqVrve~l~~~~r~i~RnVkGPVr~GDil~Ll   55 (65)
                      .|.|--+.|..++.         +=||+.||+|++.
T Consensus        53 ~~~vVTasvd~v~F---------~~Pv~vGd~v~~~   79 (157)
T COG1607          53 GGRVVTASVDSVDF---------KKPVRVGDIVCLY   79 (157)
T ss_pred             CCeEEEEEeceEEE---------ccccccCcEEEEE
Confidence            45555566655543         4599999999874


No 36 
>PRK10413 hydrogenase 2 accessory protein HypG; Provisional
Probab=37.25  E-value=1e+02  Score=19.18  Aligned_cols=41  Identities=15%  Similarity=0.096  Sum_probs=22.8

Q ss_pred             eEEEEEEecccc------CCcCcEEEEEEEEcCCCCcEEEecccCccccCcEEee
Q psy5287           6 VLARVIKTLGRT------GSQGQCTQVKVEFIGDQNRTIIRNVKGPVREGDILTL   54 (65)
Q Consensus         6 ~~A~V~kVlGRt------Gs~G~~tqVrve~l~~~~r~i~RnVkGPVr~GDil~L   54 (65)
                      .|++|+++-+..      ...|...+|.+.++.+        .+-++.+||.+.+
T Consensus         5 iP~kVi~i~~~~~~~A~vd~~Gv~r~V~l~Lv~~--------~~~~~~vGDyVLV   51 (82)
T PRK10413          5 VPGQVLAVGEDIHQLAQVEVCGIKRDVNIALICE--------GNPADLLGQWVLV   51 (82)
T ss_pred             cceEEEEECCCCCcEEEEEcCCeEEEEEeeeecc--------CCcccccCCEEEE
Confidence            478999987642      2234444444444432        1224678988754


No 37 
>PRK10694 acyl-CoA esterase; Provisional
Probab=36.26  E-value=23  Score=23.10  Aligned_cols=14  Identities=29%  Similarity=0.482  Sum_probs=11.2

Q ss_pred             cccCccccCcEEee
Q psy5287          41 NVKGPVREGDILTL   54 (65)
Q Consensus        41 nVkGPVr~GDil~L   54 (65)
                      +-.-|++.||+|.+
T Consensus        63 ~F~~Pv~~Gd~l~~   76 (133)
T PRK10694         63 TFLRPVAVGDVVCC   76 (133)
T ss_pred             EECCCcccCcEEEE
Confidence            44679999999965


No 38 
>cd04456 S1_IF1A_like S1_IF1A_like: Translation initiation factor IF1A-like, S1-like RNA-binding domain. IF1A is also referred to as eIF1A in eukaryotes and aIF1A in archaea. S1-like RNA-binding domains are found in a wide variety of RNA-associated proteins. IF1A is essential for translation initiation. eIF1A acts synergistically with eIF1 to mediate assembly of ribosomal initiation complexes at the initiation codon and maintain the accuracy of this process by recognizing and destabilizing aberrant preinitiation complexes from the mRNA. Without eIF1A and eIF1, 43S ribosomal preinitiation complexes can bind to the cap-proximal region, but are unable to reach the initiation codon. eIF1a also enhances the formation of 5'-terminal complexes in the presence of other translation initiation factors. This protein family is only found in eukaryotes and archaea.
Probab=35.78  E-value=1e+02  Score=18.76  Aligned_cols=44  Identities=25%  Similarity=0.459  Sum_probs=26.6

Q ss_pred             eEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCc------cccCcEEeeehhH
Q psy5287           6 VLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGP------VREGDILTLLESE   58 (65)
Q Consensus         6 ~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGP------Vr~GDil~LlEse   58 (65)
                      ..|+|++.+|       -...+|+..|  +...+-.+.|-      +++||++.+.-++
T Consensus         2 ~i~~V~~~lG-------~~~~~V~~~d--g~~~l~~i~gK~Rk~iwI~~GD~VlV~~~~   51 (78)
T cd04456           2 QIVRVLRMLG-------NNRHEVECAD--GQRRLVSIPGKLRKNIWIKRGDFLIVDPIE   51 (78)
T ss_pred             eEEEEEEECC-------CCEEEEEECC--CCEEEEEEchhhccCEEEcCCCEEEEEecc
Confidence            4689999988       2345555544  34444444443      6788888775443


No 39 
>PF12791 RsgI_N:  Anti-sigma factor N-terminus;  InterPro: IPR024449 The heat shock genes in Bacillus subtilis can be classified into several groups according to their regulation [], and the sigma gene, sigI, of Bacillus subtilis belongs to the group IV heat-shock response genes and has many orthologues in the bacterial phylum Firmicutes []. Regulation of sigma factor I is carried out by RsgI from the same operon. This entry represents the N-terminal cytoplasmic portion of RsgI ('upstream' of the single transmembrane helix) which has been shown to interact directly with Sigma-I [].
Probab=33.98  E-value=85  Score=17.20  Aligned_cols=31  Identities=13%  Similarity=0.065  Sum_probs=22.5

Q ss_pred             EEcCCCCcEEEecccCccccCcEEeeehhHH
Q psy5287          29 EFIGDQNRTIIRNVKGPVREGDILTLLESER   59 (65)
Q Consensus        29 e~l~~~~r~i~RnVkGPVr~GDil~LlEseR   59 (65)
                      =+|.+.|..+-=.-+++...||.+.+.|.+.
T Consensus         9 iVlT~dGeF~~ik~~~~~~vG~eI~~~~~~~   39 (56)
T PF12791_consen    9 IVLTPDGEFIKIKRKPGMEVGQEIEFDEKDI   39 (56)
T ss_pred             EEEcCCCcEEEEeCCCCCcccCEEEEechhh
Confidence            3455566666556667799999999988763


No 40 
>PF04149 DUF397:  Domain of unknown function (DUF397);  InterPro: IPR007278 The function of this family is unknown. It has been suggested that some members of this family are regulators of transcription.
Probab=33.87  E-value=90  Score=17.86  Aligned_cols=38  Identities=32%  Similarity=0.626  Sum_probs=28.2

Q ss_pred             CCcCcEEEEEEEEcCCCCcEEEecccCccccCcEEeeehhHHHH
Q psy5287          18 GSQGQCTQVKVEFIGDQNRTIIRNVKGPVREGDILTLLESEREA   61 (65)
Q Consensus        18 Gs~G~~tqVrve~l~~~~r~i~RnVkGPVr~GDil~LlEseREa   61 (65)
                      |..|.|.+|.  +.  ++...+|+-|-|  .|=+|.+-..|-.|
T Consensus        12 ~~~~~CVEva--~~--~~~v~vRDSk~p--~~~~L~~t~~eW~a   49 (56)
T PF04149_consen   12 GGGGNCVEVA--RL--PGGVAVRDSKDP--DGPVLTFTPAEWAA   49 (56)
T ss_pred             CCCCCcEEEE--ee--cceEEEecCCCC--CCCEEEeCHHHHHH
Confidence            5667776665  33  345999999998  68889888777654


No 41 
>cd03708 GTPBP_III Domain III of the GP-1 family of GTPase. This group includes proteins similar to GTPBP1 and GTPBP2. GTPB1 is structurally, related to elongation factor 1 alpha, a key component of protein biosynthesis machinery. Immunohistochemical analyses on mouse tissues revealed that GTPBP1 is expressed in some neurons and smooth muscle cells of various organs as well as macrophages. Immunofluorescence analyses revealed that GTPBP1 is localized exclusively in cytoplasm and shows a diffuse granular network forming a gradient from the nucleus to the periphery of the cells in smooth muscle cell lines and macrophages. No significant difference was observed in the immune response to protein antigen between mutant mice and wild-type mice, suggesting normal function of antigen-presenting cells of the mutant mice. The absence of an eminent phenotype in GTPBP1-deficient mice may be due to functional compensation by GTPBP2, which is similar to GTPBP1 in structure and tissue distribution.
Probab=33.35  E-value=1e+02  Score=17.80  Aligned_cols=28  Identities=18%  Similarity=0.205  Sum_probs=23.8

