Query         psy531
Match_columns 80
No_of_seqs    36 out of 38
Neff          2.8 
Searched_HMMs 46136
Date          Fri Aug 16 23:19:20 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy531.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/531hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 cd07693 Ig1_Robo First immunog  97.7 7.5E-05 1.6E-09   44.3   4.3   36   38-77      6-41  (100)
  2 cd05762 Ig8_MLCK Eighth immuno  97.7 5.3E-05 1.1E-09   48.1   3.7   38   37-78      4-41  (98)
  3 cd05724 Ig2_Robo Second immuno  97.6 0.00015 3.3E-09   42.8   4.4   37   38-77      1-37  (86)
  4 cd04973 Ig1_FGFR First immunog  97.5 0.00015 3.2E-09   43.8   3.5   33   40-77      1-33  (79)
  5 cd05730 Ig3_NCAM-1_like Third   97.4  0.0002 4.3E-09   43.8   3.7   37   37-77      7-43  (95)
  6 cd05749 Ig2_Tyro3_like Second   97.4 0.00026 5.7E-09   44.2   3.9   38   38-78      3-40  (81)
  7 cd05712 Ig_Siglec_N Immunoglob  97.3 0.00039 8.3E-09   45.1   4.4   38   38-75      4-43  (119)
  8 cd05728 Ig4_Contactin-2-like F  97.3 0.00028 6.1E-09   42.9   3.2   37   38-78      4-40  (85)
  9 cd05722 Ig1_Neogenin First imm  97.3  0.0004 8.7E-09   42.6   3.6   36   38-77      4-39  (95)
 10 cd05747 Ig5_Titin_like M5, fif  97.2 0.00049 1.1E-08   42.2   3.7   37   37-77      7-43  (92)
 11 cd05873 Ig_Sema4D_like Immunog  97.2 0.00055 1.2E-08   44.0   4.0   35   38-77      1-35  (87)
 12 cd05891 Ig_M-protein_C C-termi  97.2 0.00056 1.2E-08   42.5   3.7   36   38-77      6-41  (92)
 13 cd05737 Ig_Myomesin_like_C C-t  97.1 0.00064 1.4E-08   41.8   3.5   35   39-77      7-41  (92)
 14 cd04972 Ig_TrkABC_d4 Fourth do  97.1 0.00073 1.6E-08   41.2   3.4   36   38-77      5-40  (90)
 15 cd04975 Ig4_SCFR_like Fourth i  97.1 0.00073 1.6E-08   43.7   3.4   35   40-78     10-45  (101)
 16 cd04979 Ig_Semaphorin_C Immuno  97.0  0.0014 3.1E-08   39.8   4.3   35   38-77      1-35  (89)
 17 cd05851 Ig3_Contactin-1 Third   97.0  0.0014 3.1E-08   40.4   4.0   36   38-77      6-41  (88)
 18 PF07679 I-set:  Immunoglobulin  96.9  0.0011 2.3E-08   39.2   3.2   36   38-77      5-40  (90)
 19 cd04982 IgV_TCR_gamma Immunogl  96.9  0.0017 3.6E-08   41.0   4.1   37   37-75      2-38  (116)
 20 cd05752 Ig1_FcgammaR_like Frst  96.9  0.0015 3.3E-08   40.2   3.8   37   38-77      5-41  (78)
 21 cd04968 Ig3_Contactin_like Thi  96.9  0.0013 2.9E-08   39.7   3.3   36   38-77      6-41  (88)
 22 cd05859 Ig4_PDGFR-alpha Fourth  96.9 0.00097 2.1E-08   42.9   2.8   32   42-77     12-43  (101)
 23 cd04983 IgV_TCR_alpha_like Imm  96.9  0.0016 3.5E-08   40.2   3.7   35   37-75      2-36  (109)
 24 cd05894 Ig_C5_MyBP-C C5 immuno  96.9  0.0016 3.5E-08   40.3   3.7   33   42-78      4-36  (86)
 25 cd05856 Ig2_FGFRL1-like Second  96.8  0.0014 3.1E-08   37.9   3.1   32   42-77      3-34  (82)
 26 cd05870 Ig5_NCAM-2 Fifth immun  96.8  0.0021 4.5E-08   39.9   3.6   32   39-74      7-38  (98)
 27 cd05758 Ig5_KIRREL3-like Fifth  96.7  0.0029 6.3E-08   39.2   3.9   35   40-77      8-42  (98)
 28 cd07706 IgV_TCR_delta Immunogl  96.6  0.0027 5.9E-08   40.3   3.6   36   37-75      3-38  (116)
 29 cd05882 Ig1_Necl-1 First (N-te  96.6  0.0027 5.8E-08   40.7   3.4   32   41-76      5-36  (95)
 30 cd00099 IgV Immunoglobulin var  96.6  0.0026 5.7E-08   38.6   3.0   31   43-76      1-31  (105)
 31 cd05754 Ig3_Perlecan_like Thir  96.5  0.0053 1.1E-07   36.8   4.2   38   37-77      5-42  (85)
 32 cd05729 Ig2_FGFR_like Second i  96.5  0.0051 1.1E-07   35.5   3.8   32   42-77      3-34  (85)
 33 smart00410 IG_like Immunoglobu  96.5  0.0059 1.3E-07   33.4   3.8   31   40-74      1-31  (86)
 34 smart00409 IG Immunoglobulin.   96.5  0.0059 1.3E-07   33.4   3.8   31   40-74      1-31  (86)
 35 cd05745 Ig3_Peroxidasin Third   96.4  0.0036 7.7E-08   36.9   2.8   28   47-78      1-28  (74)
 36 cd04980 IgV_L_kappa Immunoglob  96.4  0.0052 1.1E-07   38.5   3.7   36   37-75      4-39  (106)
 37 cd05732 Ig5_NCAM-1_like Fifth   96.4  0.0044 9.5E-08   37.4   3.2   34   39-76      7-40  (96)
 38 cd05867 Ig4_L1-CAM_like Fourth  96.4  0.0037 8.1E-08   37.0   2.7   26   48-77      1-26  (76)
 39 cd05715 Ig_P0-like Immunoglobu  96.3   0.011 2.3E-07   37.9   4.6   37   39-75      4-40  (116)
 40 cd05857 Ig2_FGFR Second immuno  96.2   0.009 1.9E-07   35.3   3.9   30   44-77      5-34  (85)
 41 cd05848 Ig1_Contactin-5 First   96.2  0.0076 1.6E-07   37.7   3.5   35   39-77      7-44  (94)
 42 cd05880 Ig_EVA1 Immunoglobulin  96.2   0.012 2.6E-07   38.3   4.6   36   39-74      4-39  (115)
 43 cd05865 Ig1_NCAM-1 First immun  96.2  0.0072 1.6E-07   38.6   3.4   37   37-76      4-41  (96)
 44 cd05850 Ig1_Contactin-2 First   96.1  0.0083 1.8E-07   37.4   3.5   36   39-78      7-45  (94)
 45 cd05765 Ig_3 Subgroup of the i  96.1  0.0091   2E-07   34.8   3.2   25   48-76      1-25  (81)
 46 PF07686 V-set:  Immunoglobulin  96.0   0.013 2.7E-07   34.9   3.8   35   39-76      7-41  (114)
 47 PF00047 ig:  Immunoglobulin do  96.0   0.007 1.5E-07   33.9   2.5   28   48-78      1-28  (64)
 48 cd05739 Ig3_RPTP_IIa_LAR_like   96.0  0.0084 1.8E-07   35.8   2.9   26   48-77      1-26  (69)
 49 cd04978 Ig4_L1-NrCAM_like Four  96.0  0.0095 2.1E-07   34.4   3.0   26   48-77      1-26  (76)
 50 cd07701 Ig1_Necl-3 First (N-te  96.0   0.011 2.3E-07   37.4   3.5   30   40-73      4-33  (95)
 51 cd05717 Ig1_Necl-1-3_like Firs  95.9   0.013 2.8E-07   35.9   3.5   30   40-73      4-33  (95)
 52 cd05852 Ig5_Contactin-1 Fifth   95.9    0.01 2.2E-07   35.9   3.0   26   48-77      1-26  (73)
 53 cd04977 Ig1_NCAM-1_like First   95.9  0.0094   2E-07   37.0   2.9   34   38-76      5-39  (92)
 54 cd05740 Ig_CEACAM_D4 Fourth im  95.8   0.013 2.8E-07   36.8   3.4   36   37-77      7-42  (91)
 55 cd05899 IgV_TCR_beta Immunoglo  95.8   0.013 2.7E-07   37.0   3.3   35   37-76      2-36  (110)
 56 cd05866 Ig1_NCAM-2 First immun  95.8  0.0091   2E-07   38.0   2.6   32   38-74      5-36  (92)
 57 cd04969 Ig5_Contactin_like Fif  95.7   0.012 2.7E-07   34.4   2.9   26   48-77      1-26  (73)
 58 cd05878 Ig_Aggrecan_like Immun  95.5   0.015 3.3E-07   37.6   3.0   28   47-74      1-34  (110)
 59 cd05902 Ig_Neurocan Immunoglob  95.5   0.015 3.2E-07   38.7   2.9   28   47-74      1-31  (110)
 60 PHA02826 IL-1 receptor-like pr  95.5   0.031 6.6E-07   41.1   4.7   38   39-76     28-72  (227)
 61 cd04974 Ig3_FGFR Third immunog  95.4   0.018 3.9E-07   35.4   3.0   24   48-75      1-24  (90)
 62 cd05716 Ig_pIgR Immunoglobulin  95.4   0.031 6.7E-07   34.3   3.8   31   43-76      2-32  (98)
 63 PF13895 Ig_2:  Immunoglobulin   95.1   0.025 5.5E-07   31.8   2.7   31   43-77      9-39  (80)
 64 cd05858 Ig3_FGFR-2 Third immun  95.0   0.038 8.2E-07   33.7   3.4   24   48-75      1-24  (90)
 65 cd04967 Ig1_Contactin First Ig  94.9   0.033 7.2E-07   33.9   3.1   29   45-77     16-44  (91)
 66 cd07690 Ig1_CD4 First immunogl  94.9   0.044 9.6E-07   35.4   3.8   29   43-75      2-30  (94)
 67 cd05743 Ig_Perlecan_D2_like Im  94.8    0.03 6.5E-07   33.3   2.6   26   48-77      1-26  (78)
 68 cd05869 Ig5_NCAM-1 Fifth immun  94.7   0.044 9.5E-07   33.9   3.3   29   45-77     14-42  (97)
 69 cd05726 Ig4_Robo Fhird immunog  94.7   0.047   1E-06   33.2   3.4   26   48-77      1-26  (90)
 70 cd05756 Ig1_IL1R_like First im  94.6   0.071 1.5E-06   33.7   4.1   35   42-77      8-44  (94)
 71 cd05853 Ig6_Contactin-4 Sixth   94.6   0.046 9.9E-07   34.9   3.1   28   49-78      1-28  (85)
 72 cd05735 Ig8_DSCAM Eight immuno  94.6   0.053 1.2E-06   33.4   3.3   26   48-77      1-26  (88)
 73 cd05868 Ig4_NrCAM Fourth immun  94.4    0.04 8.7E-07   32.9   2.5   26   48-77      1-26  (76)
 74 cd05714 Ig_CSPGs_LP Immunoglob  94.4   0.051 1.1E-06   33.8   3.0   29   47-75      1-31  (106)
 75 cd05861 Ig1_PDGFR-alphabeta Fr  94.3   0.057 1.2E-06   33.0   3.1   26   48-77      1-26  (84)
 76 cd05760 Ig2_PTK7 Second immuno  94.3   0.032   7E-07   33.3   1.8   23   51-77      1-23  (77)
 77 cd05849 Ig1_Contactin-1 First   94.2   0.077 1.7E-06   33.3   3.5   29   45-77     16-44  (93)
 78 cd05872 Ig_Sema4B_like Immunog  94.2   0.082 1.8E-06   34.0   3.7   32   41-77      4-35  (85)
 79 cd05746 Ig4_Peroxidasin Fourth  94.2   0.035 7.7E-07   32.3   1.8   23   51-77      1-23  (69)
 80 PHA02785 IL-beta-binding prote  94.1   0.076 1.6E-06   40.3   3.9   38   38-77    225-263 (326)
 81 PHA03376 BARF1; Provisional     94.1    0.11 2.5E-06   40.1   4.9   33   42-76     20-53  (221)
 82 cd05773 Ig8_hNephrin_like Eigh  94.1   0.077 1.7E-06   34.1   3.4   28   46-77     21-48  (109)
 83 smart00408 IGc2 Immunoglobulin  94.0   0.094   2E-06   27.3   3.1   27   47-77      1-27  (63)
 84 cd05871 Ig_Semaphorin_classIII  93.9     0.1 2.2E-06   32.9   3.6   29   42-75      5-33  (91)
 85 cd04970 Ig6_Contactin_like Six  93.9   0.067 1.5E-06   32.1   2.7   26   49-77      1-27  (85)
 86 cd05845 Ig2_L1-CAM_like Second  93.6    0.16 3.4E-06   33.4   4.4   38   37-77      7-44  (95)
 87 PHA02982 hypothetical protein;  93.5    0.09   2E-06   41.3   3.5   59   13-74      4-62  (251)
 88 cd05896 Ig1_IL1RAPL-1_like Fir  93.5    0.17 3.6E-06   34.5   4.4   37   41-77      8-51  (104)
 89 cd05881 Ig1_Necl-2 First (N-te  93.5    0.12 2.5E-06   33.8   3.5   31   41-75      5-35  (95)
 90 cd05713 Ig_MOG_like Immunoglob  93.4    0.12 2.6E-06   31.6   3.3   27   48-75      1-27  (100)
 91 cd05757 Ig2_IL1R_like Second i  93.3    0.12 2.7E-06   32.8   3.3   34   44-78      6-41  (92)
 92 PHA02826 IL-1 receptor-like pr  93.2    0.15 3.4E-06   37.4   4.2   36   41-77    137-174 (227)
 93 cd05718 Ig1_PVR_like First imm  93.2     0.1 2.3E-06   31.5   2.7   27   49-76      1-27  (98)
 94 cd05753 Ig2_FcgammaR_like Seco  93.1    0.16 3.5E-06   31.1   3.6   31   44-77     10-40  (83)
 95 cd05733 Ig6_L1-CAM_like Sixth   92.7    0.11 2.4E-06   31.0   2.3   23   51-77      1-23  (77)
 96 cd05725 Ig3_Robo Third immunog  92.5    0.15 3.2E-06   29.4   2.6   23   51-77      1-23  (69)
 97 cd05723 Ig4_Neogenin Fourth im  92.4    0.12 2.6E-06   30.3   2.2   24   50-77      1-24  (71)
 98 cd05875 Ig6_hNeurofascin_like   92.4    0.13 2.9E-06   31.0   2.4   23   51-77      1-23  (77)
 99 cd05877 Ig_LP_like Immunoglobu  92.2    0.22 4.8E-06   30.8   3.3   29   47-75      1-31  (106)
100 cd04976 Ig2_VEGFR Second immun  92.1     0.1 2.2E-06   30.9   1.7   24   51-78      1-24  (71)
101 cd05764 Ig_2 Subgroup of the i  92.1    0.26 5.7E-06   28.4   3.3   25   48-76      1-26  (74)
102 cd05863 Ig2_VEGFR-3 Second imm  91.4    0.14 2.9E-06   31.1   1.7   24   51-78      1-24  (67)
103 cd04984 IgV_L_lambda Immunoglo  91.4    0.21 4.6E-06   30.7   2.6   31   43-76      1-32  (98)
104 cd05892 Ig_Myotilin_C C-termin  91.2    0.17 3.7E-06   30.9   1.9   23   51-77      1-23  (75)
105 cd05742 Ig1_VEGFR_like First i  91.1    0.32 6.9E-06   29.0   3.1   28   48-77      1-28  (84)
106 cd05738 Ig2_RPTP_IIa_LAR_like   91.0    0.17 3.7E-06   29.8   1.8   23   51-77      1-23  (74)
107 cd05901 Ig_Versican Immunoglob  90.9    0.31 6.6E-06   33.4   3.2   28   47-74      1-35  (117)
108 cd05893 Ig_Palladin_C C-termin  90.9    0.17 3.7E-06   30.7   1.8   23   51-77      1-23  (75)
109 cd05895 Ig_Pro_neuregulin-1 Im  90.8    0.23 5.1E-06   29.0   2.3   25   51-78      1-25  (76)
110 cd05748 Ig_Titin_like Immunogl  90.7    0.25 5.4E-06   28.6   2.3   23   51-77      2-24  (74)
111 cd07700 IgV_CD8_beta Immunoglo  90.6    0.33 7.2E-06   30.7   3.0   31   43-76      1-31  (107)
112 cd05879 Ig_P0 Immunoglobulin (  90.6    0.72 1.6E-05   30.7   4.7   34   40-74      5-39  (116)
113 cd05727 Ig2_Contactin-2-like S  90.6    0.58 1.3E-05   30.8   4.2   35   41-78     11-45  (96)
114 cd05846 Ig1_MRC-OX-2_like Firs  90.5    0.37 7.9E-06   29.9   3.0   25   48-75      1-25  (97)
115 cd05775 Ig_SLAM-CD84_like_N N-  90.3    0.29 6.2E-06   30.8   2.5   27   45-74      1-27  (97)
116 PHA02785 IL-beta-binding prote  90.3    0.24 5.2E-06   37.6   2.5   32   45-77     38-71  (326)
117 cd05900 Ig_Aggrecan Immunoglob  90.1    0.39 8.4E-06   31.9   3.1   29   47-75      1-37  (112)
118 cd05741 Ig_CEACAM_D1_like Firs  90.1    0.43 9.2E-06   28.3   3.0   25   48-76      1-25  (92)
119 cd05720 Ig_CD8_alpha Immunoglo  89.9    0.36 7.8E-06   30.7   2.7   29   44-76      2-30  (104)
120 cd05711 Ig_FcalphaRI Immunoglo  89.9    0.42 9.1E-06   30.0   3.0   28   45-77     12-39  (94)
121 cd05763 Ig_1 Subgroup of the i  89.8    0.36 7.7E-06   28.1   2.5   22   51-76      1-22  (75)
122 cd05874 Ig6_NrCAM Sixth immuno  89.8    0.34 7.4E-06   29.2   2.5   23   51-77      1-23  (77)
123 cd05876 Ig3_L1-CAM Third immun  89.4    0.32 6.9E-06   28.5   2.0   23   51-77      1-23  (71)
124 cd05898 Ig5_KIRREL3 Fifth immu  89.4    0.68 1.5E-05   30.3   3.8   32   42-76     10-41  (98)
125 cd05736 Ig2_Follistatin_like S  89.1    0.34 7.4E-06   28.2   2.0   23   51-77      1-23  (76)
126 cd05744 Ig_Myotilin_C_like Imm  88.8    0.36 7.8E-06   28.8   2.0   24   51-78      1-24  (75)
127 cd05731 Ig3_L1-CAM_like Third   88.8    0.33 7.2E-06   27.4   1.8   23   51-77      1-23  (71)
128 cd05750 Ig_Pro_neuregulin Immu  88.4    0.51 1.1E-05   26.9   2.4   23   52-78      2-25  (75)
129 smart00406 IGv Immunoglobulin   88.4    0.65 1.4E-05   26.2   2.8   25   50-76      1-25  (81)
130 cd05751 Ig1_LILRB1_like First   88.4    0.61 1.3E-05   28.8   2.9   28   45-77     13-40  (91)
131 cd04981 IgV_H Immunoglobulin (  88.2     0.7 1.5E-05   30.1   3.2   35   38-75      2-37  (117)
132 PHA02987 Ig domain OX-2-like p  87.8    0.77 1.7E-05   34.6   3.6   32   41-75     23-54  (189)
133 cd05860 Ig4_SCFR Fourth immuno  87.4    0.81 1.7E-05   30.9   3.2   34   41-77     11-44  (101)
134 cd05864 Ig2_VEGFR-2 Second imm  87.1    0.42 9.2E-06   28.8   1.6   24   51-78      1-24  (70)
135 cd05854 Ig6_Contactin-2 Sixth   87.0    0.78 1.7E-05   28.1   2.7   26   49-77      1-27  (85)
136 cd00096 Ig Immunoglobulin doma  85.2     1.1 2.4E-05   22.3   2.4   24   51-78      1-24  (74)
137 cd05862 Ig1_VEGFR First immuno  83.9     1.5 3.2E-05   27.0   2.9   27   48-76      1-27  (86)
138 cd05766 IgC_MHC_II_beta Class   83.1     1.1 2.4E-05   28.5   2.2   28   46-77     12-41  (94)
139 PRK00059 prsA peptidylprolyl i  82.5     2.3   5E-05   31.7   4.0   46   12-57      2-51  (336)
140 PF05688 DUF824:  Salmonella re  82.2     1.3 2.9E-05   26.6   2.2   27   43-69      7-33  (47)
141 KOG4221|consensus               82.1     2.4 5.1E-05   39.9   4.7   37   39-79     47-83  (1381)
142 cd05774 Ig_CEACAM_D1 First imm  82.0     1.7 3.6E-05   28.6   2.8   29   42-74      7-35  (105)
143 cd07702 Ig2_VEGFR-1 Second imm  81.6     1.1 2.4E-05   27.5   1.7   23   52-78      2-24  (72)
144 cd00098 IgC Immunoglobulin Con  80.4     1.6 3.5E-05   25.9   2.1   30   46-78     11-41  (95)
145 PF07654 C1-set:  Immunoglobuli  79.9     1.4   3E-05   26.6   1.7   28   46-77      6-35  (83)
146 KOG3513|consensus               78.3     1.9 4.2E-05   39.4   2.8   37   39-77    522-558 (1051)
147 cd05771 IgC_Tapasin_R Tapasin-  78.2     4.6  0.0001   26.3   4.0   29   47-77     52-80  (139)
148 cd07692 Ig_CD3_epsilon Immunog  77.7     2.9 6.2E-05   26.6   2.7   25   46-77      5-29  (65)
149 PF15183 MRAP:  Melanocortin-2   75.2     4.1 8.8E-05   27.9   3.1   34    2-42     41-74  (90)
150 PF13473 Cupredoxin_1:  Cupredo  71.0     3.7 7.9E-05   26.0   2.0   16   39-54     33-48  (104)
151 cd05759 Ig2_KIRREL3-like Secon  70.4     4.8  0.0001   23.8   2.3   23   51-77      2-25  (82)
152 cd05755 Ig2_ICAM-1_like Second  70.0     6.5 0.00014   26.1   3.1   31   45-77     13-44  (100)
153 cd05767 IgC_MHC_II_alpha Class  69.2     5.2 0.00011   25.7   2.5   29   45-77     12-42  (94)
154 cd04985 IgC_CH1 CH1 domain (fi  68.5     6.1 0.00013   25.3   2.7   26   48-77     16-43  (95)
155 PF08940 DUF1918:  Domain of un  67.3     3.1 6.7E-05   26.3   1.1   19   58-77     29-47  (58)
156 cd05897 Ig2_IL1R2_like Second   66.7     5.6 0.00012   25.9   2.2   30   45-77      7-40  (95)
157 KOG4221|consensus               66.0     8.4 0.00018   36.5   4.0   38   36-77    143-180 (1381)
158 cd05887 Ig1_Nectin-3_like Firs  65.2     8.1 0.00017   25.1   2.8   23   50-75      2-24  (96)
159 cd05761 Ig2_Necl-1-4_like Seco  64.5      10 0.00022   22.9   3.0   24   51-77      2-25  (82)
160 cd05772 IgC_SIRP Signal-regula  59.6     9.4  0.0002   25.2   2.4   29   45-77     18-48  (111)
161 PRK10894 lipopolysaccharide tr  59.5      12 0.00027   26.4   3.1   46   13-58      2-55  (180)
162 cd07691 Ig_CD3_gamma_delta Imm  59.0      11 0.00024   24.4   2.5   21   47-76      5-25  (69)
163 PF03921 ICAM_N:  Intercellular  57.9     8.1 0.00018   25.7   1.8   25   37-61      7-31  (91)
164 PF08204 V-set_CD47:  CD47 immu  52.9      16 0.00036   25.7   2.8   34   44-77     23-57  (130)
165 cd05886 Ig1_Nectin-1_like Firs  52.7      21 0.00045   23.0   3.1   25   50-74      2-26  (99)
166 PF12028 DUF3515:  Protein of u  50.2      16 0.00035   26.1   2.5   30   48-77     78-113 (163)
167 TIGR02925 cis_trans_EpsD pepti  50.0      35 0.00077   24.0   4.2   19   40-58     25-43  (232)
168 cd07697 IgC_TCR_gamma T cell r  49.4      19 0.00042   23.3   2.6   26   48-77     16-43  (96)
169 cd05768 IgC_CH4 CH4 domain (fo  48.0      19 0.00041   23.2   2.3   28   46-77     14-43  (102)
170 cd05889 Ig1_DNAM-1_like First   47.7      26 0.00057   22.6   3.0   24   49-75      1-24  (96)
171 cd07696 IgC_CH3 CH3 domain (th  47.6      25 0.00054   22.5   2.8   27   46-76     12-41  (96)
172 cd05769 IgC_TCR_beta T cell re  47.6      15 0.00031   24.7   1.8   27   47-77     17-45  (115)
173 PF13624 SurA_N_3:  SurA N-term  44.4      17 0.00037   23.8   1.7   18   39-56     37-54  (154)
174 cd05847 IgC_CH2_IgE CH2 domain  42.5      30 0.00066   22.0   2.6   26   48-77     14-41  (94)
175 COG5660 Predicted integral mem  40.6      21 0.00046   28.1   2.0   33   12-44    180-212 (238)
176 PF08205 C2-set_2:  CD80-like C  40.1      25 0.00055   20.7   1.9   33   42-78      9-41  (89)
177 PF13927 Ig_3:  Immunoglobulin   40.1      27 0.00059   18.7   1.9   19   51-72     18-36  (75)
178 cd07705 Ig2_Necl-1 Second immu  39.2      44 0.00096   20.4   2.9   24   51-77      2-25  (83)
179 cd05885 Ig2_Necl-4 Second immu  38.8      45 0.00097   21.1   3.0   25   51-78      2-26  (80)
180 cd07699 IgC_L Immunoglobulin C  37.4      28  0.0006   22.1   1.9   27   47-77     16-44  (100)
181 cd05884 Ig2_Necl-3 Second immu  37.0      47   0.001   20.5   2.8   24   51-77      2-25  (83)
182 cd05888 Ig1_Nectin-4_like Frst  36.5      62  0.0013   20.2   3.3   25   50-75      2-26  (100)
183 PRK15315 outer membrane protei  35.4      35 0.00075   33.5   2.8   42   27-68    456-505 (1865)
184 cd05734 Ig7_DSCAM Seventh immu  34.4      23  0.0005   20.6   1.0   19   51-72      1-19  (79)
185 TIGR02657 amicyanin amicyanin.  33.8      39 0.00085   20.7   2.1   18   37-54      7-24  (83)
186 cd05721 IgV_CTLA-4 Immunoglobu  33.1      70  0.0015   22.1   3.4   32   43-75      8-39  (115)
187 PRK15249 fimbrial chaperone pr  32.5 1.1E+02  0.0025   22.9   4.7   52   19-76     13-68  (253)
188 KOG4194|consensus               31.1      52  0.0011   30.0   3.1   33   42-77    715-747 (873)
189 KOG3513|consensus               29.7      74  0.0016   29.6   3.9   38   37-78    335-372 (1051)
190 cd05770 IgC_beta2m Class I maj  29.3      61  0.0013   20.8   2.5   29   43-72     65-93  (93)
191 TIGR03516 ppisom_GldI peptidyl  29.0      48   0.001   23.8   2.1   24   17-43      5-28  (177)
192 PF15092 UPF0728:  Uncharacteri  29.0      55  0.0012   22.3   2.3   22   39-60     48-69  (88)
193 cd07689 Ig2_VCAM-1 Second immu  28.4      66  0.0014   21.8   2.6   27   45-74     12-40  (99)
194 TIGR03352 VI_chp_3 type VI sec  28.3 1.5E+02  0.0033   20.6   4.5   47   18-70      4-52  (146)
195 TIGR02656 cyanin_plasto plasto  28.2      52  0.0011   20.8   2.0   18   37-54     13-30  (99)
196 TIGR03042 PS_II_psbQ_bact phot  27.8      74  0.0016   22.9   2.9   21   14-35      4-24  (142)
197 KOG4222|consensus               27.6      59  0.0013   31.0   2.9   39   37-78    135-173 (1281)
198 KOG3515|consensus               27.5      53  0.0011   29.4   2.5   30   44-76     18-47  (741)
199 PRK02710 plastocyanin; Provisi  27.0 1.2E+02  0.0027   19.9   3.7   16   39-54     45-60  (119)
200 TIGR02375 pseudoazurin pseudoa  26.7      54  0.0012   22.3   2.0   18   37-54     11-28  (116)
201 KOG3073|consensus               26.5      25 0.00054   27.7   0.3   13   44-56     44-56  (236)
202 TIGR02408 ectoine_ThpD ectoine  25.9      44 0.00095   24.8   1.5   19   42-60    212-230 (277)
203 PF15284 PAGK:  Phage-encoded v  24.9      37  0.0008   21.8   0.8   12   54-66     42-53  (61)
204 PF07172 GRP:  Glycine rich pro  24.5      35 0.00076   22.7   0.7    8   23-30     14-21  (95)
205 KOG4194|consensus               24.5      55  0.0012   29.9   2.1   38   37-76    507-544 (873)
206 PF11153 DUF2931:  Protein of u  23.2      99  0.0022   22.1   2.9   18   18-35      4-21  (216)
207 cd05883 Ig2_Necl-2 Second immu  23.1 1.2E+02  0.0025   19.4   2.9   24   51-77      2-25  (82)
208 PF00084 Sushi:  Sushi domain (  22.6      52  0.0011   17.5   1.1   16   45-60     19-34  (56)
209 KOG4222|consensus               22.5      55  0.0012   31.2   1.7   36   40-79     38-73  (1281)
210 COG1952 SecB Preprotein transl  21.4      69  0.0015   23.7   1.8   18   43-60     66-83  (157)
211 PF14509 GH97_C:  Glycosyl-hydr  20.6      75  0.0016   21.1   1.7   23   53-76     42-64  (103)
212 COG5510 Predicted small secret  20.2      85  0.0018   19.0   1.7   23   17-39      9-31  (44)
213 PF13623 SurA_N_2:  SurA N-term  20.1 2.3E+02  0.0049   19.8   4.1   34   17-51     15-48  (145)