Q ss_pred             eEEEEEEeccccCCcCcEEEEEEEEcCC
Q psy5287           6 VLARVIKTLGRTGSQGQCTQVKVEFIGD   33 (65)
Q Consensus         6 ~~A~V~kVlGRtGs~G~~tqVrve~l~~   33 (65)
                      ..|++.++.++.=..|+...|+++|+..
T Consensus        34 ~~~~i~~i~~~~l~~g~~~~v~i~f~~~   61 (87)
T cd03708          34 QTARIVSIDKDVLRTGDRALVRFRFLYH   61 (87)
T ss_pred             EEEEEEeccHhhccCCCeEEEEEEECCC
Confidence            5789999998888899999999998643


No 42 
>PRK04424 fatty acid biosynthesis transcriptional regulator; Provisional
Probab=32.35  E-value=28  Score=23.78  Aligned_cols=14  Identities=29%  Similarity=0.501  Sum_probs=11.6

Q ss_pred             cccCccccCcEEee
Q psy5287          41 NVKGPVREGDILTL   54 (65)
Q Consensus        41 nVkGPVr~GDil~L   54 (65)
                      +-+.||++||.|.+
T Consensus       134 rF~kPV~pGD~L~~  147 (185)
T PRK04424        134 RFKRPVKLGERVVA  147 (185)
T ss_pred             EEccCCCCCCEEEE
Confidence            34689999999976


No 43 
>cd03452 MaoC_C MaoC_C  The C-terminal hot dog fold of the MaoC (monoamine oxidase C) dehydratase regulatory protein. Orthologs of MaoC include PaaZ [Escherichia coli] and PaaN [Pseudomonas putida], which are putative ring-opening enzymes involved in phenylacetic acid degradation. The C-terminal domain of MaoC has sequence similarity to (R)-specific enoyl-CoA hydratase,Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  MaoC also has an N-terminal PutA domain like that found in the E. coli PutA proline dehydrogenase and other members of the aldehyde dehydrogenase family.
Probab=32.16  E-value=30  Score=22.06  Aligned_cols=14  Identities=29%  Similarity=0.513  Sum_probs=11.5

Q ss_pred             cccCccccCcEEee
Q psy5287          41 NVKGPVREGDILTL   54 (65)
Q Consensus        41 nVkGPVr~GDil~L   54 (65)
                      +.+.||+.||.|+.
T Consensus        84 rf~~PV~~GDtl~~   97 (142)
T cd03452          84 RFLEPVYPGDTIQV   97 (142)
T ss_pred             EECCCCCCCCEEEE
Confidence            45789999998864


No 44 
>CHL00036 ycf4 photosystem I assembly protein Ycf4
Probab=32.05  E-value=63  Score=23.35  Aligned_cols=43  Identities=30%  Similarity=0.498  Sum_probs=35.6

Q ss_pred             cEEEEEEEEcC--CCCcEEEecccCc-----cccCcEEeeehhHHHHhhc
Q psy5287          22 QCTQVKVEFIG--DQNRTIIRNVKGP-----VREGDILTLLESEREARRL   64 (65)
Q Consensus        22 ~~tqVrve~l~--~~~r~i~RnVkGP-----Vr~GDil~LlEseREarrl   64 (65)
                      .+..+|+++-+  +|.|.|-=.+||-     -|.||-++|.|-|.+|-.|
T Consensus       124 dI~sIrieikeGlnprr~iyL~~kg~~~IPLTrig~pl~l~eiE~qAaeL  173 (184)
T CHL00036        124 DIQSIRIEVKEGLNPRRVLYLEIKGQRDIPLTRTGEPLTLREIEQKAAEL  173 (184)
T ss_pred             HeEEEEEEEecCcCcccEEEEEEcCCCcCCcccCCCCCCHHHHHHHHHHH
Confidence            56778888877  4888888888885     4789999999999998765


No 45 
>PRK07217 replication factor A; Reviewed
Probab=31.61  E-value=2.1e+02  Score=22.11  Aligned_cols=48  Identities=17%  Similarity=0.187  Sum_probs=34.7

Q ss_pred             eEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEeccc----CccccCcEEeeeh
Q psy5287           6 VLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVK----GPVREGDILTLLE   56 (65)
Q Consensus         6 ~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVk----GPVr~GDil~LlE   56 (65)
                      ..|+|+++-.+.  .+.+.|+-+ +=|+++++-.=.|+    +.+.+||++.+..
T Consensus        87 V~aKVl~l~e~~--~~si~qvGl-lgDETG~IkfT~W~~s~~~~leeGd~~rI~n  138 (311)
T PRK07217         87 VTAKVVQLWEPS--SDSIAQVGL-LGDETGTIKFTKWAKSDLPELEEGKSYLLKN  138 (311)
T ss_pred             EEEEEEEecCCC--CCceEEEEE-EEcCCceEEEEEccCCCCCcccCCCEEEEEe
Confidence            468888887755  477888774 44567877666665    4599999998753


No 46 
>PF12961 DUF3850:  Domain of Unknown Function with PDB structure (DUF3850)
Probab=31.16  E-value=47  Score=20.60  Aligned_cols=25  Identities=32%  Similarity=0.347  Sum_probs=17.4

Q ss_pred             CcEEEecccCccccCcEEeeehhHH
Q psy5287          35 NRTIIRNVKGPVREGDILTLLESER   59 (65)
Q Consensus        35 ~r~i~RnVkGPVr~GDil~LlEseR   59 (65)
                      +..=+|.=--.-..||+|.|.|...
T Consensus        18 KtfEiRkNDRdf~VGD~L~L~E~~~   42 (72)
T PF12961_consen   18 KTFEIRKNDRDFQVGDILVLREWDN   42 (72)
T ss_pred             ceEEEEecCCCCCCCCEEEEEEecC
Confidence            3344454455678899999999863


No 47 
>cd03455 SAV4209 SAV4209 is a Streptomyces avermitilis protein with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  The alpha- and gamma-proteobacterial members of this CD have, in addition to a hot dog fold, an N-terminal extension.
Probab=29.60  E-value=34  Score=20.98  Aligned_cols=15  Identities=27%  Similarity=0.499  Sum_probs=12.3

Q ss_pred             ecccCccccCcEEee
Q psy5287          40 RNVKGPVREGDILTL   54 (65)
Q Consensus        40 RnVkGPVr~GDil~L   54 (65)
                      =+..+||..||.|++
T Consensus        74 ~rf~~pv~~Gdtl~~   88 (123)
T cd03455          74 FRLGAPLYAGDTLRF   88 (123)
T ss_pred             EEeeccccCCCEEEE
Confidence            356799999999875


No 48 
>PRK02542 photosystem I assembly protein Ycf4; Provisional
Probab=29.51  E-value=74  Score=23.11  Aligned_cols=43  Identities=33%  Similarity=0.425  Sum_probs=35.0

Q ss_pred             cEEEEEEEEcC--CCCcEEEecccCc-----cccCcEEeeehhHHHHhhc
Q psy5287          22 QCTQVKVEFIG--DQNRTIIRNVKGP-----VREGDILTLLESEREARRL   64 (65)
Q Consensus        22 ~~tqVrve~l~--~~~r~i~RnVkGP-----Vr~GDil~LlEseREarrl   64 (65)
                      .+..+|+++-+  +|.|.|-=.+||-     -|.||-++|.|-|.+|-.|
T Consensus       128 dIqsIrveikeGlnprr~iyL~~kg~~~IPLTrig~pl~l~eiE~qAaeL  177 (188)
T PRK02542        128 DIQAVKVEIREGLNPRRRLYLRLKGRRDIPLTRVGQPLPLAELENQGAEL  177 (188)
T ss_pred             HeEEEEEEEecCcCCccEEEEEEcCCCcCCcccCCCCCCHHHHHHHHHHH
Confidence            46778888877  4888888888884     3689999999999998765


No 49 
>TIGR03000 plancto_dom_1 Planctomycetes uncharacterized domain TIGR03000. Domains described by this model are found, so far, only in the Planctomycetes (Pirellula sp. strain 1 and Gemmata obscuriglobus), in up to six proteins per genome, and may be duplicated within a protein. The function is unknown.
Probab=29.48  E-value=96  Score=19.43  Aligned_cols=30  Identities=33%  Similarity=0.447  Sum_probs=23.2

Q ss_pred             EEEEEEEcCCCCcEEEecccCccccCcEEee
Q psy5287          24 TQVKVEFIGDQNRTIIRNVKGPVREGDILTL   54 (65)
Q Consensus        24 tqVrve~l~~~~r~i~RnVkGPVr~GDil~L   54 (65)
                      .+|++++.-| |+.+.+-=+=+||-||...|
T Consensus        44 Y~v~a~~~~d-G~~~t~~~~V~vrAGd~~~v   73 (75)
T TIGR03000        44 YTVTAEYDRD-GRILTRTRTVVVRAGDTVTV   73 (75)
T ss_pred             EEEEEEEecC-CcEEEEEEEEEEcCCceEEe
Confidence            4677777655 68888877778999998876


No 50 
>smart00652 eIF1a eukaryotic translation initiation factor 1A.
Probab=29.35  E-value=1.4e+02  Score=18.32  Aligned_cols=45  Identities=24%  Similarity=0.420  Sum_probs=27.0

Q ss_pred             ceEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCc------cccCcEEeeehhH
Q psy5287           5 VVLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGP------VREGDILTLLESE   58 (65)
Q Consensus         5 ~~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGP------Vr~GDil~LlEse   58 (65)
                      ...|+|++.+|       -...+|++-|+  ..++-.+.|=      ++.||++.+..++
T Consensus         6 q~~g~V~~~lG-------~~~~~V~~~dG--~~~la~ipgK~Rk~iwI~~GD~VlVe~~~   56 (83)
T smart00652        6 QEIAQVVKMLG-------NGRLEVMCADG--KERLARIPGKMRKKVWIRRGDIVLVDPWD   56 (83)
T ss_pred             cEEEEEEEEcC-------CCEEEEEECCC--CEEEEEEchhhcccEEEcCCCEEEEEecC
Confidence            46799999998       33455554443  3333333332      6788888876543


No 51 
>cd03446 MaoC_like MoaC_like    Similar to the MaoC (monoamine oxidase C) dehydratase regulatory protein but without the N-terminal PutA domain. This protein family has a hot-dog fold similar to that of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.
Probab=28.26  E-value=39  Score=20.76  Aligned_cols=14  Identities=29%  Similarity=0.380  Sum_probs=11.5

Q ss_pred             cccCccccCcEEee
Q psy5287          41 NVKGPVREGDILTL   54 (65)
Q Consensus        41 nVkGPVr~GDil~L   54 (65)
                      +...||+.||.|..
T Consensus        86 ~f~~pv~~GD~l~~   99 (140)
T cd03446          86 RFLNPVFIGDTIRA   99 (140)
T ss_pred             EEcCCCCCCCEEEE
Confidence            36789999998865


No 52 
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies.
Probab=28.09  E-value=41  Score=16.70  Aligned_cols=13  Identities=38%  Similarity=0.818  Sum_probs=10.7

Q ss_pred             ccccCcEEeeehh
Q psy5287          45 PVREGDILTLLES   57 (65)
Q Consensus        45 PVr~GDil~LlEs   57 (65)
                      +++.||++.+++.
T Consensus        17 ~~~~Gd~v~v~~~   29 (54)
T cd00174          17 SFKKGDIIEVLEK   29 (54)
T ss_pred             CCCCCCEEEEEEc
Confidence            3678999999876


No 53 
>cd03441 R_hydratase_like (R)-hydratase [(R)-specific enoyl-CoA hydratase].  Catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway.  The structure of the monomer includes a five-strand antiparallel beta-sheet wrapped around a central alpha helix, referred to as a hot dog fold.  The active site lies within a substrate-binding tunnel formed by the homodimer.  Other enzymes with this fold include MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE),  and the fatty acid synthase beta subunit.
Probab=27.63  E-value=40  Score=19.85  Aligned_cols=14  Identities=36%  Similarity=0.460  Sum_probs=11.7

Q ss_pred             ccCccccCcEEeee
Q psy5287          42 VKGPVREGDILTLL   55 (65)
Q Consensus        42 VkGPVr~GDil~Ll   55 (65)
                      ...||..||.|++.
T Consensus        77 f~~Pv~~Gd~l~~~   90 (127)
T cd03441          77 FLAPVFPGDTLRVE   90 (127)
T ss_pred             EeCCcCCCCEEEEE
Confidence            46899999999864


No 54 
>CHL00010 infA translation initiation factor 1
Probab=27.01  E-value=1.5e+02  Score=17.83  Aligned_cols=41  Identities=15%  Similarity=0.218  Sum_probs=23.7

Q ss_pred             eEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCc-------cccCcEEeee
Q psy5287           6 VLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGP-------VREGDILTLL   55 (65)
Q Consensus         6 ~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGP-------Vr~GDil~Ll   55 (65)
                      ..+.|++++|     +...-|  ++.  .+..+....+|=       +.+||++.+.
T Consensus         9 ~~G~Vik~lg-----~~~y~V--~~~--~g~~~~c~~rGklr~~~i~~~vGD~V~ve   56 (78)
T CHL00010          9 MEGLVTESLP-----NGMFRV--RLD--NGCQVLGYISGKIRRNSIRILPGDRVKVE   56 (78)
T ss_pred             EEEEEEEEcC-----CCEEEE--EeC--CCCEEEEEeccceecCCcccCCCCEEEEE
Confidence            4588999886     122223  321  244555555553       4569999886


No 55 
>cd01288 FabZ FabZ is a 17kD beta-hydroxyacyl-acyl carrier protein (ACP) dehydratase that primarily catalyzes the dehydration of beta-hydroxyacyl-ACP to trans-2-acyl-ACP, the third step in the elongation phase of the bacterial/ plastid, type II, fatty-acid biosynthesis pathway.
Probab=27.00  E-value=42  Score=20.19  Aligned_cols=13  Identities=46%  Similarity=0.692  Sum_probs=11.0

Q ss_pred             ccCccccCcEEee
Q psy5287          42 VKGPVREGDILTL   54 (65)
Q Consensus        42 VkGPVr~GDil~L   54 (65)
                      .++||+.||.|.+
T Consensus        84 f~~pv~pgd~l~i   96 (131)
T cd01288          84 FRKPVVPGDQLIL   96 (131)
T ss_pred             EccccCCCCEEEE
Confidence            5699999999865


No 56 
>PF08402 TOBE_2:  TOBE domain;  InterPro: IPR013611 The TOBE domain [] (Transport-associated OB) always occurs as a dimer as the C-terminal strand of each domain is supplied by the partner. Probably involved in the recognition of small ligands such as molybdenum (e.g. P46930 from SWISSPROT) and sulphate (P16676 from SWISSPROT). Found in ABC transporters immediately after the ATPase domain. A strong RPE motif is found at the presumed N terminus of the domain. ; GO: 0005215 transporter activity, 0005524 ATP binding, 0016820 hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances, 0006810 transport, 0043190 ATP-binding cassette (ABC) transporter complex; PDB: 1Q12_A 1Q1B_C 2AWN_D 3RLF_B 3PUX_B 2R6G_B 3PUV_B 1Q1E_A 3PV0_B 2AWO_A ....
Probab=26.74  E-value=1.1e+02  Score=16.27  Aligned_cols=45  Identities=20%  Similarity=0.228  Sum_probs=25.6

Q ss_pred             EEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccC---ccccCcEEeee
Q psy5287           7 LARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKG---PVREGDILTLL   55 (65)
Q Consensus         7 ~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkG---PVr~GDil~Ll   55 (65)
                      .|+|..+.    -.|.-+.+.+++-++....+......   +...||-+.|.
T Consensus        19 ~g~V~~~~----~~G~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~G~~v~l~   66 (75)
T PF08402_consen   19 PGTVVSVE----FLGSETRYTVRLEGGEELVVRVPNSQRDSPLEPGDEVRLS   66 (75)
T ss_dssp             EEEEEEEE----EESSEEEEEEEETTSSEEEEEEESSG-TTT--TTSEEEEE
T ss_pred             EEEEEEEE----ECCCEEEEEEEECCCCEEEEEecCccccCCCCCCCEEEEE
Confidence            34454443    24667778888755544344444444   78899988764