No 1  
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=97.71  E-value=7.5e-05  Score=44.32  Aligned_cols=36  Identities=22%  Similarity=0.532  Sum_probs=30.5

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +.|..++...|+.|.|.|.+.   |.|.| .++|.|+|..
T Consensus         6 ~~p~~~~v~~G~~~~l~C~~~---g~P~p-~i~W~k~g~~   41 (100)
T cd07693           6 EHPSDLIVSKGDPATLNCKAE---GRPTP-TIQWLKNGQP   41 (100)
T ss_pred             ecCceeEEcCCCeEEEEeeCC---cCCCC-EEEEEECCEE
Confidence            567889999999999999886   56777 5899999865


No 2  
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=97.69  E-value=5.3e-05  Score=48.08  Aligned_cols=38  Identities=26%  Similarity=0.239  Sum_probs=32.2

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      .+.|+.+++++|+.|.|.|.+.   |.|.|- ++|.|+|.+-
T Consensus         4 ~~~p~~~~v~~G~~v~l~C~~~---G~p~p~-v~W~kdg~~l   41 (98)
T cd05762           4 IQFPEDMKVRAGESVELFCKVT---GTQPIT-CTWMKFRKQI   41 (98)
T ss_pred             EECCcCEEEECCCEEEEEEEEc---ccCCCc-eEEEECCEEe
Confidence            3578889999999999999996   777776 8999998753


No 3  
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=97.59  E-value=0.00015  Score=42.81  Aligned_cols=37  Identities=22%  Similarity=0.452  Sum_probs=29.0

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ++|..+++..|+.|.|.|.+.  .+.|.| -++|.|+|.+
T Consensus         1 ~~p~~~~~~~G~~v~l~C~~~--~g~p~p-~i~W~k~g~~   37 (86)
T cd05724           1 VEPSDTQVAVGEMAVLECSPP--RGHPEP-TVSWRKDGQP   37 (86)
T ss_pred             CCCccEEEeCCCCEEEEEECC--CCCCCC-EEEEEECCEE
Confidence            468899999999999999763  345544 5789999865


No 4  
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=97.49  E-value=0.00015  Score=43.78  Aligned_cols=33  Identities=21%  Similarity=0.380  Sum_probs=27.6

Q ss_pred             cceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           40 AVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        40 P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+.++++.|+.|.|.|.+.-+    .| -++|.|+|.+
T Consensus         1 ~~~~~~~~G~~v~l~C~~~~~----~~-~v~W~k~g~~   33 (79)
T cd04973           1 VESYSAHPGDLLQLRCRLRDD----VQ-SINWTKDGVQ   33 (79)
T ss_pred             CCcEEecCCCCEEEEEEecCC----Cc-eEEEeeCCcC
Confidence            678889999999999998754    23 4999999975


No 5  
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=97.44  E-value=0.0002  Score=43.76  Aligned_cols=37  Identities=35%  Similarity=0.571  Sum_probs=30.9

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ++.+...++..|+.|.|.|.++   |.|.|- +.|.|+|..
T Consensus         7 ~~~~~~~~~~~G~~v~L~C~~~---g~P~p~-v~W~k~g~~   43 (95)
T cd05730           7 RQSEVNATANLGQSVTLACDAD---GFPEPT-MTWTKDGEP   43 (95)
T ss_pred             CCcccceEEeCCCCEEEEEecc---EeCCCE-EEEEECCEE
Confidence            4567788999999999999985   777776 799999864


No 6  
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=97.40  E-value=0.00026  Score=44.21  Aligned_cols=38  Identities=11%  Similarity=0.194  Sum_probs=33.7

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      ++|..++++.|+.|.|.|..   .|.|.|.-+.|.|+|.+-
T Consensus         3 ~~P~~~~v~~G~~v~l~C~a---~G~P~P~~I~W~k~g~~l   40 (81)
T cd05749           3 VEPEDLSVTANTPFNLTCQA---VGPPEPVEILWWQGGSPL   40 (81)
T ss_pred             CCCCceEEcCCCCEEEEEEe---eeecCCeEEEEEECCEEC
Confidence            57888999999999999986   699999889999999764


No 7  
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=97.35  E-value=0.00039  Score=45.09  Aligned_cols=38  Identities=18%  Similarity=0.277  Sum_probs=31.0

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCC--CCCceEEEeeecc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGD--TPVPYVLQWEKKI   75 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~--~PiPYVvqW~KdG   75 (80)
                      +.|+.+.|..|+.|+|+|.+++|.+  .+-...+.|.|+.
T Consensus         4 q~P~~v~~~~G~~VtL~C~f~~~~~~~~~~~~~~~Wykq~   43 (119)
T cd05712           4 WMPKSVSVQEGLCVLIPCSFSYPADWPVSNGVHGIWYKGH   43 (119)
T ss_pred             cCCCEEEEeccccEEEEEEeeCcccccCCCceEEEEEeCC
Confidence            5689999999999999999999953  2234668999984


No 8  
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=97.31  E-value=0.00028  Score=42.94  Aligned_cols=37  Identities=22%  Similarity=0.384  Sum_probs=31.6

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      +.|...++..|+.|.|.|.+.   |.|.| .+.|.|+|.+.
T Consensus         4 ~~p~~~~~~~G~~~~l~C~~~---g~p~p-~v~W~k~g~~~   40 (85)
T cd05728           4 KVISDTEADIGSSLRWECKAS---GNPRP-AYRWLKNGQPL   40 (85)
T ss_pred             ccCCccEEcCCCcEEEEEEee---EeCCC-EEEEEECCEEC
Confidence            468889999999999999876   77777 69999998753


No 9  
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=97.27  E-value=0.0004  Score=42.65  Aligned_cols=36  Identities=36%  Similarity=0.689  Sum_probs=28.9

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .+|+..+...|+.|.|.|.+.   +.|.| .++|.|+|..
T Consensus         4 ~~P~~~~~~~g~~v~l~C~v~---g~P~p-~i~W~k~g~~   39 (95)
T cd05722           4 SEPSDIVAVRGGPVVLNCSAE---GEPPP-KIEWKKDGVL   39 (95)
T ss_pred             ECCCCeEEcCCCCEEEeeecc---cCCCC-EEEEEECCeE
Confidence            467888889999999999986   45544 4699999874


No 10 
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=97.23  E-value=0.00049  Score=42.17  Aligned_cols=37  Identities=30%  Similarity=0.586  Sum_probs=31.3

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .++|..++++.|+.+.|.|.+.   +.|.|- +.|.|+|..
T Consensus         7 ~~~p~~~~~~~G~~~~L~C~~~---g~P~p~-v~W~k~g~~   43 (92)
T cd05747           7 LTKPRSLTVSEGESARFSCDVD---GEPAPT-VTWMREGQI   43 (92)
T ss_pred             cccCccEEEeCCCcEEEEEEEe---ecCCCE-EEEEECCEE
Confidence            4578889999999999999775   777775 999999865


No 11 
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=97.23  E-value=0.00055  Score=44.00  Aligned_cols=35  Identities=14%  Similarity=0.201  Sum_probs=28.6

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .+|+..+.+.|+.|+|.|..+-    |.|. +.|.|+|.+
T Consensus         1 ~~P~~~~v~~G~~v~L~C~~~~----~~~~-i~W~~ng~~   35 (87)
T cd05873           1 LDPRQRTFKLGNNAELKCSPKS----NLAR-VVWKFDGKV   35 (87)
T ss_pred             CCcceEEEECCCCEEEEEECCC----CCCe-EEEEECCEE
Confidence            3789999999999999999643    3343 799999875


No 12 
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=97.19  E-value=0.00056  Score=42.54  Aligned_cols=36  Identities=22%  Similarity=0.352  Sum_probs=30.4

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .-|..+++..|+.|.|.|.+.   +.|.|+ +.|.|+|.+
T Consensus         6 ~~p~~v~v~eG~~v~L~C~v~---g~P~p~-i~W~k~~~~   41 (92)
T cd05891           6 GLPDVVTIMEGKTLNLTCTVF---GNPDPE-VIWFKNDQD   41 (92)
T ss_pred             cCCCcEEEcCCCEEEEEEEEE---EeCCCe-EEEEECCEE
Confidence            457899999999999999985   567777 799999864


No 13 
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=97.14  E-value=0.00064  Score=41.78  Aligned_cols=35  Identities=23%  Similarity=0.376  Sum_probs=29.3

Q ss_pred             CcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           39 NAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        39 ~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      =|..++++.|+.+.|.|.+.   |.|.|- +.|.|+|.+
T Consensus         7 lp~~v~v~~G~~v~L~C~v~---G~P~p~-v~W~k~g~~   41 (92)
T cd05737           7 LPDVVTIMEGKTLNLTCTVF---GDPDPE-VSWLKNDQA   41 (92)
T ss_pred             CCceEEEeCCCcEEEEEEEE---ecCCCe-EEEEECCEE
Confidence            46788999999999999875   777775 789999865


No 14 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=97.08  E-value=0.00073  Score=41.24  Aligned_cols=36  Identities=14%  Similarity=0.385  Sum_probs=30.0

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +.|+..++..|+.|.|.|.+.   |.|.| -+.|.|+|..
T Consensus         5 ~~p~~~~v~~G~~v~l~C~~~---G~P~p-~v~W~~~g~~   40 (90)
T cd04972           5 DGPNATVVYEGGTATIRCTAE---GSPLP-KVEWIIAGLI   40 (90)
T ss_pred             cCCcCEEEcCCCcEEEEEEEE---EcCCC-eEEEEECCEE
Confidence            346677799999999999998   77776 6899999864


No 15 
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=97.05  E-value=0.00073  Score=43.73  Aligned_cols=35  Identities=26%  Similarity=0.412  Sum_probs=27.8

Q ss_pred             cceEEeecCCeEEEeeecCC-CCCCCCceEEEeeeccccc
Q psy531           40 AVHITALLGESVVFNCGVDF-PGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        40 P~~ltA~vGe~VVlnCdvdf-P~~~PiPYVvqW~KdG~~~   78 (80)
                      =..+++.+|++|.|.|.++= |   |+| .+.|.|||.+-
T Consensus        10 ~~~~~v~~G~~v~L~c~v~g~~---P~p-~v~W~Kdg~~i   45 (101)
T cd04975          10 NTTIFVNLGENLNLVVEVEAYP---PPP-HINWTYDNRTL   45 (101)
T ss_pred             CceEEEECCCCEEEEEEEEecC---CCC-ccEEEeCCeeC
Confidence            35788999999999999982 3   444 58999999753


No 16 
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=97.02  E-value=0.0014  Score=39.76  Aligned_cols=35  Identities=17%  Similarity=0.274  Sum_probs=27.9

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ++|..+++..|+.|.|.|.+.-    |.| -++|.|+|..
T Consensus         1 ~~~~~~~v~~g~~v~L~C~~~~----p~~-~i~W~k~~~~   35 (89)
T cd04979           1 AEEKVVTVVEGNSVFLECSPKS----NLA-SVVWLFQGGP   35 (89)
T ss_pred             CcceEEEEECCCcEEEEEeCCC----CCc-eEEEEECCcc
Confidence            3678889999999999999764    334 3899999854


No 17 
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=96.97  E-value=0.0014  Score=40.40  Aligned_cols=36  Identities=28%  Similarity=0.504  Sum_probs=30.4

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .+|...++..|+.|.|.|.++   |.|.|. +.|.|+|.+
T Consensus         6 ~~~~~~~~~~G~~v~l~C~~~---G~P~P~-v~W~k~~~~   41 (88)
T cd05851           6 VKFKDTYALKGQNVTLECFAL---GNPVPV-IRWRKILEP   41 (88)
T ss_pred             EccccEEEeCCCcEEEEEEec---ccCCCE-EEEEECCcC
Confidence            456778899999999999976   888885 999998764


No 18 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=96.95  E-value=0.0011  Score=39.17  Aligned_cols=36  Identities=31%  Similarity=0.478  Sum_probs=29.2

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +.|..++++.|+.+.|.|.+.-.   |.| .++|.|+|.+
T Consensus         5 ~~~~~~~v~~G~~~~l~c~~~~~---p~~-~v~W~~~~~~   40 (90)
T PF07679_consen    5 KKPKDVTVKEGESVTLECEVSGN---PPP-TVTWYKNGRP   40 (90)
T ss_dssp             EESSEEEEETTSEEEEEEEEEES---SSS-EEEEEETTEE
T ss_pred             EecCCEEEeCCCEEEEEEEEEeC---CCC-cccccccccc
Confidence            35788999999999999999733   444 7899999865


No 19 
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=96.93  E-value=0.0017  Score=41.04  Aligned_cols=37  Identities=19%  Similarity=0.216  Sum_probs=30.0

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      .|.|..+++..|+.|-|+|.+.-+  .-.++.+.|.|+.
T Consensus         2 ~Q~p~~~~~~~G~~v~l~C~~~~~--~~~~~~v~Wyrq~   38 (116)
T cd04982           2 EQPQLSITREESKSVTISCKVSGI--DFSTTYIHWYRQK   38 (116)
T ss_pred             CCcCCeEEeCCCCCEEEEEEEeCC--CccccEEEEEEEC
Confidence            578999999999999999998664  1235679999973


No 20 
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=96.92  E-value=0.0015  Score=40.24  Aligned_cols=37  Identities=22%  Similarity=0.236  Sum_probs=29.7

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ..|+..+...|+.|.|.|..+-.   |.|--++|.|+|..
T Consensus         5 ~~P~~~~v~~G~~V~L~C~~~~~---p~~~~~~W~kng~~   41 (78)
T cd05752           5 LDPPWTTIFQGEKVTLTCNGFNS---PEQNSTQWYHNGKL   41 (78)
T ss_pred             eCCCCeEeeCCCCEEEEEeCCCC---CCCccEEEEECCEE
Confidence            35888889999999999998753   44444799999975


No 21 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=96.88  E-value=0.0013  Score=39.67  Aligned_cols=36  Identities=28%  Similarity=0.422  Sum_probs=29.1

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ..|+..++..|+.|.|.|.++   |.|.|- ++|.|++..
T Consensus         6 ~~p~~~~~~~g~~v~l~C~~~---g~P~p~-v~W~k~~~~   41 (88)
T cd04968           6 VFPKDTYALKGQNVTLECFAL---GNPVPQ-IKWRKVDGS   41 (88)
T ss_pred             ECCCceEEeCCCcEEEEEEee---EeCCCE-EEEEECCCc
Confidence            457888899999999999764   667664 899998753


No 22 
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=96.88  E-value=0.00097  Score=42.92  Aligned_cols=32  Identities=28%  Similarity=0.300  Sum_probs=28.9

Q ss_pred             eEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           42 HITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ..++.+|+.+.|.|.++   +.|.| .++|.|+|.+
T Consensus        12 ~~~~~~~~~~~l~~~v~---g~P~P-~v~W~kdg~~   43 (101)
T cd05859          12 LEFANLHEVKEFVVEVE---AYPPP-QIRWLKDNRT   43 (101)
T ss_pred             eEEEecCCcEEEEEEEE---EeCCC-ceEEEECCEE
Confidence            67899999999999997   77888 7999999986


No 23 
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=96.88  E-value=0.0016  Score=40.16  Aligned_cols=35  Identities=23%  Similarity=0.460  Sum_probs=28.5

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      .+.|..+++..|+.|.|+|.+...    .+..+.|.|+.
T Consensus         2 ~q~~~~v~~~~G~~v~L~C~~~~~----~~~~v~W~k~~   36 (109)
T cd04983           2 TQSPQSLSVQEGENVTLNCNYSTS----TFYYLFWYRQY   36 (109)
T ss_pred             eecCCceEEcCCCCEEEEEEECCC----CccEEEEEEEC
Confidence            467889999999999999998854    23467899975


No 24 
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=96.88  E-value=0.0016  Score=40.26  Aligned_cols=33  Identities=15%  Similarity=0.426  Sum_probs=27.4

Q ss_pred             eEEeecCCeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           42 HITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      -+++++|+.|.|.|.+.   |.|.| .+.|.|+|.+-
T Consensus         4 ~~~v~~G~~v~l~c~~~---G~P~P-~v~W~k~~~~i   36 (86)
T cd05894           4 TIVVVAGNKLRLDVPIS---GEPAP-TVTWSRGDKAF   36 (86)
T ss_pred             EEEEEcCCEEEEEeeEe---ecCCC-eEEEEECCEEC
Confidence            36789999999999885   77777 68999998754


No 25 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=96.85  E-value=0.0014  Score=37.91  Aligned_cols=32  Identities=28%  Similarity=0.494  Sum_probs=25.2

Q ss_pred             eEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           42 HITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ++++.+|+.|.|.|.+.   +.|.|. +.|.|+|..
T Consensus         3 ~~~~~~G~~v~L~C~~~---g~p~p~-i~W~k~~~~   34 (82)
T cd05856           3 VIARPVGSSVRLKCVAS---GNPRPD-ITWLKDNKP   34 (82)
T ss_pred             ceeccCCCeEEEEEEee---EeCCCc-EEEEECCcC
Confidence            46688999999999875   455554 899999865


No 26 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=96.76  E-value=0.0021  Score=39.89  Aligned_cols=32  Identities=16%  Similarity=0.536  Sum_probs=26.9

Q ss_pred             CcceEEeecCCeEEEeeecCCCCCCCCceEEEeeec
Q psy531           39 NAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKK   74 (80)
Q Consensus        39 ~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~Kd   74 (80)
                      +|...++..|+.|.|.|.+.   |.|.|. ++|.|+
T Consensus         7 ~~~~~~~~~G~~v~l~C~~~---G~P~p~-i~W~k~   38 (98)
T cd05870           7 QLKNETTVENGAATLSCKAE---GEPIPE-ITWKRA   38 (98)
T ss_pred             eeccEEEcCCCcEEEEEecc---cCCCCe-EEEEEC
Confidence            46678899999999999875   777775 999995


No 27 
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=96.71  E-value=0.0029  Score=39.24  Aligned_cols=35  Identities=26%  Similarity=0.365  Sum_probs=29.3

Q ss_pred             cceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           40 AVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        40 P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |...++..|+.|.|.|.+.   +.|.|-.+.|.|++.+
T Consensus         8 ~~~~~~~~G~~v~L~C~~~---g~P~P~~v~W~~~~~~   42 (98)
T cd05758           8 EATQYAILGDKGRVECFIF---STPPPDRIVWTWKENE   42 (98)
T ss_pred             CCcEEEeCCCcEEEEEEEc---ccCCCCEeEEEECCEE
Confidence            4455689999999999998   8888877999998853


No 28 
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=96.65  E-value=0.0027  Score=40.32  Aligned_cols=36  Identities=22%  Similarity=0.496  Sum_probs=29.2

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      .|.|..+++..|++|.|+|.+....   ..+-+.|.|..
T Consensus         3 ~q~~~~v~~~~G~~v~L~C~~~~~~---~~~~v~Wyrq~   38 (116)
T cd07706           3 TQAQPDVSVQVGEEVTLNCRYETSW---TNYYIFWYKQL   38 (116)
T ss_pred             EEeCCceEEcCCCCEEEEEEEeCCC---CceEEEEEEEC
Confidence            4778899999999999999876532   34779999974


No 29 
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=96.62  E-value=0.0027  Score=40.68  Aligned_cols=32  Identities=28%  Similarity=0.466  Sum_probs=25.3

Q ss_pred             ceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           41 VHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        41 ~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      ..+++..|+.|.|+|.+..   .|. +.++|.|++.
T Consensus         5 ~~~tv~~G~tv~L~C~v~g---~~~-~~v~W~k~~~   36 (95)
T cd05882           5 QDETVAVGGTVTLKCGVKE---HDN-SSLQWSNTAQ   36 (95)
T ss_pred             ccEEEecCCcEEEEEEEeC---CCC-CeEEEeccCc
Confidence            4578999999999998864   443 4589999875


No 30 
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.57  E-value=0.0026  Score=38.60  Aligned_cols=31  Identities=23%  Similarity=0.404  Sum_probs=25.2

Q ss_pred             EEeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           43 ITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        43 ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      +++..|+.|.|.|.++.+   ..++.+.|.|...
T Consensus         1 ~~v~~G~~v~L~C~~~~~---~~~~~v~W~k~~~   31 (105)
T cd00099           1 LSVSEGESVTLSCTYSGS---FSSYYIFWYRQKP   31 (105)
T ss_pred             CeecCCCCEEEEEEEeCC---cCcceEEEEEECC
Confidence            468899999999999976   3356799999754


No 31 
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=96.54  E-value=0.0053  Score=36.83  Aligned_cols=38  Identities=18%  Similarity=0.298  Sum_probs=29.3

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      -+.|..++...|+.|.|.|...-.  . ++.-+.|.|++.+
T Consensus         5 ~~~p~~~~v~~G~~v~L~C~~~~~--~-~~~~i~W~~~~~~   42 (85)
T cd05754           5 VEEPRSQEVRPGADVSFICRAKSK--S-PAYTLVWTRVGGG   42 (85)
T ss_pred             ecCCCceEEcCCCCEEEEEEcCCC--C-CCcEEEEEECCCc
Confidence            357888899999999999987532  1 3455899998853


No 32 
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=96.52  E-value=0.0051  Score=35.49  Aligned_cols=32  Identities=22%  Similarity=0.408  Sum_probs=24.9

Q ss_pred             eEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           42 HITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .+.+..|+.+.|.|.+.   +.|.|+ ++|.|+|..
T Consensus         3 ~~~~~~G~~~~l~C~~~---~~p~~~-v~W~k~~~~   34 (85)
T cd05729           3 LHAVPAGSTVRLKCPAS---GNPRPT-ITWLKDGKP   34 (85)
T ss_pred             eeEecCCCcEEEEEEcC---CCCCCe-EEEEECCEE
Confidence            45688999999999885   345555 799999764


No 33 
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=96.48  E-value=0.0059  Score=33.37  Aligned_cols=31  Identities=32%  Similarity=0.500  Sum_probs=25.6

Q ss_pred             cceEEeecCCeEEEeeecCCCCCCCCceEEEeeec
Q psy531           40 AVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKK   74 (80)
Q Consensus        40 P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~Kd   74 (80)
                      |..+++.+|+.+.|.|.+...    ....+.|.++
T Consensus         1 ~~~~~~~~g~~~~l~C~~~~~----~~~~~~W~~~   31 (86)
T smart00410        1 PPSVTVKEGESVTLSCEVSGS----PPPEVTWYKQ   31 (86)
T ss_pred             CCcEEEeCCCeEEEEEEEccC----CCCeEEEEEC
Confidence            456778999999999999865    4567999987


No 34 
>smart00409 IG Immunoglobulin.
Probab=96.48  E-value=0.0059  Score=33.37  Aligned_cols=31  Identities=32%  Similarity=0.500  Sum_probs=25.6