No 57 
>smart00326 SH3 Src homology 3 domains. Src homology 3 (SH3) domains bind to target proteins through sequences containing proline and hydrophobic amino acids. Pro-containing polypeptides may bind to SH3 domains in 2 different binding orientations.
Probab=26.70  E-value=45  Score=16.66  Aligned_cols=13  Identities=46%  Similarity=0.879  Sum_probs=10.6

Q ss_pred             cccCcEEeeehhH
Q psy5287          46 VREGDILTLLESE   58 (65)
Q Consensus        46 Vr~GDil~LlEse   58 (65)
                      ++.||++.+.+..
T Consensus        21 ~~~Gd~v~v~~~~   33 (58)
T smart00326       21 FKKGDIITVLEKS   33 (58)
T ss_pred             CCCCCEEEEEEcC
Confidence            6789999998763


No 58 
>PRK14699 replication factor A; Provisional
Probab=25.98  E-value=2.4e+02  Score=22.60  Aligned_cols=50  Identities=14%  Similarity=0.314  Sum_probs=33.1

Q ss_pred             ceEEEEEEec-cc-----cCCcCcEEEEEEEEcCCCC--cEEEecccCc------cccCcEEeeeh
Q psy5287           5 VVLARVIKTL-GR-----TGSQGQCTQVKVEFIGDQN--RTIIRNVKGP------VREGDILTLLE   56 (65)
Q Consensus         5 ~~~A~V~kVl-GR-----tGs~G~~tqVrve~l~~~~--r~i~RnVkGP------Vr~GDil~LlE   56 (65)
                      .-.|+|+.+- -|     -|+.|++.  .+.+-|++|  |...=+=..|      +++||++.+.-
T Consensus        71 ~i~~rVl~i~~~r~f~r~dG~~g~v~--~~~iaDeTG~ir~tlW~~~a~~~~~g~l~~GDvv~I~~  134 (484)
T PRK14699         71 NFIARVVSVFDTKEFTRNDGTIGRVG--NLIVGDETGKIKLTLWDNMADLIKAGKIKAGQTLQISG  134 (484)
T ss_pred             EEEEEEEEecCceEEecCCCCceEEE--EEEEecCCCeEEEEEecCccchhhhcCCCCCCEEEEcc
Confidence            3468999886 33     57777776  344446665  4455555554      89999998854


No 59 
>cd03449 R_hydratase (R)-hydratase [(R)-specific enoyl-CoA hydratase] catalyzes the hydration of trans-2-enoyl CoA to (R)-3-hydroxyacyl-CoA as part of the PHA (polyhydroxyalkanoate) biosynthetic pathway.  (R)-hydratase contains a hot-dog fold similar to those of thioesterase II, and beta-hydroxydecanoyl-ACP dehydratase, MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and the fatty acid synthase beta subunit.  The active site lies within a substrate-binding tunnel formed by the (R)-hydratase homodimer.  A subset of the bacterial (R)-hydratases contain a C-terminal phosphotransacetylase (PTA) domain.
Probab=25.90  E-value=47  Score=19.75  Aligned_cols=15  Identities=33%  Similarity=0.313  Sum_probs=12.3

Q ss_pred             ecccCccccCcEEee
Q psy5287          40 RNVKGPVREGDILTL   54 (65)
Q Consensus        40 RnVkGPVr~GDil~L   54 (65)
                      -+.+.||..||.|.+
T Consensus        77 ~~f~~Pv~~gd~l~~   91 (128)
T cd03449          77 LRFLRPVFIGDTVTA   91 (128)
T ss_pred             EEECCCccCCCEEEE
Confidence            367899999998875


No 60 
>PF02392 Ycf4:  Ycf4;  InterPro: IPR003359 Photosystem I (PSI) is a large protein complex embedded within the photosynthetic thylakoid membrane. It consists of 11 subunits, ~100 chlorophyll a molecules, 2 phylloquinones, and 3 Fe4S4-clusters. The three dimensional structure of the PSI complex has been resolved at 2.5 A [], which allows the precise localisation of each cofactor. PSI together with photosystem II (PSII) catalyses the light-induced steps in oxygenic photosynthesis - a process found in cyanobacteria, eukaryotic algae (e.g. red algae, green algae) and higher plants. To date, three thylakoid proteins involved in the stable accumulation of PSI have been identified: BtpA (IPR005137 from INTERPRO) [], Ycf3 [, ], and Ycf4 []. Because translation of the psaA and psaB mRNAs encoding the two reaction centre polypeptides, of PSI and PSII respectively, is not affected in mutant strains lacking functional ycf3 and ycf4, the products of these two genes appear to act at a post-translational step of PSI biosynthesis. These gene products are therefore involved either in the stabilisation or in the assembly of the PSI complex. However, their exact roles remain unknown. The BtpA protein appears to act at the level of PSI stabilisation []. It is an extrinsic membrane protein located on the cytoplasmic side of the thylakoid membrane [, ]. Homologs of BtpA are found in the crenarchaeota and euryarchaeota, where their function remains unknown. The Ycf4 protein is firmly associated with the thylakoid membrane, presumably through a transmembrane domain []. Ycf4 co-fractionates with a protein complex larger than PSI upon sucrose density gradient centrifugation of solubilised thylakoids []. The Ycf3 protein is loosely associated with the thylakoid membrane and can be released from the membrane with sodium carbonate. This suggests that Ycf3 is not part of a stable complex and that it probably interacts transiently with its partners []. Ycf3 contains a number of tetratrico peptide repeats (TPR, IPR001440 from INTERPRO); TPR is a structural motif present in a wide range of proteins, which mediates protein-protein interactions. ; GO: 0015979 photosynthesis, 0009522 photosystem I, 0009579 thylakoid, 0016021 integral to membrane
Probab=25.47  E-value=97  Score=22.26  Aligned_cols=43  Identities=35%  Similarity=0.495  Sum_probs=35.1

Q ss_pred             cEEEEEEEEcCC--CCcEEEecccC----c-cccCcEEeeehhHHHHhhc
Q psy5287          22 QCTQVKVEFIGD--QNRTIIRNVKG----P-VREGDILTLLESEREARRL   64 (65)
Q Consensus        22 ~~tqVrve~l~~--~~r~i~RnVkG----P-Vr~GDil~LlEseREarrl   64 (65)
                      .+..+|+++-++  |.|.|-=.+||    | -|.||-++|.|-|.+|-.|
T Consensus       121 dI~sIrv~i~eg~nprr~lyl~~k~~~~IPLTrig~~~~l~eiE~~aaeL  170 (180)
T PF02392_consen  121 DIQSIRVEIKEGFNPRRVLYLRTKGQRDIPLTRIGEPLTLSEIEEKAAEL  170 (180)
T ss_pred             HeEEEEEEEccCCCCcceEEEEecCCcccCCccCCCCCCHHHHHHHHHHH
Confidence            467788888775  78988888888    4 3779999999999998765


No 61 
>KOG2716|consensus
Probab=25.39  E-value=24  Score=25.94  Aligned_cols=18  Identities=50%  Similarity=0.791  Sum_probs=15.2

Q ss_pred             cccCcEEeeehhHHHHhhc
Q psy5287          46 VREGDILTLLESEREARRL   64 (65)
Q Consensus        46 Vr~GDil~LlEseREarrl   64 (65)
                      .|.||+. |-|+|+|.+.|
T Consensus        64 mRdGdv~-LPe~~kel~El   81 (230)
T KOG2716|consen   64 MRDGDVD-LPESEKELKEL   81 (230)
T ss_pred             hhccccc-CccchHHHHHH
Confidence            6889998 99999997665


No 62 
>cd03453 SAV4209_like SAV4209_like.  Similar in sequence to the Streptomyces avermitilis SAV4209 protein, with a hot dog fold that is similar to those of (R)-specific enoyl-CoA hydratase, the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.
Probab=25.21  E-value=47  Score=20.51  Aligned_cols=15  Identities=33%  Similarity=0.308  Sum_probs=12.5

Q ss_pred             cccCccccCcEEeee
Q psy5287          41 NVKGPVREGDILTLL   55 (65)
Q Consensus        41 nVkGPVr~GDil~Ll   55 (65)
                      ...+||..||.|++.
T Consensus        76 rf~~Pv~~Gdtl~~~   90 (127)
T cd03453          76 RFTKPVPVPDTLTCT   90 (127)
T ss_pred             EECCcCcCCCEEEEE
Confidence            567999999998863


No 63 
>TIGR00523 eIF-1A eukaryotic/archaeal initiation factor 1A. Recommended nomenclature: eIF-1A for eukaryotes, aIF-1A for Archaea. Also called eIF-4C
Probab=25.19  E-value=1.9e+02  Score=18.46  Aligned_cols=41  Identities=29%  Similarity=0.583  Sum_probs=25.2

Q ss_pred             ceEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCc------cccCcEEee
Q psy5287           5 VVLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGP------VREGDILTL   54 (65)
Q Consensus         5 ~~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGP------Vr~GDil~L   54 (65)
                      ...|+|++.+|     +.  ..+|++.|  +..++-.+.|=      ++.||++.+
T Consensus        20 e~~g~V~~~lG-----~~--~~~V~~~d--G~~~la~i~GK~Rk~iwI~~GD~VlV   66 (99)
T TIGR00523        20 EILGVIEQMLG-----AG--RVKVRCLD--GKTRLGRIPGKLKKRIWIREGDVVIV   66 (99)
T ss_pred             EEEEEEEEEcC-----CC--EEEEEeCC--CCEEEEEEchhhcccEEecCCCEEEE
Confidence            46799999998     23  34444433  44455555554      567888776


No 64 
>PF14604 SH3_9:  Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A ....
Probab=24.96  E-value=42  Score=18.21  Aligned_cols=13  Identities=38%  Similarity=0.861  Sum_probs=9.6

Q ss_pred             ccccCcEEeeehh
Q psy5287          45 PVREGDILTLLES   57 (65)
Q Consensus        45 PVr~GDil~LlEs   57 (65)
                      .++.||+|.+++.
T Consensus        14 s~~~Gd~i~v~~~   26 (49)
T PF14604_consen   14 SFKKGDVITVLEK   26 (49)
T ss_dssp             EB-TTEEEEEEEE
T ss_pred             eEcCCCEEEEEEe
Confidence            3678999999865


No 65 
>cd04091 mtEFG1_II_like mtEFG1_C: C-terminus of mitochondrial Elongation factor G1 (mtEFG1)-like proteins found in eukaryotes.  Eukaryotic cells harbor 2 protein synthesis systems: one localized in the cytoplasm, the other in the mitochondria. Most factors regulating mitochondrial protein synthesis are encoded by nuclear genes, translated in the cytoplasm, and then transported to the mitochondria. The eukaryotic system of elongation factor (EF) components is more complex than that in prokaryotes, with both cytoplasmic and mitochondrial elongation factors and multiple isoforms being expressed in certain species.  Eukaryotic EF-2 operates in the cytosolic protein synthesis machinery of eukaryotes, EF-Gs in protein synthesis in bacteria.  Eukaryotic mtEFG1 proteins show significant homology to bacterial EF-Gs.  Mutants in yeast mtEFG1 have impaired mitochondrial protein synthesis, respiratory defects and a tendency to lose mitochondrial DNA. There are two forms of mtEFG present in mammals 
Probab=24.86  E-value=37  Score=19.74  Aligned_cols=22  Identities=23%  Similarity=0.452  Sum_probs=16.2

Q ss_pred             EEEecccCccccCcEEeeehhH
Q psy5287          37 TIIRNVKGPVREGDILTLLESE   58 (65)
Q Consensus        37 ~i~RnVkGPVr~GDil~LlEse   58 (65)
                      .+.|-..|-++.||.|....+.
T Consensus        17 ~~~Rv~sG~lk~gd~v~~~~~~   38 (81)
T cd04091          17 TYMRIYQGKLKKGDTIYNVRTG   38 (81)
T ss_pred             EEEEEecCEEcCCCEEEEcCCC
Confidence            4677788888888888766543


No 66 
>cd03703 aeIF5B_II aeIF5B_II: This family represents the domain II of archeal and eukaryotic aeIF5B. aeIF5B is a homologue of prokaryotic Initiation Factor 2 (IF2).  Disruption of the eIF5B gene (FUN12) in yeast causes a severe slow-growth phenotype, associated with a defect in translation. eIF5B has a function analogous to prokaryotic IF2 in mediating the joining of joining of 60S subunits.  The eIF5B consists of three N-terminal domains  (I, II, II) connected by a long helix to domain IV. Domain I is a G domain, domain II and IV are beta-barrels and domain III has a novel alpha-beta-alpha sandwich fold. The G domain and the beta-barrel domain II display a similar structure and arrangement to the homologous domains of EF1A, eEF1A and aeIF2gamma.
Probab=24.77  E-value=2e+02  Score=18.84  Aligned_cols=26  Identities=19%  Similarity=0.314  Sum_probs=19.8

Q ss_pred             EEecccCccccCcEEeeehhHHHHhhc
Q psy5287          38 IIRNVKGPVREGDILTLLESEREARRL   64 (65)
Q Consensus        38 i~RnVkGPVr~GDil~LlEseREarrl   64 (65)
                      +..+..+. -.||.+..-++|.||+.+
T Consensus        79 ~~~gL~~v-~aG~~~~vv~~e~~a~~~  104 (110)
T cd03703          79 LAPDLEKA-IAGSPLLVVGPEDEIEEL  104 (110)
T ss_pred             EeCCCccc-cCCCEEEEECCHHHHHHH
Confidence            34444555 679999999999999875


No 67 
>cd03691 BipA_TypA_II BipA_TypA_II: domain II of BipA (also called TypA) having homology to domain II of the elongation factors (EFs) EF-G and EF-Tu.  BipA is a highly conserved protein with global regulatory properties in Escherichia coli.  BipA is phosphorylated on a tyrosine residue under some cellular conditions. Mutants show altered regulation of some pathways. BipA functions as a translation factor that is required specifically for the expression of the transcriptional modulator Fis.  BipA binds to ribosomes at a site that coincides with that of EF-G and has a GTPase activity that is sensitive to high GDP:GTP ratios and, is stimulated  by 70S ribosomes programmed with mRNA and aminoacylated tRNAs. The growth rate-dependent induction of BipA allows the efficient expression of Fis, thereby modulating a range of downstream processes, including DNA metabolism and type III secretion.
Probab=24.56  E-value=1.5e+02  Score=17.04  Aligned_cols=21  Identities=24%  Similarity=0.450  Sum_probs=17.2

Q ss_pred             EEEecccCccccCcEEeeehh
Q psy5287          37 TIIRNVKGPVREGDILTLLES   57 (65)
Q Consensus        37 ~i~RnVkGPVr~GDil~LlEs   57 (65)
                      .+.|-..|-++.||.|.....
T Consensus        18 ~~~Rv~sG~l~~g~~v~~~~~   38 (86)
T cd03691          18 AIGRIFRGTVKVGQQVAVVKR   38 (86)
T ss_pred             EEEEEEeCEEcCCCEEEEEcC
Confidence            588999999999999976654


No 68 
>PF09874 DUF2101:  Predicted membrane protein (DUF2101);  InterPro: IPR018663  This family of conserved hypothetical proteins has no known function. 
Probab=24.50  E-value=1e+02  Score=22.71  Aligned_cols=46  Identities=28%  Similarity=0.315  Sum_probs=33.2

Q ss_pred             eEEEEEEeccccCCcCcEEEEEEEEcCC------CCcEEEecccCccccCcEEeeehhHHH
Q psy5287           6 VLARVIKTLGRTGSQGQCTQVKVEFIGD------QNRTIIRNVKGPVREGDILTLLESERE   60 (65)
Q Consensus         6 ~~A~V~kVlGRtGs~G~~tqVrve~l~~------~~r~i~RnVkGPVr~GDil~LlEseRE   60 (65)
                      +.+.|.++=+      ..  |+|..=||      |+..++-|+- -+.+||++-|+=.||-
T Consensus       145 TyG~VeEv~~------~~--v~V~V~dDI~ANVkPg~YwV~~~~-d~~~G~vVKl~VE~r~  196 (206)
T PF09874_consen  145 TYGVVEEVKE------NL--VRVFVHDDIAANVKPGYYWVEAVP-DVEEGDVVKLLVEERT  196 (206)
T ss_pred             eeEEEEEecC------CE--EEEEEccchhhcCCCCeEEecCCC-CCCCCceEEEEEeccc
Confidence            5667777654      33  45555465      8999999988 6889999999866653