Q ss_pred             cceEEeecCCeEEEeeecCCCCCCCCceEEEeeec
Q psy531           40 AVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKK   74 (80)
Q Consensus        40 P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~Kd   74 (80)
                      |..+++.+|+.+.|.|.+...    ....+.|.++
T Consensus         1 ~~~~~~~~g~~~~l~C~~~~~----~~~~~~W~~~   31 (86)
T smart00409        1 PPSVTVKEGESVTLSCEVSGS----PPPEVTWYKQ   31 (86)
T ss_pred             CCcEEEeCCCeEEEEEEEccC----CCCeEEEEEC
Confidence            456778999999999999865    4567999987


No 35 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=96.42  E-value=0.0036  Score=36.93  Aligned_cols=28  Identities=29%  Similarity=0.523  Sum_probs=23.4

Q ss_pred             cCCeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           47 LGESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        47 vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      .|+.|.|.|.+   .|.|.|. +.|.|+|.+.
T Consensus         1 eG~~v~l~C~~---~g~P~p~-i~W~k~g~~~   28 (74)
T cd05745           1 EGQTVDFLCEA---QGYPQPV-IAWTKGGSQL   28 (74)
T ss_pred             CCCeEEEEeEC---CEecCCE-EEEEECCEEC
Confidence            38999999997   4888887 9999998653


No 36 
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=96.41  E-value=0.0052  Score=38.48  Aligned_cols=36  Identities=17%  Similarity=0.326  Sum_probs=28.1

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      .|.|..++++.|++|.|+|.++-..+   -+-+.|.|+.
T Consensus         4 ~Q~p~~~~v~~G~~v~L~C~~~~~~~---~~~~~Wyrq~   39 (106)
T cd04980           4 TQSPATLSVSPGESATISCKASQSVS---SNYLAWYQQK   39 (106)
T ss_pred             EECCCcEEECCCCCEEEEEEECCCCC---CCcEEEEEEC
Confidence            57899999999999999999853321   2458998874


No 37 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=96.40  E-value=0.0044  Score=37.44  Aligned_cols=34  Identities=21%  Similarity=0.491  Sum_probs=27.3

Q ss_pred             CcceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           39 NAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        39 ~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      .+...++..|+.|.|.|.++   +.|.|. +.|.|++.
T Consensus         7 ~~~~~~~~~g~~v~l~C~~~---g~p~p~-v~W~~~~~   40 (96)
T cd05732           7 YLENQTAVELEQITLTCEAE---GDPIPE-ITWRRATR   40 (96)
T ss_pred             ecCceeEecCCcEEEEEEEe---EcCCCc-EEEEECCc
Confidence            35567899999999999886   566664 88999874


No 38 
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=96.37  E-value=0.0037  Score=37.00  Aligned_cols=26  Identities=27%  Similarity=0.693  Sum_probs=22.1

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+.|.|.|.+.   |.|.| -++|.|+|.+
T Consensus         1 G~~v~l~C~~~---G~P~p-~i~W~k~g~~   26 (76)
T cd05867           1 GETARLDCQVE---GIPTP-NITWSINGAP   26 (76)
T ss_pred             CCeEEEEEEee---EeCCC-eEEEEECCEE
Confidence            89999999764   77888 7999999864


No 39 
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=96.27  E-value=0.011  Score=37.94  Aligned_cols=37  Identities=14%  Similarity=0.240  Sum_probs=27.5

Q ss_pred             CcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           39 NAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        39 ~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      -|..+++..|+.|.|+|.+..+....--+.++|.|+.
T Consensus         4 ~p~~v~v~~G~~vtL~C~~s~~~~~~~~~~v~W~~~~   40 (116)
T cd05715           4 TPREVYAVNGSDVRLKCTFSSSEPISDDISVTWSFQP   40 (116)
T ss_pred             cCCeEEEEcCCCeEEEeEEeCCCCcCCceEEEEEEec
Confidence            4788899999999999998765322122569998754


No 40 
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=96.25  E-value=0.009  Score=35.33  Aligned_cols=30  Identities=23%  Similarity=0.548  Sum_probs=23.9

Q ss_pred             EeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           44 TALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        44 tA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ....|+.+.|.|.+.   |.|.| .++|.|+|.+
T Consensus         5 ~v~~G~~~~L~C~~~---g~P~p-~i~W~k~g~~   34 (85)
T cd05857           5 AVPAANTVKFRCPAA---GNPTP-TMRWLKNGKE   34 (85)
T ss_pred             EcCCCCEEEEEEEcC---CCCCC-EEEEEECCEE
Confidence            367899999999885   44555 6899999865


No 41 
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=96.19  E-value=0.0076  Score=37.68  Aligned_cols=35  Identities=20%  Similarity=0.425  Sum_probs=26.7

Q ss_pred             CcceEEe---ecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           39 NAVHITA---LLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        39 ~P~~ltA---~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +|..++.   ..|+.|.|.|.+.   |.|.| .++|.|+|.+
T Consensus         7 ~p~~~~~~~~~~g~~v~l~C~~~---G~P~P-~i~W~k~g~~   44 (94)
T cd05848           7 EPDDAIFPTDSDEKKVILNCEAR---GNPVP-TYRWLRNGTE   44 (94)
T ss_pred             CCCcEEccCCCCCCEEEEEEEee---ecCCC-EEEEEECCeE
Confidence            4555433   3589999999984   88888 7999999865


No 42 
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=96.18  E-value=0.012  Score=38.34  Aligned_cols=36  Identities=17%  Similarity=0.370  Sum_probs=26.3

Q ss_pred             CcceEEeecCCeEEEeeecCCCCCCCCceEEEeeec
Q psy531           39 NAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKK   74 (80)
Q Consensus        39 ~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~Kd   74 (80)
                      -|..++|..|++|.|+|.+......+..+.++|.++
T Consensus         4 ~~~~v~~~~G~~v~L~C~~s~~~~~~~~~~i~W~~~   39 (115)
T cd05880           4 TSKEVEAVNGTDVRLKCTFSSSAPIGDTLVITWNFR   39 (115)
T ss_pred             cCceEEEEcCCCEEEEEEEEeCCCCCCcEEEEEEEE
Confidence            467899999999999999865422222356999754


No 43 
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=96.15  E-value=0.0072  Score=38.56  Aligned_cols=37  Identities=19%  Similarity=0.154  Sum_probs=29.8

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeee-ccc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEK-KIV   76 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~K-dG~   76 (80)
                      ...|...+..+|+.|.|.|.+   .|.|.|--++|.| +|.
T Consensus         4 ~~~p~~~~v~~G~~v~l~C~v---~G~P~~p~i~W~~~~g~   41 (96)
T cd05865           4 DIVPSQGEISVGESKFFLCQV---AGEAKDKDISWFSPNGE   41 (96)
T ss_pred             EEeCCccEECCCCeEEEEEEE---eCCCCCCEEEEECCCCc
Confidence            346777789999999999988   4777666899998 664


No 44 
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=96.12  E-value=0.0083  Score=37.38  Aligned_cols=36  Identities=14%  Similarity=0.326  Sum_probs=27.0

Q ss_pred             CcceE---EeecCCeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           39 NAVHI---TALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        39 ~P~~l---tA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      +|..+   ++..|+.|.|.|.+.   +.|.| .++|.|+|.+.
T Consensus         7 ~P~~~~~~~~~~g~~v~l~C~a~---g~P~p-~i~W~~~g~~l   45 (94)
T cd05850           7 QPSSLLFPEGSPEEKVTLGCRAR---ASPPA-TYRWKMNGTEI   45 (94)
T ss_pred             CCCCEEecCCCCCCeEEEEeEce---eCCCC-EEEEEECCEEC
Confidence            44444   456678999999984   77777 68999998753


No 45 
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.05  E-value=0.0091  Score=34.77  Aligned_cols=25  Identities=40%  Similarity=0.946  Sum_probs=20.4

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      |+.|.|.|.+.   +.|.|. +.|.|++.
T Consensus         1 G~~v~l~C~~~---g~P~p~-v~W~k~~~   25 (81)
T cd05765           1 GETASFHCDVT---GRPPPE-ITWEKQVH   25 (81)
T ss_pred             CCcEEEEeecc---ccCCCc-EEEEecCC
Confidence            89999999774   777776 89999853


No 46 
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=96.03  E-value=0.013  Score=34.89  Aligned_cols=35  Identities=20%  Similarity=0.344  Sum_probs=28.6

Q ss_pred             CcceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           39 NAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        39 ~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      .|..+++..|++|.|.|.+. +  ....+.+.|.|...
T Consensus         7 ~~~~v~~~~G~~v~L~C~~~-~--~~~~~~v~W~~~~~   41 (114)
T PF07686_consen    7 PPSPVTVQEGESVTLPCSYS-S--SSNQSSVYWYRQSP   41 (114)
T ss_dssp             EESEEEEETTSEEEEEEEEE-S--SSSGSEEEEEEEET
T ss_pred             eCCeEEEecCCCEEEEEEEe-C--CCCcceEEEEEECc
Confidence            58889999999999999999 3  33456799999644


No 47 
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=96.01  E-value=0.007  Score=33.91  Aligned_cols=28  Identities=32%  Similarity=0.629  Sum_probs=23.4

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      |++|.|.|.+   .+.+.+.-+.|.|.+...
T Consensus         1 G~~v~L~C~~---~~~~~~~~~~W~~~~~~~   28 (64)
T PF00047_consen    1 GSSVTLTCSV---SSGPPPTTVTWSKNGQSL   28 (64)
T ss_dssp             TSEEEEEEEE---EESSSTSEEEEEETTTTT
T ss_pred             CCeEEEEeec---CCCCCCcEEEEEECCccc
Confidence            8999999999   566677889999998643


No 48 
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=95.98  E-value=0.0084  Score=35.75  Aligned_cols=26  Identities=35%  Similarity=0.703  Sum_probs=22.5

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+.|.|.|...   |.|.|- ++|.|+|.+
T Consensus         1 G~~v~L~C~a~---G~P~P~-v~W~k~g~~   26 (69)
T cd05739           1 GGSVNLTCVAV---GAPMPY-VKWMKGGEE   26 (69)
T ss_pred             CCeEEEEEEee---ecCCCE-EEEEECCEE
Confidence            78999999875   889995 889999865


No 49 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=95.97  E-value=0.0095  Score=34.42  Aligned_cols=26  Identities=27%  Similarity=0.639  Sum_probs=22.0

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+.|.|.|.+.   |.|.|- +.|.|+|.+
T Consensus         1 G~~~~l~C~~~---g~P~p~-i~W~~~g~~   26 (76)
T cd04978           1 GETGRLDCEAE---GIPQPT-ITWRLNGVP   26 (76)
T ss_pred             CCeEEEEEEce---eeCCCE-EEEEECCEE
Confidence            89999999874   788875 899999864


No 50 
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=95.97  E-value=0.011  Score=37.40  Aligned_cols=30  Identities=27%  Similarity=0.555  Sum_probs=24.0

Q ss_pred             cceEEeecCCeEEEeeecCCCCCCCCceEEEeee
Q psy531           40 AVHITALLGESVVFNCGVDFPGDTPVPYVLQWEK   73 (80)
Q Consensus        40 P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~K   73 (80)
                      ++.+++..|+.|.|.|.+.   +.|.|+ +.|.|
T Consensus         4 ~~~v~v~eG~~v~L~C~~~---~~p~~~-v~W~~   33 (95)
T cd07701           4 TQNVTVVEGGTANLTCRVD---QNDNTS-LQWSN   33 (95)
T ss_pred             cceEEEecCCcEEEEEEEe---cCCceE-EEEeC
Confidence            5678999999999999885   445555 68975


No 51 
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=95.88  E-value=0.013  Score=35.88  Aligned_cols=30  Identities=23%  Similarity=0.497  Sum_probs=22.6

Q ss_pred             cceEEeecCCeEEEeeecCCCCCCCCceEEEeee
Q psy531           40 AVHITALLGESVVFNCGVDFPGDTPVPYVLQWEK   73 (80)
Q Consensus        40 P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~K   73 (80)
                      +..+++..|+.|.|+|.+.-   .+-| .++|.|
T Consensus         4 ~~~~~v~~G~~v~L~C~~~~---~~~~-~v~W~~   33 (95)
T cd05717           4 TQDVTVVEGGTATLKCRVKN---NDNS-SLQWSN   33 (95)
T ss_pred             CCcEEEcCCCCEEEEEEECC---CCCc-eEEEeC
Confidence            35678999999999999853   2333 499975


No 52 
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=95.87  E-value=0.01  Score=35.85  Aligned_cols=26  Identities=27%  Similarity=0.632  Sum_probs=21.6

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+.|.|.|.+.   +.|.| .++|.|++..
T Consensus         1 G~~~~l~C~~~---g~P~p-~v~W~k~~~~   26 (73)
T cd05852           1 GGRVIIECKPK---AAPKP-KFSWSKGTEL   26 (73)
T ss_pred             CCeEEEEEecc---eeCCC-EEEEEeCCEe
Confidence            88999999875   67777 7899999864


No 53 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=95.87  E-value=0.0094  Score=37.01  Aligned_cols=34  Identities=24%  Similarity=0.272  Sum_probs=26.9

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeee-ccc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEK-KIV   76 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~K-dG~   76 (80)
                      ..|...++.+|+.|.|.|.+.   |.| | -++|.| +|.
T Consensus         5 v~p~~~~v~~G~~~~l~C~~~---G~p-~-~i~W~~~~~~   39 (92)
T cd04977           5 IVPSQGEISVGESKFFLCQVI---GEP-K-DISWFSPNGE   39 (92)
T ss_pred             EecCcEEECCCCeEEEEEEeE---eeC-C-eEEEECCCCC
Confidence            467778999999999999985   444 4 799998 443


No 54 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=95.83  E-value=0.013  Score=36.77  Aligned_cols=36  Identities=8%  Similarity=0.152  Sum_probs=29.1

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .+.|..+++..|++|.|.|..+   |. .| .+.|.|+|..
T Consensus         7 ~~~~~~~~v~~g~~v~l~C~a~---g~-~p-~i~W~kng~~   42 (91)
T cd05740           7 NNSVGNQPPEDNQPVTLTCEAE---GQ-AT-YIWWVNNGSL   42 (91)
T ss_pred             ccccCccccccCCcEEEEEEeC---CC-CC-EEEEEECCEE
Confidence            5677888999999999999987   44 44 4799999864


No 55 
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=95.80  E-value=0.013  Score=36.95  Aligned_cols=35  Identities=14%  Similarity=0.184  Sum_probs=28.2

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      .|.|..++++.|+.|-|+|.+.-    + .+-|.|.|+..
T Consensus         2 ~Q~p~~~~v~~G~~v~l~C~~~~----~-~~~v~Wykq~~   36 (110)
T cd05899           2 TQSPRYLIKGRGQSVTLRCSQTS----G-HDNMYWYRQDP   36 (110)
T ss_pred             EECCCceEEcCCCcEEEEEEECC----C-CCEEEEEEECC
Confidence            47899999999999999998754    2 24588999853


No 56 
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=95.77  E-value=0.0091  Score=38.00  Aligned_cols=32  Identities=22%  Similarity=0.453  Sum_probs=26.2

Q ss_pred             CCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeec
Q psy531           38 SNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKK   74 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~Kd   74 (80)
                      .+|..+++..|+.|.|.|.+   .|.|.  .++|.|+
T Consensus         5 ~~~~~~~v~~G~~v~l~C~~---~G~P~--~v~W~k~   36 (92)
T cd05866           5 ISLSKVELSVGESKFFTCTA---IGEPE--SIDWYNP   36 (92)
T ss_pred             EEecceEEcCCCeEEEEEEE---EEeCC--eEEEEeC
Confidence            46778889999999999997   46554  6899985


No 57 
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=95.74  E-value=0.012  Score=34.38  Aligned_cols=26  Identities=27%  Similarity=0.673  Sum_probs=21.5

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+.|.|.|.+.   +.|.| .+.|.|++..
T Consensus         1 G~~v~L~C~~~---g~P~p-~v~W~k~~~~   26 (73)
T cd04969           1 GGDVIIECKPK---AAPKP-TISWSKGTEL   26 (73)
T ss_pred             CCeEEEEEeee---EcCCC-EEEEEECCEE
Confidence            88999999974   66766 6899999864


No 58 
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=95.52  E-value=0.015  Score=37.63  Aligned_cols=28  Identities=29%  Similarity=0.567  Sum_probs=22.5

Q ss_pred             cCCeEEEeeecCCCCCCC------CceEEEeeec
Q psy531           47 LGESVVFNCGVDFPGDTP------VPYVLQWEKK   74 (80)
Q Consensus        47 vGe~VVlnCdvdfP~~~P------iPYVvqW~Kd   74 (80)
                      .|++|.|+|.+..+...+      -...++|.|+
T Consensus         1 ~G~~V~LpC~~~~~~~~~~~~~~~~~~~i~W~k~   34 (110)
T cd05878           1 LSSSVLLPCYFTLPPALPPPSNAPESPRIKWTKL   34 (110)
T ss_pred             CCCCEEEeeEeeCCccccccccCCCCCEEEEEEe
Confidence            599999999998874332      2588999997


No 59 
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=95.47  E-value=0.015  Score=38.66  Aligned_cols=28  Identities=29%  Similarity=0.602  Sum_probs=23.0

Q ss_pred             cCCeEEEeeecCCC-C--CCCCceEEEeeec
Q psy531           47 LGESVVFNCGVDFP-G--DTPVPYVLQWEKK   74 (80)
Q Consensus        47 vGe~VVlnCdvdfP-~--~~PiPYVvqW~Kd   74 (80)
                      .|++|.|+|.+.++ .  +.+-++.++|.|.
T Consensus         1 ~~~~v~LpC~~~~~p~~~~~~~~~~I~W~k~   31 (110)
T cd05902           1 LSSSVLLPCVFTLPPSASSPPEGPRIKWTKL   31 (110)
T ss_pred             CCCcEEEeeEEEcCccccCCCCCCEEEEEEe
Confidence            48999999998885 3  3456799999997