No 69 
>PRK06386 replication factor A; Reviewed
Probab=24.45  E-value=3.3e+02  Score=21.22  Aligned_cols=48  Identities=17%  Similarity=0.318  Sum_probs=30.1

Q ss_pred             eEEEEEEecc----ccCCcCcEEEEEEEEcC-CCCcEEEecccCccccCcEEeeeh
Q psy5287           6 VLARVIKTLG----RTGSQGQCTQVKVEFIG-DQNRTIIRNVKGPVREGDILTLLE   56 (65)
Q Consensus         6 ~~A~V~kVlG----RtGs~G~~tqVrve~l~-~~~r~i~RnVkGPVr~GDil~LlE   56 (65)
                      ..|+|+++--    +.|+.|   .|+.=++. ++++.=+=.+.-++.+||++.+..
T Consensus       122 V~akVle~~e~e~~~~g~~~---~v~sg~lgDeTGrIr~TlW~~~l~eGd~v~i~n  174 (358)
T PRK06386        122 VIGKITGITKKEYDSDGTSK---IVYQGYIEDDTARVRISSFGKPLEDNRFVRIEN  174 (358)
T ss_pred             EEEEEEEccCceEecCCCcc---EEEEEEEEcCCCeEEEEEccccccCCCEEEEee
Confidence            4578877643    334334   44444554 577765555555899999998754


No 70 
>cd03447 FAS_MaoC FAS_MaoC, the MaoC-like hot dog fold of the fatty acid synthase, beta subunit.  Other enzymes with this fold include MaoC dehydratase, Hydratase-Dehydrogenase-Epimerase protein (HDE), and 17-beta-hydroxysteriod dehydrogenase (HSD).
Probab=24.30  E-value=49  Score=21.03  Aligned_cols=14  Identities=29%  Similarity=0.294  Sum_probs=11.9

Q ss_pred             cccCccccCcEEee
Q psy5287          41 NVKGPVREGDILTL   54 (65)
Q Consensus        41 nVkGPVr~GDil~L   54 (65)
                      +..+||..||.|.+
T Consensus        76 rf~~PV~~gdtl~~   89 (126)
T cd03447          76 SFVGMVLPNDELEV   89 (126)
T ss_pred             EEcccCcCCCEEEE
Confidence            36799999999886


No 71 
>COG3365 Uncharacterized protein conserved in archaea [Function unknown]
Probab=24.23  E-value=43  Score=22.85  Aligned_cols=18  Identities=50%  Similarity=0.685  Sum_probs=13.2

Q ss_pred             EEecccCccccCcEEeee
Q psy5287          38 IIRNVKGPVREGDILTLL   55 (65)
Q Consensus        38 i~RnVkGPVr~GDil~Ll   55 (65)
                      -+|-+---||+||||.|.
T Consensus        22 kvr~Iid~vr~G~IlVLE   39 (118)
T COG3365          22 KVRYIIDKVREGDILVLE   39 (118)
T ss_pred             HHHHHHHhccCCcEEEEe
Confidence            345556668899999884


No 72 
>PRK08572 rps17p 30S ribosomal protein S17P; Reviewed
Probab=23.56  E-value=85  Score=20.75  Aligned_cols=22  Identities=23%  Similarity=0.232  Sum_probs=15.7

Q ss_pred             cEEEeccc-CccccCcEEeeehh
Q psy5287          36 RTIIRNVK-GPVREGDILTLLES   57 (65)
Q Consensus        36 r~i~RnVk-GPVr~GDil~LlEs   57 (65)
                      ++....-. -...+||++.+.||
T Consensus        67 ky~aHDe~cn~~kvGD~V~I~E~   89 (108)
T PRK08572         67 RIHAHNPPCIDAKVGDKVKIAEC   89 (108)
T ss_pred             eEEEECCCCCCCCCCCEEEEEEc
Confidence            34444444 45899999999987


No 73 
>PF11095 Gemin7:  Gem-associated protein 7 (Gemin7);  InterPro: IPR020338 Gem-associated protein 7 (Gemin7) is a component of the survival of motor neuron complex, which functions in the assembly of spliceosomal small nuclear ribonucleoproteins. Gemin7 interacts with several Sm proteins of spliceosomal small nuclear ribonucleoproteins, especially SmE []. Gem-associated protein 7 is found in the nucleoplasm, in nuclear "gems" (Gemini of Cajal bodies), and in the cytoplasm. Three transcript variants encoding the same protein have been found for this gene [].; GO: 0032797 SMN complex; PDB: 1Y96_D.
Probab=23.46  E-value=1.6e+02  Score=18.56  Aligned_cols=30  Identities=23%  Similarity=0.474  Sum_probs=21.1

Q ss_pred             EEEEEEcC---CCCcEEEecccCc--------cccCcEEee
Q psy5287          25 QVKVEFIG---DQNRTIIRNVKGP--------VREGDILTL   54 (65)
Q Consensus        25 qVrve~l~---~~~r~i~RnVkGP--------Vr~GDil~L   54 (65)
                      +|.-+|-.   +....++.|-+.|        +|-+||+.+
T Consensus        36 ~V~a~F~a~d~~~~~f~Vs~L~TPlGv~~eAlLR~~DVi~~   76 (80)
T PF11095_consen   36 TVSARFGACDIDVSNFQVSNLQTPLGVQPEALLRCSDVISI   76 (80)
T ss_dssp             EEEEEEEEE-TTS-EEEEEEEETTTTEEEEEEEEGGGEEEE
T ss_pred             EEEEEEEEecCchheEEhhhcCCCcccChhheeecCCEEEE
Confidence            45555543   4568899999999        577888875


No 74 
>PRK00006 fabZ (3R)-hydroxymyristoyl-ACP dehydratase; Reviewed
Probab=23.38  E-value=52  Score=20.78  Aligned_cols=14  Identities=50%  Similarity=0.591  Sum_probs=11.1

Q ss_pred             ccCccccCcEEeee
Q psy5287          42 VKGPVREGDILTLL   55 (65)
Q Consensus        42 VkGPVr~GDil~Ll   55 (65)
                      ...||+.||.|.+.
T Consensus        98 F~~pv~pGd~l~i~  111 (147)
T PRK00006         98 FKRPVVPGDQLILE  111 (147)
T ss_pred             EccccCCCCEEEEE
Confidence            45899999998753


No 75 
>COG0298 HypC Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=23.13  E-value=2.2e+02  Score=18.31  Aligned_cols=38  Identities=16%  Similarity=0.410  Sum_probs=24.6

Q ss_pred             eEEEEEEeccccC-----CcCcEEEEEEEEcCCCCcEEEecccCccccCcEEee
Q psy5287           6 VLARVIKTLGRTG-----SQGQCTQVKVEFIGDQNRTIIRNVKGPVREGDILTL   54 (65)
Q Consensus         6 ~~A~V~kVlGRtG-----s~G~~tqVrve~l~~~~r~i~RnVkGPVr~GDil~L   54 (65)
                      -|++|++|-+-.+     .-|-..+|+..+++.           +++.||-+.+
T Consensus         5 iPgqI~~I~~~~~~A~Vd~gGvkreV~l~Lv~~-----------~v~~GdyVLV   47 (82)
T COG0298           5 IPGQIVEIDDNNHLAIVDVGGVKREVNLDLVGE-----------EVKVGDYVLV   47 (82)
T ss_pred             cccEEEEEeCCCceEEEEeccEeEEEEeeeecC-----------ccccCCEEEE
Confidence            4677888876433     234456677776653           8888997753


No 76 
>PRK10409 hydrogenase assembly chaperone; Provisional
Probab=23.09  E-value=2.1e+02  Score=18.23  Aligned_cols=41  Identities=17%  Similarity=0.267  Sum_probs=22.2