No 60 
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=95.45  E-value=0.031  Score=41.13  Aligned_cols=38  Identities=18%  Similarity=0.365  Sum_probs=27.2

Q ss_pred             CcceEEeecCCeEEEeeecCC-CCC---C---CCceEEEeeeccc
Q psy531           39 NAVHITALLGESVVFNCGVDF-PGD---T---PVPYVLQWEKKIV   76 (80)
Q Consensus        39 ~P~~ltA~vGe~VVlnCdvdf-P~~---~---PiPYVvqW~KdG~   76 (80)
                      +..-+.+..||.|+|.|.++. |..   .   .--|-|+|.|.+.
T Consensus        28 ~~~~~~v~eGe~v~L~C~~~~~~~~~~~~~~~~~~~~V~W~k~~s   72 (227)
T PHA02826         28 DLTPVYAKFGDPMVLLCTGKHYKKSIFFDKTFITSYNVTWSKTDS   72 (227)
T ss_pred             CcceEEecCCCCEEEEccccccccccccccccCCCccEEEEeCCe
Confidence            345577899999999999874 411   1   2347799999864


No 61 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=95.44  E-value=0.018  Score=35.38  Aligned_cols=24  Identities=38%  Similarity=0.785  Sum_probs=20.4

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      |+.|.|.|.+.   +.|.|- ++|.|++
T Consensus         1 G~~v~l~C~v~---g~P~P~-i~W~k~~   24 (90)
T cd04974           1 GSDVEFHCKVY---SDAQPH-IQWLKHV   24 (90)
T ss_pred             CCcEEEEEEEe---CCCCCe-EEEEEec
Confidence            78999999986   677777 9999974


No 62 
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=95.36  E-value=0.031  Score=34.28  Aligned_cols=31  Identities=29%  Similarity=0.341  Sum_probs=23.7

Q ss_pred             EEeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           43 ITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        43 ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      ++|..|++|.|+|.++...+.   +.+.|.|...
T Consensus         2 v~~~~G~~vtl~C~~~~~~~~---~~~~W~r~~~   32 (98)
T cd05716           2 VTGELGGSVTIPCPYPPKNRS---YEKYWCKWGS   32 (98)
T ss_pred             EEEEeCCeEEEEeeCCCCCCC---cEeEeECCCC
Confidence            579999999999998754222   4568998753


No 63 
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=95.12  E-value=0.025  Score=31.82  Aligned_cols=31  Identities=29%  Similarity=0.463  Sum_probs=24.5

Q ss_pred             EEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           43 ITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        43 ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .+...|+.+.|.|.++   +.|. .-++|.|++..
T Consensus         9 ~~v~~g~~~~l~C~~~---~~p~-~~~~w~~~~~~   39 (80)
T PF13895_consen    9 QSVEEGDSVTLTCSVS---GNPP-PQVQWYKNGSP   39 (80)
T ss_dssp             SEEETTSEEEEEEEEE---SSSS-SEEEEEETTEE
T ss_pred             eEEeCCCcEEEEEEEE---cccc-eeeeeeeeeee
Confidence            4478899999999988   4444 56999998754


No 64 
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=94.99  E-value=0.038  Score=33.72  Aligned_cols=24  Identities=38%  Similarity=0.754  Sum_probs=20.3

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      |+.|.|.|.+.   +.|.| .++|.|++
T Consensus         1 G~~v~L~C~~~---g~P~P-~i~W~k~~   24 (90)
T cd05858           1 GSTVEFVCKVY---SDAQP-HIQWLKHV   24 (90)
T ss_pred             CCeEEEEEEEe---cCCCC-EEEEEEec
Confidence            89999999984   77888 59999964


No 65 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=94.95  E-value=0.033  Score=33.92  Aligned_cols=29  Identities=21%  Similarity=0.394  Sum_probs=22.9

Q ss_pred             eecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           45 ALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        45 A~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +..|+.|.|.|.+   .+.|.| .+.|.|+|.+
T Consensus        16 ~~~~~~~~l~C~~---~g~p~p-~i~W~k~~~~   44 (91)
T cd04967          16 ESDEGKVSLNCRA---RGSPPP-TYRWLMNGTE   44 (91)
T ss_pred             CCCCCEEEEEEee---eEcCCC-EEEEEECCEE
Confidence            4566889999998   355666 7999999865


No 66 
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=94.93  E-value=0.044  Score=35.42  Aligned_cols=29  Identities=10%  Similarity=0.358  Sum_probs=22.0

Q ss_pred             EEeecCCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           43 ITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        43 ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      +.|++|+.|.|.|...   +.+.|+ ++|.|++
T Consensus         2 v~~~~G~~VtL~C~~s---~~~~~~-i~W~~~~   30 (94)
T cd07690           2 VLGKKGDTAELPCTAS---QKKSIQ-FHWKNSN   30 (94)
T ss_pred             eEeeCCCCEEEEEEeC---CCCCcE-EEEEECC
Confidence            5799999999999754   455554 6798665


No 67 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=94.85  E-value=0.03  Score=33.34  Aligned_cols=26  Identities=31%  Similarity=0.765  Sum_probs=20.8

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+.|.|.|.+.   +.|.| .++|.|++..
T Consensus         1 G~~v~l~C~~~---g~P~p-~v~W~~~~~~   26 (78)
T cd05743           1 GETVEFTCVAT---GVPTP-IINWRLNWGH   26 (78)
T ss_pred             CCEEEEEEEEE---EecCC-EEEEEECCeE
Confidence            89999999874   77766 5889998653


No 68 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=94.75  E-value=0.044  Score=33.86  Aligned_cols=29  Identities=21%  Similarity=0.617  Sum_probs=23.4

Q ss_pred             eecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           45 ALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        45 A~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ++.|+.+.|.|.+.   |.|.| .++|.|++.+
T Consensus        14 ~~~g~~v~l~C~~~---G~P~P-~v~W~~~~~~   42 (97)
T cd05869          14 MELEEQITLTCEAS---GDPIP-SITWRTSTRN   42 (97)
T ss_pred             EEcCCCEEEEEEee---EeCCC-EEEEEECCcc
Confidence            56789999999976   66777 4899998754


No 69 
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=94.74  E-value=0.047  Score=33.17  Aligned_cols=26  Identities=31%  Similarity=0.742  Sum_probs=20.6

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+.|.|.|.+   .+.|.|. +.|.|+|..
T Consensus         1 G~~v~L~C~~---~g~P~p~-v~W~k~g~~   26 (90)
T cd05726           1 GRTVTFQCEA---TGNPQPA-IFWQKEGSQ   26 (90)
T ss_pred             CCEEEEEEEC---CccCCCE-EEEEeCCCc
Confidence            8999999976   4667775 679999853


No 70 
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=94.62  E-value=0.071  Score=33.74  Aligned_cols=35  Identities=31%  Similarity=0.434  Sum_probs=24.3

Q ss_pred             eEEeecCCeEEEeeecCCC-CC-CCCceEEEeeecccc
Q psy531           42 HITALLGESVVFNCGVDFP-GD-TPVPYVLQWEKKIVK   77 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvdfP-~~-~PiPYVvqW~KdG~~   77 (80)
                      ...+..||.|.|.|.+.=. .. .| .+-|.|.|+|.+
T Consensus         8 ~~~v~~G~~~~L~C~~~g~~~~~~p-~~~v~Wyk~~~~   44 (94)
T cd05756           8 KSYVLEGEPVVIKCPLFYSYIAQSP-GLNLTWYKSDGK   44 (94)
T ss_pred             EEEEecCCCeEEECCCCCcccccCC-CceEEEEEcCCC
Confidence            4457789999999985521 01 34 445999999864


No 71 
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=94.59  E-value=0.046  Score=34.86  Aligned_cols=28  Identities=21%  Similarity=0.248  Sum_probs=21.4

Q ss_pred             CeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           49 ESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        49 e~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      |+|+|.|.+.+..+- .++ +.|.|+|++-
T Consensus         1 ~~~~l~C~v~~d~~l-~~~-~~W~~dg~~i   28 (85)
T cd05853           1 ESIVLPCQVSHDHSL-DIV-FTWSFNGHLI   28 (85)
T ss_pred             CcEEEEEEeccCCCC-CcE-EEEEECCEEC
Confidence            689999999985333 345 6999999754


No 72 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=94.55  E-value=0.053  Score=33.44  Aligned_cols=26  Identities=23%  Similarity=0.580  Sum_probs=21.3

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ||.|.|.|.+.   |.| |-.+.|.|++..
T Consensus         1 g~~~~l~C~~~---g~p-~~~i~W~k~~~~   26 (88)
T cd05735           1 GQKKEMSCTAH---GEK-PIIVRWEKEDRI   26 (88)
T ss_pred             CCeEEEEEEEE---CCC-CCEEEEeeCCEE
Confidence            89999999987   554 558999999854


No 73 
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=94.42  E-value=0.04  Score=32.94  Aligned_cols=26  Identities=27%  Similarity=0.592  Sum_probs=22.0

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+.|.|.|.+.   |.|.| -+.|.|+|.+
T Consensus         1 g~~~~l~C~a~---G~P~P-~i~W~k~g~~   26 (76)
T cd05868           1 GEDGTLICRAN---GNPKP-SISWLTNGVP   26 (76)
T ss_pred             CCCEEEEEEee---EeCCC-eEEEEECCEE
Confidence            88999999984   77776 5999999875


No 74 
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=94.36  E-value=0.051  Score=33.82  Aligned_cols=29  Identities=24%  Similarity=0.485  Sum_probs=22.3

Q ss_pred             cCCeEEEeeecCCCCC--CCCceEEEeeecc
Q psy531           47 LGESVVFNCGVDFPGD--TPVPYVLQWEKKI   75 (80)
Q Consensus        47 vGe~VVlnCdvdfP~~--~PiPYVvqW~KdG   75 (80)
                      .|+.|.|.|.+..+..  ..-.+-|+|.|..
T Consensus         1 ~G~~V~L~C~~~~~~~~~~~~~~~i~W~k~~   31 (106)
T cd05714           1 LGGNVTLPCRFHLEPALSAPHGPRIKWTKLE   31 (106)
T ss_pred             CCCCEEEeEEeECCcccCCCCCcEEEEEEeC
Confidence            4999999999886532  2346789999984


No 75 
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=94.35  E-value=0.057  Score=33.05  Aligned_cols=26  Identities=27%  Similarity=0.480  Sum_probs=19.7

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ||++.|+|.+.   +.|. +-++|.+.|.+
T Consensus         1 Ge~~~l~C~~~---~~~~-~~~~W~~~~~~   26 (84)
T cd05861           1 GETITVNCIVQ---GNEV-VDFSWTYPGKD   26 (84)
T ss_pred             CCcEEEEEEEE---CCCc-cEEEEEECCcc
Confidence            89999999984   4455 44899987653


No 76 
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=94.29  E-value=0.032  Score=33.35  Aligned_cols=23  Identities=30%  Similarity=0.691  Sum_probs=18.6

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |.|.|.++   |.|.| .++|.|+|.+
T Consensus         1 v~L~C~~~---g~P~p-~v~W~k~g~~   23 (77)
T cd05760           1 VTLRCHID---GHPRP-TYQWFRDGTP   23 (77)
T ss_pred             CEEEEEee---ecCCC-cEEEEECCEE
Confidence            57999775   77877 6999999875


No 77 
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=94.19  E-value=0.077  Score=33.33  Aligned_cols=29  Identities=24%  Similarity=0.574  Sum_probs=23.6

Q ss_pred             eecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           45 ALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        45 A~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +..|+.|.|.|.+.   |.|.| .+.|.|+|.+
T Consensus        16 ~~~~~~v~l~C~a~---G~P~P-~i~W~k~~~~   44 (93)
T cd05849          16 ESTEGKVSVNCRAR---ANPFP-IYKWRKNNLD   44 (93)
T ss_pred             CccCCeEEEeCcCc---cCCCC-EEEEEECCEE
Confidence            44577999999984   77888 6999999865


No 78 
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=94.18  E-value=0.082  Score=34.01  Aligned_cols=32  Identities=19%  Similarity=0.172  Sum_probs=27.7

Q ss_pred             ceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           41 VHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        41 ~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ..++...|++|+|.|....+.-+     +.|.++|.+
T Consensus         4 ~~~tv~~g~~v~L~C~~~s~~A~-----v~W~~ng~~   35 (85)
T cd05872           4 KNRTVAPGADVVLPCQLRSNLAS-----PVWLFNGTP   35 (85)
T ss_pred             eEEEEecCCCEEEECCCCCCCcc-----EEEEECCcc
Confidence            56889999999999999988655     999999875


No 79 
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=94.16  E-value=0.035  Score=32.31  Aligned_cols=23  Identities=30%  Similarity=0.702  Sum_probs=18.7

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |.|.|.+.   |.|.|. ++|.|+|.+
T Consensus         1 v~L~C~~~---g~P~p~-i~W~k~g~~   23 (69)
T cd05746           1 VQIPCSAQ---GDPEPT-ITWNKDGVQ   23 (69)
T ss_pred             CEeEecce---EeCCCE-EEEEECCEE
Confidence            56889875   788886 899999865


No 80 
>PHA02785 IL-beta-binding protein; Provisional
Probab=94.10  E-value=0.076  Score=40.25  Aligned_cols=38  Identities=16%  Similarity=0.261  Sum_probs=28.6

Q ss_pred             CCcceEEeecCCeEEEeeecC-CCCCCCCceEEEeeecccc
Q psy531           38 SNAVHITALLGESVVFNCGVD-FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvd-fP~~~PiPYVvqW~KdG~~   77 (80)
                      +.|+.+++..|+.|.|.|.+. +|... -| .+.|.|+|.+
T Consensus       225 ~~p~~~~~~~G~~v~L~C~a~g~P~~~-~~-~v~W~kng~~  263 (326)
T PHA02785        225 QLPEGVVTSIGSNLTIACRVSLRPPTT-DA-DVFWISNGMY  263 (326)
T ss_pred             cCCCcEEecCCCcEEEEEEEECCCCCC-Cc-eEEEEECCEE
Confidence            356677888999999999998 45321 13 5899999863


No 81 
>PHA03376 BARF1; Provisional
Probab=94.08  E-value=0.11  Score=40.09  Aligned_cols=33  Identities=24%  Similarity=0.211  Sum_probs=26.4

Q ss_pred             eEEeecCCeEEEeeecC-CCCCCCCceEEEeeeccc
Q psy531           42 HITALLGESVVFNCGVD-FPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvd-fP~~~PiPYVvqW~KdG~   76 (80)
                      -++|++||.|+|.|+.. ...+  .=-.|.|.|++.
T Consensus        20 pVta~VGEda~LsC~lnp~ssa--~~MrIrWqKs~p   53 (221)
T PHA03376         20 AVTAFLGERVTLTSYWRRVSLG--PEIEVSWFKLGP   53 (221)
T ss_pred             chhheeCCcEEEEecccCccCC--CceEEEEEecCC
Confidence            57899999999999998 4443  336799999764


No 82 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=94.05  E-value=0.077  Score=34.10  Aligned_cols=28  Identities=18%  Similarity=0.291  Sum_probs=23.6

Q ss_pred             ecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           46 LLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        46 ~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ..|+.|.|.|.+.   |.|.| .+.|.|+|.+
T Consensus        21 ~~g~~v~L~C~a~---G~P~p-~i~W~k~g~~   48 (109)
T cd05773          21 DGSSDANLVCQAQ---GVPRV-QFRWAKNGVP   48 (109)
T ss_pred             CCCCEEEEEEECc---ccCCC-EEEEEECCEE
Confidence            4678999999996   78877 7999999864


No 83 
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=94.02  E-value=0.094  Score=27.35  Aligned_cols=27  Identities=30%  Similarity=0.534  Sum_probs=19.2

Q ss_pred             cCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           47 LGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        47 vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .|+.|.|.|.+.   +.|. .-+.|.|+|..
T Consensus         1 ~g~~~~l~C~~~---~~~~-~~v~W~~~~~~   27 (63)
T smart00408        1 EGQSVTLTCPAE---GDPV-PNITWLKDGKP   27 (63)
T ss_pred             CCceEEEEeeCc---cCCC-CeEEEEECCEE
Confidence            489999999943   3333 35899998754


No 84 
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=93.86  E-value=0.1  Score=32.87  Aligned_cols=29  Identities=14%  Similarity=0.318  Sum_probs=21.8

Q ss_pred             eEEeecCCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           42 HITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      .+++..|++|.|.|...    .|.|+ ++|.|++
T Consensus         5 ~~~~~eG~~v~L~C~~~----~p~p~-v~Wykq~   33 (91)
T cd05871           5 VVYGVENNSTFLECLPK----SPQAS-VKWLFQR   33 (91)
T ss_pred             EEEEecCCcEEEEEECC----CCCce-EEEEEEC
Confidence            34588999999999943    44555 7999853


No 85 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=93.86  E-value=0.067  Score=32.07  Aligned_cols=26  Identities=23%  Similarity=0.480  Sum_probs=19.6

Q ss_pred             CeEEEeeecCCCCCCCCce-EEEeeecccc
Q psy531           49 ESVVFNCGVDFPGDTPVPY-VLQWEKKIVK   77 (80)
Q Consensus        49 e~VVlnCdvdfP~~~PiPY-VvqW~KdG~~   77 (80)
                      |+|.|.|.+.   +.|.|- -+.|.|+|.+
T Consensus         1 e~~~L~C~~~---g~P~p~i~~~W~~~g~~   27 (85)
T cd04970           1 ESITLQCHAS---HDPTLDLTFTWSFNGVP   27 (85)
T ss_pred             CcEEEEEEEe---cCCCCCeEEEEEECCeE
Confidence            6799999996   445553 3799999875


No 86 
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=93.65  E-value=0.16  Score=33.43  Aligned_cols=38  Identities=18%  Similarity=0.282  Sum_probs=29.2

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .++++.+++..|+.++|.|+.  |.+.|-|- +.|.+++..
T Consensus         7 ~~~~~~v~V~eG~~~~L~C~p--P~g~P~P~-i~W~~~~~~   44 (95)
T cd05845           7 KEKIRPVEVEEGDSVVLPCNP--PKSAVPLR-IYWMNSDLL   44 (95)
T ss_pred             ccccceeEEecCCCEEEEecC--CCCCCCCE-EEEECCCCc
Confidence            355677889999999999975  66776665 699987643


No 87 
>PHA02982 hypothetical protein; Provisional
Probab=93.55  E-value=0.09  Score=41.25  Aligned_cols=59  Identities=15%  Similarity=0.380  Sum_probs=42.2

Q ss_pred             chhHHHHHHHHHHHHhhccCCCCCCCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeec
Q psy531           13 NLHHISLQVLLIITLVHFKGVSPDISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKK   74 (80)
Q Consensus        13 ~~~~~~~~~ll~i~l~~~sg~~g~~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~Kd   74 (80)
                      |+--|+++.++.+-|.+.-+---+.+|--.+.|.||++|.|+|.  ||....|-. .-|.++
T Consensus         4 n~~~~~i~i~~~~~~~~~y~e~~~~~d~~dv~a~vd~~V~L~C~--~~~~~~i~~-~~W~~~   62 (251)
T PHA02982          4 NLFTIAIAIIIFFGLINIYDEEDLKEDTADVNATVDQEVKLQCL--FKDADEISR-AMWKGD   62 (251)
T ss_pred             hhhhHHHHHHHHhhhhhccCchhcccchhhhhccCCCcEEEEec--CCCcchhhh-heeeCC
Confidence            56667777766565655555544566667788999999999999  997666644 458775


No 88 
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=93.50  E-value=0.17  Score=34.47  Aligned_cols=37  Identities=22%  Similarity=0.329  Sum_probs=26.8

Q ss_pred             ceEEeecCCeEEEeeecC-------CCCCCCCceEEEeeecccc
Q psy531           41 VHITALLGESVVFNCGVD-------FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        41 ~~ltA~vGe~VVlnCdvd-------fP~~~PiPYVvqW~KdG~~   77 (80)
                      +.+.+..||.|+|+|.+-       |+..+-...-|-|.|+|.+
T Consensus         8 ~~~~~~~GE~v~l~C~~~~~~~~~~~~~~~~~~~~v~WyK~~~~   51 (104)
T cd05896           8 KKYMVLAGEPVRIKCALFYGYIRTNYSMAQSAGLSLMWYKSSGD   51 (104)
T ss_pred             eeEEEcCCCeEEEECCCccccccccccccccCCceEEEEECCCC
Confidence            456789999999999972       3333334457999999744


No 89 
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=93.50  E-value=0.12  Score=33.77  Aligned_cols=31  Identities=26%  Similarity=0.363  Sum_probs=25.2

Q ss_pred             ceEEeecCCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           41 VHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        41 ~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      +.+++..|++|.|+|.++...+    |.++|-|-|
T Consensus         5 ~nvtv~~G~ta~L~C~v~~~~~----~~v~w~~~~   35 (95)
T cd05881           5 EDVTVVEGEVAIISCRVKNNDD----SVIQLLNPN   35 (95)
T ss_pred             CceEEcCCCcEEEEEEEccCCc----cEEEEEecC
Confidence            4588999999999999998742    557887665


No 90 
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=93.39  E-value=0.12  Score=31.60  Aligned_cols=27  Identities=15%  Similarity=0.319  Sum_probs=19.7

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      |+.|.|.|.+.-+. ..-.+-+.|.|..
T Consensus         1 G~~v~L~C~~~~~~-~~~~~~v~W~k~~   27 (100)
T cd05713           1 GEDAELPCHLSPKM-SAEHMEVRWFRSQ   27 (100)
T ss_pred             CCcEEEEeEEcCCC-CCCeeEEEEEECC
Confidence            89999999996432 3344568898864


No 91 
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=93.27  E-value=0.12  Score=32.78  Aligned_cols=34  Identities=21%  Similarity=0.318  Sum_probs=24.3

Q ss_pred             EeecCCeEEEeeec--CCCCCCCCceEEEeeeccccc
Q psy531           44 TALLGESVVFNCGV--DFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        44 tA~vGe~VVlnCdv--dfP~~~PiPYVvqW~KdG~~~   78 (80)
                      .+-.|+.+.|.|..  .|+...|.|. +.|.|+|.+-
T Consensus         6 ~~~~g~~~~l~Cp~~~~~~~~~~~p~-i~Wyk~~~~i   41 (92)
T cd05757           6 ILFSTKGGKIVCPDLDDFKNENTLPP-VQWYKDCKLL   41 (92)
T ss_pred             EEeeccCCEEECCChHHccCCCCCCc-EEEeECCEEC
Confidence            37889999999976  3333334444 7999999764


No 92 
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=93.23  E-value=0.15  Score=37.44  Aligned_cols=36  Identities=14%  Similarity=0.121  Sum_probs=26.8

Q ss_pred             ceEEeecCCeEEEeeecC--CCCCCCCceEEEeeecccc
Q psy531           41 VHITALLGESVVFNCGVD--FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        41 ~~ltA~vGe~VVlnCdvd--fP~~~PiPYVvqW~KdG~~   77 (80)
                      .......|+.|.|.|...  +|.+.|.| -++|.|+|.+
T Consensus       137 ~~~~~~~G~~v~L~C~~~~~~~~~~p~p-~I~WyKng~~  174 (227)
T PHA02826        137 INYQFNSGKDSKLHCYGTDGISSTFKDY-TLTWYKNGNI  174 (227)
T ss_pred             ccceEecCCCEEEEeeCCCCccccCCCc-eEEEEECCEE
Confidence            345567899999999873  55455555 5899999975


No 93 
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=93.18  E-value=0.1  Score=31.47  Aligned_cols=27  Identities=30%  Similarity=0.481  Sum_probs=20.7

Q ss_pred             CeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           49 ESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        49 e~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      |.|.|.|.+..+.+ ...+-|.|.|+..
T Consensus         1 ~~v~L~C~~~~~~~-~~~~~v~W~k~~~   27 (98)
T cd05718           1 ESVTLECSFPVPGP-VQITQVTWMKITG   27 (98)
T ss_pred             CCEEEEeEeeCCCC-ceEEEEEEeeECC
Confidence            67999999877643 3456899999864


No 94 
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=93.12  E-value=0.16  Score=31.14  Aligned_cols=31  Identities=16%  Similarity=0.194  Sum_probs=23.0

Q ss_pred             EeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           44 TALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        44 tA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +...||.|.|+|...-   ...+.-+.|.|+|..
T Consensus        10 ~V~~G~~vtL~C~~~~---~~~~~~~~w~k~g~~   40 (83)
T cd05753          10 VVFEGEPLVLRCHGWK---NKPVYKVTYYRDGKA   40 (83)
T ss_pred             eecCCCCEEEEeeCCC---CCcceEEEEEECCeE
Confidence            4778999999999632   223356899999864


No 95 
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=92.68  E-value=0.11  Score=30.96  Aligned_cols=23  Identities=22%  Similarity=0.690  Sum_probs=18.7

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |.|.|.+.   |.|.|- +.|.|+|.+
T Consensus         1 i~l~C~~~---G~P~P~-v~W~k~g~~   23 (77)
T cd05733           1 IVIKCEAK---GNPPPT-FSWTRNGTH   23 (77)
T ss_pred             CEEEeeCc---ccCCCe-EEEEECCeE
Confidence            46889875   888886 999999865


No 96 
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=92.47  E-value=0.15  Score=29.35  Aligned_cols=23  Identities=39%  Similarity=0.775  Sum_probs=17.7

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |.|.|.++   |.|.|. +.|.|++..
T Consensus         1 v~l~C~~~---g~P~p~-v~W~k~~~~   23 (69)
T cd05725           1 VEFQCEVG---GDPVPT-VLWRKEDGE   23 (69)
T ss_pred             CEEEEECc---cCCCCE-EEEEECCcc
Confidence            57899774   778775 899998653


No 97 
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=92.39  E-value=0.12  Score=30.28  Aligned_cols=24  Identities=33%  Similarity=0.740  Sum_probs=19.1

Q ss_pred             eEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           50 SVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        50 ~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .|.|.|.++   |.|.|- +.|.|+|..
T Consensus         1 ~v~l~C~~~---G~P~p~-v~W~k~g~~   24 (71)
T cd05723           1 DVIFECEVT---GKPTPT-VKWVKNGDM   24 (71)
T ss_pred             CEEEEEEEE---EeCCCE-EEEEECCeE
Confidence            378999985   778774 799999864


No 98 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=92.38  E-value=0.13  Score=31.04  Aligned_cols=23  Identities=26%  Similarity=0.717  Sum_probs=18.9

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ++|.|.++   |.|.|. ++|.|+|.+
T Consensus         1 ~~l~C~~~---G~P~P~-v~W~k~g~~   23 (77)
T cd05875           1 IIIECEAK---GNPVPT-FQWTRNGKF   23 (77)
T ss_pred             CEEEEecc---ccCCCE-EEEEECCEE
Confidence            47899886   888887 899999864


No 99 
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=92.17  E-value=0.22  Score=30.83  Aligned_cols=29  Identities=21%  Similarity=0.440  Sum_probs=21.5

Q ss_pred             cCCeEEEeeecCCC-CCC-CCceEEEeeecc
Q psy531           47 LGESVVFNCGVDFP-GDT-PVPYVLQWEKKI   75 (80)
Q Consensus        47 vGe~VVlnCdvdfP-~~~-PiPYVvqW~KdG   75 (80)
                      .|+.|.|.|.+..+ ... +..+-|.|.|+.
T Consensus         1 ~G~~vtL~C~~~~~~~~~~~~~~~v~W~k~~   31 (106)
T cd05877           1 RGGNVTLPCRYHYEPELSAPRKIRVKWTKLE   31 (106)
T ss_pred             CCCcEEEEeEeECCCcCCCCccceEEEEEec
Confidence            49999999998754 222 345779999985


No 100
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=92.12  E-value=0.1  Score=30.87  Aligned_cols=24  Identities=29%  Similarity=0.331  Sum_probs=18.6

Q ss_pred             EEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      |.|.|.+.   |.|.|- +.|.|+|.+-
T Consensus         1 ~~l~c~v~---g~P~p~-v~W~k~g~~l   24 (71)
T cd04976           1 VRLPVKVK---AYPPPE-IQWYKNGKLI   24 (71)
T ss_pred             CEEEeEEE---EeCCCE-EEEEECCEEC
Confidence            56889875   777775 7999998753


No 101
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=92.05  E-value=0.26  Score=28.43  Aligned_cols=25  Identities=20%  Similarity=0.589  Sum_probs=19.3

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeee-ccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEK-KIV   76 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~K-dG~   76 (80)
                      |+.|.|.|.+.   +.|.| -+.|.| ++.
T Consensus         1 G~~~~l~C~~~---g~P~p-~v~W~~~~~~   26 (74)
T cd05764           1 GQRATLRCKAR---GDPEP-AIHWISPDGK   26 (74)
T ss_pred             CCeEEEEEEcc---CcCCC-EEEEEeCCCE
Confidence            89999999985   66665 689997 443


No 102
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=91.42  E-value=0.14  Score=31.12  Aligned_cols=24  Identities=29%  Similarity=0.320  Sum_probs=18.1

Q ss_pred             EEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      |-|.|.+.   |.|.| .++|.|+|++-
T Consensus         1 ~~l~c~v~---g~P~P-~v~W~kdg~~l   24 (67)
T cd05863           1 VKLPVKVA---AYPPP-EFQWYKDGKLI   24 (67)
T ss_pred             CEEEEEEE---EeCCC-EEEEEECCEEC
Confidence            35778876   77777 49999999753


No 103
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=91.41  E-value=0.21  Score=30.70  Aligned_cols=31  Identities=16%  Similarity=0.326  Sum_probs=21.6

Q ss_pred             EEeecCCeEEEeeecCCCC-CCCCceEEEeeeccc
Q psy531           43 ITALLGESVVFNCGVDFPG-DTPVPYVLQWEKKIV   76 (80)
Q Consensus        43 ltA~vGe~VVlnCdvdfP~-~~PiPYVvqW~KdG~   76 (80)
                      ++++.|+.|.|+|.+.-.. +.   +-++|.|+..
T Consensus         1 ~~v~~G~~v~l~C~~~~~~~~~---~~i~Wy~q~~   32 (98)
T cd04984           1 LSVSPGETVTITCTGSSGNISG---NYVNWYQQKP   32 (98)
T ss_pred             CccCCCCCEEEEEEEcCCCcCC---CCEEEEEECC
Confidence            4678999999999875331 22   3388988743


No 104
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=91.16  E-value=0.17  Score=30.87  Aligned_cols=23  Identities=22%  Similarity=0.611  Sum_probs=18.3

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |.|.|.+.   |.|.|. +.|.|+|..
T Consensus         1 v~l~C~v~---G~P~P~-i~W~k~~~~   23 (75)
T cd05892           1 VKLECQIS---AIPPPK-IFWKRNNEM   23 (75)
T ss_pred             CEEEEEEE---ecCCCe-EEEEECCEE
Confidence            57889874   778885 899999865


No 105
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=91.10  E-value=0.32  Score=29.02  Aligned_cols=28  Identities=32%  Similarity=0.396  Sum_probs=20.2

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ||.+.|.|.+.-..+  ++.-++|.+.|..
T Consensus         1 Ge~~~L~C~~~g~~~--~~~~i~W~~~~~~   28 (84)
T cd05742           1 GETLVLNCTVLTELN--EGVDFQWTYPGKK   28 (84)
T ss_pred             CCeEEEEEEEEeCCC--ccEEEEEecCCcc
Confidence            899999999964311  4556999876643


No 106
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=90.95  E-value=0.17  Score=29.84  Aligned_cols=23  Identities=22%  Similarity=0.599  Sum_probs=17.3

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |.|.|.++   |.|.| .++|.|++.+
T Consensus         1 a~l~C~~~---G~P~p-~v~W~k~~~~   23 (74)
T cd05738           1 ATMLCAAS---GNPDP-EITWFKDFLP   23 (74)
T ss_pred             CEEEEEEe---EecCC-EEEEEECCEE
Confidence            47899764   77766 6899999764


No 107
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=90.95  E-value=0.31  Score=33.43  Aligned_cols=28  Identities=29%  Similarity=0.399  Sum_probs=22.5

Q ss_pred             cCCeEEEeeecCCCC-------CCCCceEEEeeec
Q psy531           47 LGESVVFNCGVDFPG-------DTPVPYVLQWEKK   74 (80)
Q Consensus        47 vGe~VVlnCdvdfP~-------~~PiPYVvqW~Kd   74 (80)
                      .|++|.|.|.+.+..       ..+-+..|+|.|-
T Consensus         1 ~~g~v~LPC~f~~~p~~p~~~~~~~~~~rIkW~~~   35 (117)
T cd05901           1 LSGSVVLPCRFSTLPTLPPSVITTSEFLRIKWTKI   35 (117)
T ss_pred             CCCCEEEeeEEEecCCCCCcccCCCCCcEEEEEEe
Confidence            489999999999642       3556789999996


No 108
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=90.93  E-value=0.17  Score=30.65  Aligned_cols=23  Identities=30%  Similarity=0.666  Sum_probs=18.2

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |.|.|.+.   |.|.| .+.|.|+|.+
T Consensus         1 v~l~C~v~---G~P~P-~v~W~k~~~~   23 (75)
T cd05893           1 VRLECRVS---GVPHP-QIFWKKENES   23 (75)
T ss_pred             CEEEEEEe---EecCC-EEEEEECCEE
Confidence            56888875   88888 6889999765


No 109
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=90.84  E-value=0.23  Score=28.99  Aligned_cols=25  Identities=16%  Similarity=0.293  Sum_probs=17.5

Q ss_pred             EEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      ++|.|...  .+ +++..++|.|+|.+.
T Consensus         1 ~~L~C~a~--~~-~p~~~~~W~~~g~~i   25 (76)
T cd05895           1 LVLRCETV--SE-YPSLRFKWFKNGKEI   25 (76)
T ss_pred             CEEEEecc--cC-CCCCceEEEECCccc
Confidence            47999974  22 344579999998754


No 110
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=90.65  E-value=0.25  Score=28.65  Aligned_cols=23  Identities=22%  Similarity=0.501  Sum_probs=18.6

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |.|.|.+.   |.|.| -+.|.|+|..
T Consensus         2 ~~l~c~~~---G~P~p-~v~W~k~g~~   24 (74)
T cd05748           2 VRLEVPIS---GRPTP-TVTWSKDGKP   24 (74)
T ss_pred             EEEEeeEe---eeCCC-eEEEEECCEE
Confidence            67888775   88888 4999999865


No 111
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=90.65  E-value=0.33  Score=30.66  Aligned_cols=31  Identities=13%  Similarity=0.134  Sum_probs=22.5

Q ss_pred             EEeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           43 ITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        43 ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      ++++.|+.|.|.|.+.=.   ...+-+.|.|+..
T Consensus         1 ~~v~~G~~vtL~C~~~~~---~~~~~~~Wyrq~~   31 (107)
T cd07700           1 ILVQTNNTVKLSCEAKGI---SENTRIYWLRWRQ   31 (107)
T ss_pred             CEEcCCCCEEEEEEEecC---CCCCeEEEEEECC
Confidence            468999999999997521   1234689998844


No 112
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=90.63  E-value=0.72  Score=30.71  Aligned_cols=34  Identities=12%  Similarity=0.237  Sum_probs=25.4