Q ss_pred             eEEEEEEecccc---CCcCcEEEEEEEEcCCCCcEEEecccC--ccccCcEEee
Q psy5287           6 VLARVIKTLGRT---GSQGQCTQVKVEFIGDQNRTIIRNVKG--PVREGDILTL   54 (65)
Q Consensus         6 ~~A~V~kVlGRt---Gs~G~~tqVrve~l~~~~r~i~RnVkG--PVr~GDil~L   54 (65)
                      .|++|+++-|-+   ...|...+|...+++        ...+  ++.+||.+.+
T Consensus         5 iP~kVv~i~~~~A~vd~~Gv~reV~l~Lv~--------~~~~~~~~~vGDyVLV   50 (90)
T PRK10409          5 VPGQIRTIDGNQAKVDVCGIQRDVDLTLVG--------SCDENGQPRVGQWVLV   50 (90)
T ss_pred             cceEEEEEcCCeEEEEcCCeEEEEEEeeec--------ccCCCCccCCCCEEEE
Confidence            478999986521   222333333333332        2222  5889998764


No 77 
>PF08817 YukD:  WXG100 protein secretion system (Wss), protein YukD;  InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold []. Ubiquitin covalently binds to protein and flags them for protein degradation, however conjugation assays have indicated that YukD lacks the capacity for covalent bond formation with other proteins []. ; PDB: 2BPS_B.
Probab=22.77  E-value=50  Score=19.36  Aligned_cols=11  Identities=55%  Similarity=0.890  Sum_probs=5.5

Q ss_pred             ccccCcEEeee
Q psy5287          45 PVREGDILTLL   55 (65)
Q Consensus        45 PVr~GDil~Ll   55 (65)
                      +|+-||+|.|+
T Consensus        69 gV~dGd~L~L~   79 (79)
T PF08817_consen   69 GVRDGDVLVLR   79 (79)
T ss_dssp             T--TT-EEEE-
T ss_pred             CCCCCCEEEeC
Confidence            47888888874


No 78 
>PF07653 SH3_2:  Variant SH3 domain;  InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ]. They are found in a great variety of intracellular or membrane-associated proteins [, , ] for example, in a variety of proteins with enzymatic activity, in adaptor proteins that lack catalytic sequences and in cytoskeletal proteins, such as fodrin and yeast actin binding protein ABP-1. The SH3 domain has a characteristic fold which consists of five or six beta-strands arranged as two tightly packed anti-parallel beta sheets. The linker regions may contain short helices []. The surface of the SH3-domain bears a flat, hydrophobic ligand-binding pocket which consists of three shallow grooves defined by conservative aromatic residues in which the ligand adopts an extended left-handed helical arrangement. The ligand binds with low affinity but this may be enhanced by multiple interactions. The region bound by the SH3 domain is in all cases proline-rich and contains PXXP as a core-conserved binding motif. The function of the SH3 domain is not well understood but they may mediate many diverse processes such as increasing local concentration of proteins, altering their subcellular location and mediating the assembly of large multiprotein complexes []. This entry represents a variant of the SH3 domain.; PDB: 1I1J_B 1K0X_A 1HJD_A 2KEA_A 1KJW_A 1JXM_A 1JXO_B 2EBP_A 2DL3_A 2EYX_A ....
Probab=22.60  E-value=40  Score=18.29  Aligned_cols=12  Identities=33%  Similarity=0.850  Sum_probs=9.0

Q ss_pred             cccCcEEeee-hh
Q psy5287          46 VREGDILTLL-ES   57 (65)
Q Consensus        46 Vr~GDil~Ll-Es   57 (65)
                      +..||+|.++ +.
T Consensus        18 ~~~Gd~i~v~~~~   30 (55)
T PF07653_consen   18 FKKGDVIEVLGEK   30 (55)
T ss_dssp             B-TTEEEEEEEEE
T ss_pred             EecCCEEEEEEee
Confidence            6789999998 44


No 79 
>PF01455 HupF_HypC:  HupF/HypC family;  InterPro: IPR001109 The large subunit of [NiFe]-hydrogenase, as well as other nickel metalloenzymes, is synthesised as a precursor devoid of the metalloenzyme active site. This precursor then undergoes a complex post-translational maturation process that requires a number of accessory proteins. The hydrogenase expression/formation proteins (HupF/HypC) form a family of small proteins that are hydrogenase precursor-specific chaperones required for this maturation process []. They are believed to keep the hydrogenase precursor in a conformation accessible for metal incorporation [, ].; PDB: 3D3R_A 2Z1C_C 2OT2_A.
Probab=22.27  E-value=77  Score=18.86  Aligned_cols=42  Identities=21%  Similarity=0.321  Sum_probs=20.9

Q ss_pred             eEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCccccCcEEee
Q psy5287           6 VLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGPVREGDILTL   54 (65)
Q Consensus         6 ~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGPVr~GDil~L   54 (65)
                      .|++|+++- -.|..     -.|++- +..|.+-=..-+++.+||.+..
T Consensus         5 iP~~Vv~v~-~~~~~-----A~v~~~-G~~~~V~~~lv~~v~~Gd~VLV   46 (68)
T PF01455_consen    5 IPGRVVEVD-EDGGM-----AVVDFG-GVRREVSLALVPDVKVGDYVLV   46 (68)
T ss_dssp             EEEEEEEEE-TTTTE-----EEEEET-TEEEEEEGTTCTSB-TT-EEEE
T ss_pred             ccEEEEEEe-CCCCE-----EEEEcC-CcEEEEEEEEeCCCCCCCEEEE
Confidence            578999992 01222     223443 2233343444567888998753


No 80 
>PRK13691 (3R)-hydroxyacyl-ACP dehydratase subunit HadC; Provisional
Probab=22.08  E-value=57  Score=22.03  Aligned_cols=13  Identities=38%  Similarity=0.435  Sum_probs=11.4

Q ss_pred             ccCccccCcEEee
Q psy5287          42 VKGPVREGDILTL   54 (65)
Q Consensus        42 VkGPVr~GDil~L   54 (65)
                      ...||+.||.|+.
T Consensus        93 f~rPV~~GDtL~~  105 (166)
T PRK13691         93 FHKPVLAGDKLWA  105 (166)
T ss_pred             EeCCcCCCCEEEE
Confidence            6689999999875


No 81 
>PF05550 Peptidase_C53:  Pestivirus Npro endopeptidase C53;  InterPro: IPR008751 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Cysteine peptidases have characteristic molecular topologies, which can be seen not only in their three-dimensional structures, but commonly also in the two-dimensional structures. These are peptidases in which the nucleophile is the sulphydryl group of a cysteine residue. Cysteine proteases are divided into clans (proteins which are evolutionary related), and further sub-divided into families, on the basis of the architecture of their catalytic dyad or triad [].  This group of cysteine peptidases belong to MEROPS peptidase family C53 (clan C-). The active site residues occur in the order E, H, C in the sequence which is unlike that in any other family. They are unique to pestiviruses. The N-terminal cysteine peptidase (Npro) encoded by the bovine viral diarrhoea virus genome is responsible for the self-cleavage that releases the N terminus of the core protein. This unique protease is dispensable for viral replication, and its coding region can be replaced by a ubiquitin gene directly fused in frame to the core [, , , ].; GO: 0016032 viral reproduction, 0019082 viral protein processing
Probab=21.96  E-value=99  Score=22.20  Aligned_cols=26  Identities=35%  Similarity=0.547  Sum_probs=21.9

Q ss_pred             ceEEEEEEeccc-cCCcCcEEEEEEEE
Q psy5287           5 VVLARVIKTLGR-TGSQGQCTQVKVEF   30 (65)
Q Consensus         5 ~~~A~V~kVlGR-tGs~G~~tqVrve~   30 (65)
                      .+..+|+|-+|| |||-|..-.+-|=+
T Consensus       109 ~~~CEvTkriGRvTGSDgkLYHiyvC~  135 (168)
T PF05550_consen  109 TQMCEVTKRIGRVTGSDGKLYHIYVCI  135 (168)
T ss_pred             cceEeecceEEEEECCCCCEEEEEEec
Confidence            467899999999 89999998887654