Q ss_pred             cceEEeecCCeEEEeeecCCCC-CCCCceEEEeeec
Q psy531           40 AVHITALLGESVVFNCGVDFPG-DTPVPYVLQWEKK   74 (80)
Q Consensus        40 P~~ltA~vGe~VVlnCdvdfP~-~~PiPYVvqW~Kd   74 (80)
                      |..++|.+|+.|.|.|.+.... ..+.+ -|+|...
T Consensus         5 ~~ev~a~~G~~v~L~C~f~~~~~~~~~~-~v~W~~~   39 (116)
T cd05879           5 DREVYGTVGSDVTLSCSFWSSEWISDDI-SFTWHYQ   39 (116)
T ss_pred             cceEEEEcCCcEEEEEEEecCCCCCCcE-EEEEEEc
Confidence            4567899999999999996643 34554 5899553


No 113
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=90.59  E-value=0.58  Score=30.80  Aligned_cols=35  Identities=23%  Similarity=0.289  Sum_probs=26.5

Q ss_pred             ceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           41 VHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        41 ~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      +-..+..|+.++|.|.  -|.+.|.| .+.|.|++.+.
T Consensus        11 ~~~~v~eG~~~~L~C~--pP~g~P~p-~~~W~k~~~~~   45 (96)
T cd05727          11 DEVKVKEGWGVVLFCD--PPPHYPDL-SYRWLLNEFPN   45 (96)
T ss_pred             CceeeeeCCcEEEeeC--CCCCCCCC-EEEEEECCccc
Confidence            3366889999999996  35666654 48999998753


No 114
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=90.46  E-value=0.37  Score=29.88  Aligned_cols=25  Identities=24%  Similarity=0.691  Sum_probs=19.7

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      |+.|.|.|.+....+   .+.|.|.|..
T Consensus         1 G~~vtL~C~~~~~~~---~~~v~W~k~~   25 (97)
T cd05846           1 GGNVTLSCNLTLPEE---VLQVTWQKIQ   25 (97)
T ss_pred             CCcEEEEEEeCCCCe---eEEEEEEEcC
Confidence            899999999876532   4789999863


No 115
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=90.35  E-value=0.29  Score=30.75  Aligned_cols=27  Identities=22%  Similarity=0.315  Sum_probs=20.1

Q ss_pred             eecCCeEEEeeecCCCCCCCCceEEEeeec
Q psy531           45 ALLGESVVFNCGVDFPGDTPVPYVLQWEKK   74 (80)
Q Consensus        45 A~vGe~VVlnCdvdfP~~~PiPYVvqW~Kd   74 (80)
                      +.+|++|.|+|.+.-+  .. -..+.|.|.
T Consensus         1 g~~G~sVtL~c~~~~~--~~-~~~v~W~~~   27 (97)
T cd05775           1 GILGGSVTLPLNIPDG--TE-IESITWSFN   27 (97)
T ss_pred             CccCCeEEEeCCCCCC--cE-EEEEEEecC
Confidence            4689999999988532  22 267999886


No 116
>PHA02785 IL-beta-binding protein; Provisional
Probab=90.31  E-value=0.24  Score=37.55  Aligned_cols=32  Identities=22%  Similarity=0.296  Sum_probs=24.3

Q ss_pred             eecCCeEEEeeecCC--CCCCCCceEEEeeecccc
Q psy531           45 ALLGESVVFNCGVDF--PGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        45 A~vGe~VVlnCdvdf--P~~~PiPYVvqW~KdG~~   77 (80)
                      +..||.++|.|.+..  ..|.| ++-+.|.|.|.+
T Consensus        38 ~~~ge~~~l~C~~~~~~~~g~p-~~~i~W~K~g~~   71 (326)
T PHA02785         38 ELENEPVILPCPQINTLSSGYN-ILDILWEKRGAD   71 (326)
T ss_pred             hhcCCCEEEECCCccccccCCC-CceEEEEECCCc
Confidence            667999999999742  24555 468999999754


No 117
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=90.09  E-value=0.39  Score=31.90  Aligned_cols=29  Identities=24%  Similarity=0.473  Sum_probs=21.5

Q ss_pred             cCCeEEEeeecCCCC-C-------CCCceEEEeeecc
Q psy531           47 LGESVVFNCGVDFPG-D-------TPVPYVLQWEKKI   75 (80)
Q Consensus        47 vGe~VVlnCdvdfP~-~-------~PiPYVvqW~KdG   75 (80)
                      +|+.|.|.|.+..+. .       .|-...++|.|..
T Consensus         1 ~G~~VtLpC~~~~~~~~~~~~~~~~~~~~~I~W~k~~   37 (112)
T cd05900           1 LGSSLLIPCYFQDPIAKDPGAPTVAPLSPRIKWSFIS   37 (112)
T ss_pred             CCCcEEEeeEEeCCcCccccccccCCCCCEEEEEEec
Confidence            599999999998753 1       1234678999963


No 118
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=90.08  E-value=0.43  Score=28.34  Aligned_cols=25  Identities=24%  Similarity=0.137  Sum_probs=19.2

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      ||+|.|.|.+..    ..++-+.|.|...
T Consensus         1 G~~VtL~c~~~~----~~~~~i~W~~~~~   25 (92)
T cd05741           1 GESVTLPVSNLP----ENLQEITWYKGKD   25 (92)
T ss_pred             CCcEEEEcccCC----CCCEEEEEECCCC
Confidence            899999998764    2346799999753


No 119
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=89.89  E-value=0.36  Score=30.66  Aligned_cols=29  Identities=28%  Similarity=0.335  Sum_probs=21.3

Q ss_pred             EeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           44 TALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        44 tA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      +++.|+.|.|+|.+.-.    -.+-+.|.|+..
T Consensus         2 ~v~~G~~vtL~C~~~~~----~~~~v~Wyrq~~   30 (104)
T cd05720           2 DAELGQKVELKCEVLNS----SPTGCSWLFQPP   30 (104)
T ss_pred             cccCCCeEEEEEEecCC----CCCcEEEEEeCC
Confidence            47899999999986432    124588988763


No 120
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=89.88  E-value=0.42  Score=30.00  Aligned_cols=28  Identities=25%  Similarity=0.228  Sum_probs=22.2

Q ss_pred             eecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           45 ALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        45 A~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      -..||.|.|+|....+.+     .++|.|+|..
T Consensus        12 V~~G~~VTL~C~~~~~~~-----~f~l~k~g~~   39 (94)
T cd05711          12 VPSGENVTLQCHSDIRFD-----RFILYKEGRS   39 (94)
T ss_pred             cCCCCeEEEEEecCCCCC-----EEEEEECCCC
Confidence            457999999997776554     3899999865


No 121
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=89.85  E-value=0.36  Score=28.14  Aligned_cols=22  Identities=23%  Similarity=0.622  Sum_probs=17.2

Q ss_pred             EEEeeecCCCCCCCCceEEEeeeccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      |.|.|.+.   |.|.| .+.|.|+|.
T Consensus         1 a~l~C~~~---G~P~P-~v~W~k~~~   22 (75)
T cd05763           1 ARLECAAT---GHPTP-QIAWQKDGG   22 (75)
T ss_pred             CEeEeecc---cccCC-EEEEEeCCC
Confidence            46889663   78887 589999985


No 122
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=89.84  E-value=0.34  Score=29.21  Aligned_cols=23  Identities=22%  Similarity=0.660  Sum_probs=18.6

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+|.|.+   .|.|.|- ++|.|+|.+
T Consensus         1 ~~l~C~a---~G~P~P~-i~W~k~g~~   23 (77)
T cd05874           1 IVIQCEA---KGKPPPS-FSWTRNGTH   23 (77)
T ss_pred             CEEEeeC---cccCCCe-EEEEECCeE
Confidence            5788987   4888888 599999875


No 123
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=89.42  E-value=0.32  Score=28.47  Aligned_cols=23  Identities=22%  Similarity=0.621  Sum_probs=18.0

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |+|.|.+.   |.|.| .+.|.|++.+
T Consensus         1 ~~L~C~~~---G~P~P-~v~W~k~~~~   23 (71)
T cd05876           1 LVLECIAE---GLPTP-EVHWDRIDGP   23 (71)
T ss_pred             CEEEEEee---EecCC-eEEEEECCcC
Confidence            47889874   77877 5899999764


No 124
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=89.39  E-value=0.68  Score=30.28  Aligned_cols=32  Identities=28%  Similarity=0.364  Sum_probs=23.9

Q ss_pred             eEEeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           42 HITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      -..|..|+.|.|-|.+.   +.|.|=.+.|..++.
T Consensus        10 s~~~~~G~~~~L~C~~~---s~P~P~~i~W~w~~~   41 (98)
T cd05898          10 VQYAVRGERGKVKCFIG---STPPPDRIAWAWKEN   41 (98)
T ss_pred             eEEEeCCCcEEEEEEEc---cCCCCcEEEEEEccc
Confidence            34589999999999994   455666677777654


No 125
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=89.06  E-value=0.34  Score=28.20  Aligned_cols=23  Identities=26%  Similarity=0.664  Sum_probs=17.3

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +.|.|.+.   |.|.| .++|.|+|.+
T Consensus         1 ~~L~C~v~---g~P~p-~v~W~k~~~~   23 (76)
T cd05736           1 ASLRCHAE---GIPLP-RLTWLKNGMD   23 (76)
T ss_pred             CEeEeEee---ecCCC-EEEEEECCEE
Confidence            46889876   56666 4799999865


No 126
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=88.82  E-value=0.36  Score=28.78  Aligned_cols=24  Identities=29%  Similarity=0.556  Sum_probs=18.4

Q ss_pred             EEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      |.|.|.+.   |.|.|. +.|.|+|.+-
T Consensus         1 v~L~C~v~---G~P~P~-v~W~k~~~~i   24 (75)
T cd05744           1 VRLECRVS---AIPPPQ-IFWKKNNEML   24 (75)
T ss_pred             CEEEEEEe---ecCCCe-EEEEECCEEC
Confidence            46889884   777775 8999998653


No 127
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=88.78  E-value=0.33  Score=27.38  Aligned_cols=23  Identities=22%  Similarity=0.531  Sum_probs=17.9

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |.|.|.+.   |.|.|. ++|.|++.+
T Consensus         1 v~l~C~~~---g~P~p~-v~W~k~~~~   23 (71)
T cd05731           1 LLLECIAE---GLPTPE-ISWIKIGGE   23 (71)
T ss_pred             CEEEEEee---EecCCe-EEEEECCeE
Confidence            46889875   778886 899998764


No 128
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=88.42  E-value=0.51  Score=26.88  Aligned_cols=23  Identities=22%  Similarity=0.398  Sum_probs=17.1

Q ss_pred             EEeeecCCCCC-CCCceEEEeeeccccc
Q psy531           52 VFNCGVDFPGD-TPVPYVLQWEKKIVKN   78 (80)
Q Consensus        52 VlnCdvdfP~~-~PiPYVvqW~KdG~~~   78 (80)
                      +|.|.+.   + .|+| -++|.|+|.+.
T Consensus         2 ~l~C~~~---g~~P~p-~~~W~k~g~~l   25 (75)
T cd05750           2 VLKCEAT---SEYPSL-RFKWFKDGKEL   25 (75)
T ss_pred             EEEEEcc---CCCCCc-eEEEEcCCeec
Confidence            6889886   4 5655 67999998653


No 129
>smart00406 IGv Immunoglobulin V-Type.
Probab=88.38  E-value=0.65  Score=26.22  Aligned_cols=25  Identities=20%  Similarity=0.355  Sum_probs=19.1

Q ss_pred             eEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           50 SVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        50 ~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      .|.|+|.+..... + .+.+.|.|+..
T Consensus         1 ~v~l~C~~~~~~~-~-~~~v~W~~~~~   25 (81)
T smart00406        1 SVTLSCKASGFTF-S-SYYVSWVRQPP   25 (81)
T ss_pred             CEEEEEEEecccc-c-eeEEEEEEeCC
Confidence            3789999887643 2 68899999764


No 130
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=88.36  E-value=0.61  Score=28.75  Aligned_cols=28  Identities=14%  Similarity=0.237  Sum_probs=22.7

Q ss_pred             eecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           45 ALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        45 A~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ...|+.|.|.|.-+.|...     .+|.|+|..
T Consensus        13 V~~G~~VtL~C~~~~~~~~-----f~l~k~g~~   40 (91)
T cd05751          13 VPLGKPVTLRCQGPYGAVE-----YRLYREGST   40 (91)
T ss_pred             cCCCCcEEEEEecCCCCCE-----EEEEECCCC
Confidence            5689999999999877444     688998764


No 131
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=88.15  E-value=0.7  Score=30.07  Aligned_cols=35  Identities=14%  Similarity=0.241  Sum_probs=25.4

Q ss_pred             CCcceEEeecCCeEEEeeecCCCC-CCCCceEEEeeecc
Q psy531           38 SNAVHITALLGESVVFNCGVDFPG-DTPVPYVLQWEKKI   75 (80)
Q Consensus        38 ~~P~~ltA~vGe~VVlnCdvdfP~-~~PiPYVvqW~KdG   75 (80)
                      +.|..++++.|+.|.|+|.+.-.. +.   +-+.|.|+.
T Consensus         2 ~~~~~~~v~~G~~vtL~C~~~~~~~~~---~~~~WYkQ~   37 (117)
T cd04981           2 VESGPGLVKPGQSLKLSCKASGFTFTS---YGVNWVRQA   37 (117)
T ss_pred             ccCCCeEEcCCCCEEEEEEEeCCCccc---ceEEEEEEC
Confidence            467788899999999999864221 12   348898874


No 132
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=87.81  E-value=0.77  Score=34.57  Aligned_cols=32  Identities=22%  Similarity=0.333  Sum_probs=25.1

Q ss_pred             ceEEeecCCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           41 VHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        41 ~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      ..+++..||.|.|.|....+...+.   |+|.|+.
T Consensus        23 ~~v~V~ege~VtLsCs~t~s~~~~q---VtWkK~~   54 (189)
T PHA02987         23 VKITVSEHVNVKISCNKTSSFNSIL---ITWKKNN   54 (189)
T ss_pred             EEEEEcCCCCEEEEEecCCCCccce---EEEEEcC
Confidence            4577999999999999876654433   9999864


No 133
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=87.42  E-value=0.81  Score=30.89  Aligned_cols=34  Identities=21%  Similarity=0.182  Sum_probs=27.0

Q ss_pred             ceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           41 VHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        41 ~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      ..+++++||++.|.|.++   .-|.|--++|.|++..
T Consensus        11 ~~~~v~~gE~~~L~V~ie---AYP~p~~~~W~~~~~~   44 (101)
T cd05860          11 TTIFVNAGENLDLIVEYE---AYPKPEHQQWIYMNRT   44 (101)
T ss_pred             ceEEEECCCCEEEEEEEE---eCCCCeeeEEEcCCcc
Confidence            457799999999999997   3345556899999763


No 134
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=87.07  E-value=0.42  Score=28.82  Aligned_cols=24  Identities=21%  Similarity=0.191  Sum_probs=18.1

Q ss_pred             EEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      |.|.|.+.   |.|.|- +.|.|+|++-
T Consensus         1 ~~~~c~v~---G~P~P~-v~W~k~g~~l   24 (70)
T cd05864           1 VKIPVKYY---GYPPPE-VKWYKNGQLI   24 (70)
T ss_pred             CEEEeEEE---EeCCCE-EEEEECCEEC
Confidence            45777765   777777 6999999764


No 135
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=86.96  E-value=0.78  Score=28.11  Aligned_cols=26  Identities=15%  Similarity=0.424  Sum_probs=18.5

Q ss_pred             CeEEEeeecCCCCCCCCce-EEEeeecccc
Q psy531           49 ESVVFNCGVDFPGDTPVPY-VLQWEKKIVK   77 (80)
Q Consensus        49 e~VVlnCdvdfP~~~PiPY-VvqW~KdG~~   77 (80)
                      |.|.|-|.+.   +.|.|= -+.|.|+|.+
T Consensus         1 ~~~~L~C~a~---g~P~p~~~v~W~~~g~~   27 (85)
T cd05854           1 ENLTLQCHAS---HDPTMDLTFTWSLDDFP   27 (85)
T ss_pred             CcEEEEEEEe---cCCCCCeEEEEEECCeE
Confidence            5688999876   445542 3789999865


No 136
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=85.23  E-value=1.1  Score=22.34  Aligned_cols=24  Identities=25%  Similarity=0.378  Sum_probs=17.6

Q ss_pred             EEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      |.|.|.+..    +.+..++|.|.+...
T Consensus         1 ~~l~C~~~~----~~~~~~~W~~~~~~~   24 (74)
T cd00096           1 VTLTCLASG----PPPPTITWLKNGKPL   24 (74)
T ss_pred             CEEEEEecC----CCCCcEEEEECCEEC
Confidence            468898886    445669999987553


No 137
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=83.86  E-value=1.5  Score=27.00  Aligned_cols=27  Identities=30%  Similarity=0.503  Sum_probs=19.5

Q ss_pred             CCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           48 GESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      ||.+.|+|.+.-  +..+.+-++|...+.
T Consensus         1 Ge~~~L~C~~~~--~~~~~~~~~W~~p~~   27 (86)
T cd05862           1 GEKLVLNCTART--ELNVGIDFQWDYPGK   27 (86)
T ss_pred             CCcEEEEEEEEe--CCCCcEEEEEEcCCc
Confidence            899999999942  223346689987664


No 138
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=83.07  E-value=1.1  Score=28.50  Aligned_cols=28  Identities=21%  Similarity=0.440  Sum_probs=22.0

Q ss_pred             ecCCeEEEeeecC--CCCCCCCceEEEeeecccc
Q psy531           46 LLGESVVFNCGVD--FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        46 ~vGe~VVlnCdvd--fP~~~PiPYVvqW~KdG~~   77 (80)
                      ..|+.+.|.|.+.  ||.+    --|.|.|+|.+
T Consensus        12 ~~~~~~~L~C~~~gFyP~~----i~v~W~~~g~~   41 (94)
T cd05766          12 SLSHPHLLVCHVWGFYPPE----ITVKWFKNGQE   41 (94)
T ss_pred             cCCCCeEEEEEEeeecCCC----CEEEEEECCee
Confidence            3578899999996  6744    24899999976