No 82 
>TIGR00413 rlpA rare lipoprotein A. This is a family of prokaryotic proteins with unknown function. Lipoprotein annotation based on the presence of consensus lipoprotein signal sequence. Included in this family is the E. coli putative lipoprotein rlpA.
Probab=21.75  E-value=1.6e+02  Score=21.62  Aligned_cols=35  Identities=29%  Similarity=0.450  Sum_probs=24.0

Q ss_pred             EEEEEEEcCCCCcEEE-ecccCccccCcEEeeehhH
Q psy5287          24 TQVKVEFIGDQNRTII-RNVKGPVREGDILTLLESE   58 (65)
Q Consensus        24 tqVrve~l~~~~r~i~-RnVkGPVr~GDil~LlEse   58 (65)
                      |.|+|.-+++....++ =|=.||-..|-||.|...-
T Consensus        37 T~V~VtNl~ngrsviVrVnDRGPf~~gRiIDLS~aA   72 (208)
T TIGR00413        37 TYVKVTNLHNNRSVIVRINDRGPFSDDRIIDLSHAA   72 (208)
T ss_pred             CEEEEEECCCCCEEEEEEeCCCCCCCCCEEECCHHH
Confidence            6777777764322333 3668999999999986543


No 83 
>PTZ00241 40S ribosomal protein S11; Provisional
Probab=21.73  E-value=53  Score=23.22  Aligned_cols=13  Identities=38%  Similarity=0.649  Sum_probs=11.6

Q ss_pred             ccccCcEEeeehh
Q psy5287          45 PVREGDILTLLES   57 (65)
Q Consensus        45 PVr~GDil~LlEs   57 (65)
                      .+.+||++.+.||
T Consensus       116 ~~kvGD~V~I~Ec  128 (158)
T PTZ00241        116 DVKEGDIVVVGQC  128 (158)
T ss_pred             CCCCCCEEEEEEc
Confidence            3899999999987


No 84 
>PF04280 Tim44:  Tim44-like domain;  InterPro: IPR007379 Tim44 is an essential component of the machinery that mediates the translocation of nuclear-encoded proteins across the mitochondrial inner membrane []. Tim44 is thought to bind phospholipids of the mitochondrial inner membrane both by electrostatic interactions and by penetrating the polar head group region [].; GO: 0015450 P-P-bond-hydrolysis-driven protein transmembrane transporter activity, 0006886 intracellular protein transport, 0005744 mitochondrial inner membrane presequence translocase complex; PDB: 2CW9_A 2FXT_A 3QK9_A.
Probab=21.35  E-value=2.1e+02  Score=17.80  Aligned_cols=39  Identities=26%  Similarity=0.364  Sum_probs=26.5

Q ss_pred             eEEEEEEeccccCCcCcEEEEEEEEcCCCCcEEEecccCccccC
Q psy5287           6 VLARVIKTLGRTGSQGQCTQVKVEFIGDQNRTIIRNVKGPVREG   49 (65)
Q Consensus         6 ~~A~V~kVlGRtGs~G~~tqVrve~l~~~~r~i~RnVkGPVr~G   49 (65)
                      .-|+++++-..    |...++.|.|....... +++-.|=+.+|
T Consensus        77 ~~~~i~~~~~~----~~~~~vtv~f~~~~~~~-~~d~~G~ii~G  115 (147)
T PF04280_consen   77 DNAEIVEAEQE----GNFDQVTVRFRSQQIDY-VDDKDGEIIEG  115 (147)
T ss_dssp             EEEEEEEEEEE----TTEEEEEEEEEEEEEEE-EETTTCTCCCC
T ss_pred             EEEEeeeceee----CCEEEEEEEEEEEEEEE-EECCCCcEeeC
Confidence            33444444333    78899999996543344 88888888888


No 85 
>cd03450 NodN NodN (nodulation factor N) contains a single hot dog fold similar to those of the peroxisomal Hydratase-Dehydrogenase-Epimerase (HDE) protein, and the fatty acid synthase beta subunit.  Rhizobium and related species form nodules on the roots of their legume hosts, a symbiotic process that requires production of Nod factors, which are signal molecules involved in root hair deformation and meristematic cell division.  The nodulation gene products, including NodN, are involved in producing the Nod factors, however the role played by NodN is unclear.
Probab=21.04  E-value=57  Score=21.53  Aligned_cols=14  Identities=21%  Similarity=0.249  Sum_probs=11.8

Q ss_pred             cccCccccCcEEee
Q psy5287          41 NVKGPVREGDILTL   54 (65)
Q Consensus        41 nVkGPVr~GDil~L   54 (65)
                      ...+||..||.|+.
T Consensus        93 rF~~PV~~GDtl~~  106 (149)
T cd03450          93 RFPAPVPVGSRVRG  106 (149)
T ss_pred             EeCcceeCCcEEEE
Confidence            36799999999875


No 86 
>PF03061 4HBT:  Thioesterase superfamily;  InterPro: IPR006683 This family contains a wide variety of enzymes, principally thioesterases. This family includes 4HBT (3.1.2.23 from EC) which catalyses the final step in the biosynthesis of 4-hydroxybenzoate from 4-chlorobenzoate in the soil dwelling microbe Pseudomonas CBS-3. This family includes various cytosolic long-chain acyl-CoA thioester hydrolases. Long-chain acyl-CoA hydrolases hydrolyse palmitoyl-CoA to CoA and palmitate, they also catalyse the hydrolysis of other long chain fatty acyl-CoA thioesters. ; PDB: 3F5O_F 2F0X_D 2H4U_C 2PRX_A 2OV9_D 1YLI_B 3BJK_F 1IXL_A 3DKZ_B 2EIS_B ....
Probab=20.87  E-value=77  Score=16.98  Aligned_cols=15  Identities=40%  Similarity=0.629  Sum_probs=9.8

Q ss_pred             ecccCccccCcEEee
Q psy5287          40 RNVKGPVREGDILTL   54 (65)
Q Consensus        40 RnVkGPVr~GDil~L   54 (65)
                      =+-..|++.||.|..
T Consensus        38 i~f~~p~~~gd~l~~   52 (79)
T PF03061_consen   38 IDFLRPVRPGDTLRV   52 (79)
T ss_dssp             EEESS-BBTTSEEEE
T ss_pred             EEEccccCCCeEEEE
Confidence            345678899987764


No 87 
>TIGR01750 fabZ beta-hydroxyacyl-[acyl carrier protein] dehydratase FabZ. This enzyme, FabZ, shows overlapping substrate specificity with FabA with regard to chain length in fatty acid biosynthesis. FabZ works preferentially on shorter chains and is often designated (3R)-hydroxymyristoyl-[acyl carrier protein] dehydratase, although its actual specificity is broader. Unlike FabA, FabZ does not function as an isomerase and cannot initiate unsaturated fatty acid biosynthesis. However, only FabZ can act during the elongation of unsaturated fatty acid chains.
Probab=20.15  E-value=68  Score=20.00  Aligned_cols=14  Identities=43%  Similarity=0.665  Sum_probs=11.3

Q ss_pred             cccCccccCcEEee
Q psy5287          41 NVKGPVREGDILTL   54 (65)
Q Consensus        41 nVkGPVr~GDil~L   54 (65)
                      ...+||+.||.|++
T Consensus        93 kF~~~v~pGd~l~i  106 (140)
T TIGR01750        93 KFRRPVVPGDQLIL  106 (140)
T ss_pred             EECCccCCCCEEEE
Confidence            34699999999875


No 88 
>PRK11536 6-N-hydroxylaminopurine resistance protein; Provisional
Probab=20.01  E-value=58  Score=23.62  Aligned_cols=16  Identities=25%  Similarity=0.285  Sum_probs=14.0

Q ss_pred             cCccccCcEEeeehhH
Q psy5287          43 KGPVREGDILTLLESE   58 (65)
Q Consensus        43 kGPVr~GDil~LlEse   58 (65)
                      -|.|+.||.|.|+|.-
T Consensus       151 ~G~V~~GD~v~l~~r~  166 (223)
T PRK11536        151 PGKVSADAPLELVSRV  166 (223)
T ss_pred             CcEEcCCCEEEEEeCC
Confidence            4899999999999864


Done!