No 139
>PRK00059 prsA peptidylprolyl isomerase; Provisional
Probab=82.54  E-value=2.3  Score=31.72  Aligned_cols=46  Identities=9%  Similarity=0.073  Sum_probs=30.1

Q ss_pred             hchhHHHHHHHHHHHHhhccCCCCCCCC----cceEEeecCCeEEEeeec
Q psy531           12 TNLHHISLQVLLIITLVHFKGVSPDISN----AVHITALLGESVVFNCGV   57 (80)
Q Consensus        12 ~~~~~~~~~~ll~i~l~~~sg~~g~~~~----P~~ltA~vGe~VVlnCdv   57 (80)
                      |++-+|.+.+++|++..+..||+.....    +..+.|+||+..|-.=++
T Consensus         2 ~~~~~~~~~~~~~~l~~~~~gc~~~~~~~~~~~~~vvA~Vn~~~It~~e~   51 (336)
T PRK00059          2 KSIKKLVASLLVGVFIFSAVGCNMIEKTPEAIAKSTVATVNGEKITRGDL   51 (336)
T ss_pred             chHHHHHHHHHHHHHHHhhccccccccCccccCCCceEEECCEEeCHHHH
Confidence            4566777777777776666777642222    334569999998865444


No 140
>PF05688 DUF824:  Salmonella repeat of unknown function (DUF824);  InterPro: IPR008542 This family consists of a series of repeated sequences (of around 180 residues) which are found in Salmonella typhimurium, Salmonella typhi and Escherichia coli. These repeats are almost always found with this entry. The repeats are associated with RatA and RatB, the coding sequences of which are found in the pathogeneicity island of Salmonella. The sequences may be determinants of pathogenicity [, ].
Probab=82.19  E-value=1.3  Score=26.61  Aligned_cols=27  Identities=26%  Similarity=0.390  Sum_probs=23.3

Q ss_pred             EEeecCCeEEEeeecCCCCCCCCceEE
Q psy531           43 ITALLGESVVFNCGVDFPGDTPVPYVL   69 (80)
Q Consensus        43 ltA~vGe~VVlnCdvdfP~~~PiPYVv   69 (80)
                      ..||+||++.|.=.+-=-+|.|+||.-
T Consensus         7 akaK~Ge~I~ltVt~kda~G~pv~n~~   33 (47)
T PF05688_consen    7 AKAKVGETIPLTVTVKDANGNPVPNAP   33 (47)
T ss_pred             hheecCCeEEEEEEEECCCCCCcCCce
Confidence            469999999999888777999999863


No 141
>KOG4221|consensus
Probab=82.12  E-value=2.4  Score=39.93  Aligned_cols=37  Identities=24%  Similarity=0.466  Sum_probs=30.7

Q ss_pred             CcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccccC
Q psy531           39 NAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKNN   79 (80)
Q Consensus        39 ~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~~   79 (80)
                      +|+  .|--|.+|+|+|--.+-.+  .+|.++|.|||...+
T Consensus        47 ep~--d~~~~~svlLecs~~~~~~--~~~~i~wkkDg~~l~   83 (1381)
T KOG4221|consen   47 EPS--DAMEGSSVLLECSAYAAGG--TSVKIEWKKDGSQLN   83 (1381)
T ss_pred             ccc--ccccccceEEeccccccCC--CCeeEEEccCchhhh
Confidence            566  3478999999999988877  689999999998654


No 142
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=81.97  E-value=1.7  Score=28.56  Aligned_cols=29  Identities=21%  Similarity=0.304  Sum_probs=22.0

Q ss_pred             eEEeecCCeEEEeeecCCCCCCCCceEEEeeec
Q psy531           42 HITALLGESVVFNCGVDFPGDTPVPYVLQWEKK   74 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~Kd   74 (80)
                      --.|.+|+.|+|.|+. +|..   .--+.|.|.
T Consensus         7 p~~~~~G~~V~L~v~~-~p~~---~~~~~W~kg   35 (105)
T cd05774           7 PPQVAEGENVLLLVHN-LPEN---LLAYAWYKG   35 (105)
T ss_pred             CCcccCCCCEEEEecC-CCCC---ceEEEEEcC
Confidence            3347899999999987 6743   245899995


No 143
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=81.59  E-value=1.1  Score=27.54  Aligned_cols=23  Identities=22%  Similarity=0.316  Sum_probs=17.1

Q ss_pred             EEeeecCCCCCCCCceEEEeeeccccc
Q psy531           52 VFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        52 VlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      -|-|.+.   |.|.|- +.|.|+|.+.
T Consensus         2 ~l~c~v~---g~P~P~-v~W~kdg~~l   24 (72)
T cd07702           2 RLTPKVK---AFPAPE-VIWLKDGLPA   24 (72)
T ss_pred             eEEeeEE---EcCCCe-EEEEECCEEC
Confidence            3667654   788887 5999999763


No 144
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=80.36  E-value=1.6  Score=25.94  Aligned_cols=30  Identities=30%  Similarity=0.452  Sum_probs=22.3

Q ss_pred             ecCCeEEEeeecCCCCCC-CCceEEEeeeccccc
Q psy531           46 LLGESVVFNCGVDFPGDT-PVPYVLQWEKKIVKN   78 (80)
Q Consensus        46 ~vGe~VVlnCdvdfP~~~-PiPYVvqW~KdG~~~   78 (80)
                      ..|+.+.|.|.+.   |- |.+--+.|.|+|.+.
T Consensus        11 ~~~~~~~L~C~a~---g~~P~~~~i~W~~~g~~~   41 (95)
T cd00098          11 LLGGSVTLTCLAT---GFYPPDITVTWLKNGKEL   41 (95)
T ss_pred             HcCCCeEEEEEEe---eEECCCcEEEEEECCEEC
Confidence            4689999999986   22 334569999998763


No 145
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=79.86  E-value=1.4  Score=26.55  Aligned_cols=28  Identities=36%  Similarity=0.642  Sum_probs=22.1

Q ss_pred             ecCCeEEEeeecC--CCCCCCCceEEEeeecccc
Q psy531           46 LLGESVVFNCGVD--FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        46 ~vGe~VVlnCdvd--fP~~~PiPYVvqW~KdG~~   77 (80)
                      ..|+.+.|.|.+.  ||.+    --|.|.|+|.+
T Consensus         6 ~~~~~~~L~C~v~~f~P~~----i~v~W~~~~~~   35 (83)
T PF07654_consen    6 ELGGSVTLTCLVSGFYPKD----ITVTWLKNGKE   35 (83)
T ss_dssp             HSTSEEEEEEEEEEEBSST----EEEEEEETTEE
T ss_pred             cCCCCEEEEEEEEEEECCC----cEEEEEeccce
Confidence            3499999999997  6743    35899999875


No 146
>KOG3513|consensus
Probab=78.25  E-value=1.9  Score=39.44  Aligned_cols=37  Identities=19%  Similarity=0.413  Sum_probs=30.9

Q ss_pred             CcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           39 NAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        39 ~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .|....-++|++|+|.|...|-..-.++|  .|.++|.+
T Consensus       522 ~P~~~~v~~g~~v~l~Ce~shD~~ld~~f--~W~~nG~~  558 (1051)
T KOG3513|consen  522 APSNTDVKVGESVTLTCEASHDPSLDITF--TWKKNGRP  558 (1051)
T ss_pred             ccchhhhccCceEEEEeecccCCCcceEE--EEEECCEE
Confidence            56777789999999999999886666665  89999974


No 147
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=78.24  E-value=4.6  Score=26.28  Aligned_cols=29  Identities=17%  Similarity=0.468  Sum_probs=21.4

Q ss_pred             cCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           47 LGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        47 vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .|+.+.|.|.+.  ...|.+=-+.|.|+|.+
T Consensus        52 ~~~~~~L~C~a~--g~~P~~~~i~W~~~g~~   80 (139)
T cd05771          52 IEEPQTLICHIA--GYYPLDVQVEWTREPPG   80 (139)
T ss_pred             cCCcEEEEEEEC--CCCCCCeEEEEEECCCC
Confidence            688999999995  22333446999999864


No 148
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain. Ig_CD3_epsilon; immunoglobulin (Ig)-like domain of CD3 epsilon chain. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=77.72  E-value=2.9  Score=26.63  Aligned_cols=25  Identities=24%  Similarity=0.549  Sum_probs=19.2

Q ss_pred             ecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           46 LLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        46 ~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      .-|.+|+|.|+.+.  +.     ++|.|++..
T Consensus         5 isGTtVtlTCP~~~--~~-----i~W~~n~~~   29 (65)
T cd07692           5 ISGTTVTVTCPLSG--DD-----IKWKKNDQV   29 (65)
T ss_pred             EeccEEEEECCCCC--CC-----ceEEeCCcc
Confidence            45899999999773  22     799999743


No 149
>PF15183 MRAP:  Melanocortin-2 receptor accessory protein family
Probab=75.20  E-value=4.1  Score=27.95  Aligned_cols=34  Identities=21%  Similarity=0.464  Sum_probs=24.3

Q ss_pred             cchhhhhHhhhchhHHHHHHHHHHHHhhccCCCCCCCCcce
Q psy531            2 GMWLNLAFLETNLHHISLQVLLIITLVHFKGVSPDISNAVH   42 (80)
Q Consensus         2 ~~~~~~~~~~~~~~~~~~~~ll~i~l~~~sg~~g~~~~P~~   42 (80)
                      |.|..||.       ..+.+|+|+++++-||++..+..+.+
T Consensus        41 ~FWv~LA~-------FV~~lF~iL~~ms~sgspq~~~~~k~   74 (90)
T PF15183_consen   41 AFWVSLAA-------FVVFLFLILLYMSWSGSPQMRNSEKH   74 (90)
T ss_pred             hHHHHHHH-------HHHHHHHHHHHHhccCCCCcCCcccc
Confidence            56777764       35678899999999999865544443


No 150
>PF13473 Cupredoxin_1:  Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D.
Probab=70.99  E-value=3.7  Score=25.98  Aligned_cols=16  Identities=25%  Similarity=0.372  Sum_probs=11.2

Q ss_pred             CcceEEeecCCeEEEe
Q psy531           39 NAVHITALLGESVVFN   54 (80)
Q Consensus        39 ~P~~ltA~vGe~VVln   54 (80)
                      +|..++++.|+.|.+.
T Consensus        33 ~P~~i~v~~G~~v~l~   48 (104)
T PF13473_consen   33 SPSTITVKAGQPVTLT   48 (104)
T ss_dssp             ES-EEEEETTCEEEEE
T ss_pred             ecCEEEEcCCCeEEEE
Confidence            7888889999955443


No 151
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=70.38  E-value=4.8  Score=23.77  Aligned_cols=23  Identities=13%  Similarity=0.287  Sum_probs=16.6

Q ss_pred             EEEeeecC-CCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVD-FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvd-fP~~~PiPYVvqW~KdG~~   77 (80)
                      +.|.|.+. |   .|.| .+.|.|+|++
T Consensus         2 ~~L~C~v~g~---~P~~-~v~W~~~g~~   25 (82)
T cd05759           2 YNLTCRARGA---KPAA-EIIWFRDGEV   25 (82)
T ss_pred             EEEEEEEeCc---cCCC-EEEEEECCEE
Confidence            56889884 2   3445 5999999875


No 152
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=70.02  E-value=6.5  Score=26.07  Aligned_cols=31  Identities=16%  Similarity=0.300  Sum_probs=26.1

Q ss_pred             eecCCeEEEeeecCCCCCCCCceE-EEeeecccc
Q psy531           45 ALLGESVVFNCGVDFPGDTPVPYV-LQWEKKIVK   77 (80)
Q Consensus        45 A~vGe~VVlnCdvdfP~~~PiPYV-vqW~KdG~~   77 (80)
                      ..+|+.+-|.|.+.  .+.|.+.+ |.|.|.+..
T Consensus        13 ~~eG~~~tL~C~v~--g~~P~a~L~i~W~rG~~~   44 (100)
T cd05755          13 QPVGKNYTLQCDVP--GVAPRQNLTVVLLRGNET   44 (100)
T ss_pred             ccCCCcEEEEEEEc--CcCCCCcEEEEEeeCCEE
Confidence            58999999999984  67888886 899998754


No 153
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=69.23  E-value=5.2  Score=25.74  Aligned_cols=29  Identities=38%  Similarity=0.523  Sum_probs=22.2

Q ss_pred             eecCCeEEEeeecC--CCCCCCCceEEEeeecccc
Q psy531           45 ALLGESVVFNCGVD--FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        45 A~vGe~VVlnCdvd--fP~~~PiPYVvqW~KdG~~   77 (80)
                      +..|+.+.|.|.+.  ||.+.    -|+|.|+|.+
T Consensus        12 ~~~~~~~tL~C~a~gFyP~~I----~v~W~~~g~~   42 (94)
T cd05767          12 VELGEPNTLICFVDNFFPPVL----NVTWLKNGVP   42 (94)
T ss_pred             ccCCCCeEEEEEEEEEECCcC----EEEEEECCeE
Confidence            34577789999996  77443    4899999976


No 154
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=68.48  E-value=6.1  Score=25.31  Aligned_cols=26  Identities=19%  Similarity=0.482  Sum_probs=20.0

Q ss_pred             CCeEEEeeecC--CCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVD--FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvd--fP~~~PiPYVvqW~KdG~~   77 (80)
                      ++.|.|.|.+.  ||.+    --|.|.|+|.+
T Consensus        16 ~~~~~L~C~a~gFyP~~----i~vtW~k~g~~   43 (95)
T cd04985          16 SDSVTLGCLATGFLPEP----VTFTWNSGSNS   43 (95)
T ss_pred             CCcEEEEEEEeeEECCC----cEEEEeECCEE
Confidence            56689999985  6642    46899999986


No 155
>PF08940 DUF1918:  Domain of unknown function (DUF1918);  InterPro: IPR015035 This domain is found in various hypothetical bacterial proteins, and has no known function. ; PDB: 2A7Y_A.
Probab=67.34  E-value=3.1  Score=26.32  Aligned_cols=19  Identities=21%  Similarity=0.590  Sum_probs=11.8

Q ss_pred             CCCCCCCCceEEEeeecccc
Q psy531           58 DFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        58 dfP~~~PiPYVvqW~KdG~~   77 (80)
                      --+.| -+||+|.|..+|..
T Consensus        29 ~g~dG-~PPY~VRw~D~Ghe   47 (58)
T PF08940_consen   29 RGPDG-SPPYLVRWDDTGHE   47 (58)
T ss_dssp             S-SSS--S-EEEEETTTTEE
T ss_pred             ECCCC-CCCEEEEecCCCcE
Confidence            34544 46899999987764


No 156
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=66.67  E-value=5.6  Score=25.90  Aligned_cols=30  Identities=30%  Similarity=0.357  Sum_probs=22.2

Q ss_pred             eecCCeEEEeeec--CC--CCCCCCceEEEeeecccc
Q psy531           45 ALLGESVVFNCGV--DF--PGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        45 A~vGe~VVlnCdv--df--P~~~PiPYVvqW~KdG~~   77 (80)
                      +.+|.+..|.|.-  +|  +...   .-++|.||+.+
T Consensus         7 ~~~~~~~~l~Cp~~~~f~~~~~~---~~v~WYKd~~~   40 (95)
T cd05897           7 LFTSTSGKLVCPDLSDFTINRTD---VELQWYKDSVL   40 (95)
T ss_pred             eccccCcEEECCCHHHcccCCCC---CcEEEccCCEE
Confidence            5688999999964  55  3322   35999999975


No 157
>KOG4221|consensus
Probab=65.99  E-value=8.4  Score=36.49  Aligned_cols=38  Identities=29%  Similarity=0.524  Sum_probs=31.7

Q ss_pred             CCCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           36 DISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        36 ~~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      -.+.|+..+.-.|+.|.|+|+|.-   .|.| .++|.|+..+
T Consensus       143 f~~~~~~~t~~~g~ta~f~c~vn~---e~~p-~i~w~kn~~p  180 (1381)
T KOG4221|consen  143 FALQPESTTLLYGQTALFSCEVNA---EPVP-TIMWLKNDQP  180 (1381)
T ss_pred             cccCccceeEecCCcEEEEEEEcC---ccCc-eeEEeccccc
Confidence            356888899999999999998875   6667 7999999764


No 158
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=65.23  E-value=8.1  Score=25.12  Aligned_cols=23  Identities=22%  Similarity=0.419  Sum_probs=17.7

Q ss_pred             eEEEeeecCCCCCCCCceEEEeeecc
Q psy531           50 SVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        50 ~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      .|.|.|.+..+.   .-+.|+|.|..
T Consensus         2 ~vtL~C~~~~~~---~~~qV~W~k~~   24 (96)
T cd05887           2 NVTLKCRIQVNE---TITQSSWEKIH   24 (96)
T ss_pred             CEEEEEEecCCC---cEEEEEEEEcC
Confidence            589999988653   23789999974


No 159
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively). Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cel
Probab=64.48  E-value=10  Score=22.87  Aligned_cols=24  Identities=25%  Similarity=0.576  Sum_probs=17.5

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |.|.|.+  -.+.|.| -|.|.|+|.+
T Consensus         2 ~~L~C~~--~~~~P~~-~v~W~~~~~~   25 (82)
T cd05761           2 VELTCTS--SGSKPAA-TIRWFKGDKE   25 (82)
T ss_pred             EEEEEEe--cCcCcCC-eEEEEECCEE
Confidence            6788988  2344556 7999999875


No 160
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=59.62  E-value=9.4  Score=25.21  Aligned_cols=29  Identities=31%  Similarity=0.510  Sum_probs=22.0

Q ss_pred             eecCCeEEEeeecC--CCCCCCCceEEEeeecccc
Q psy531           45 ALLGESVVFNCGVD--FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        45 A~vGe~VVlnCdvd--fP~~~PiPYVvqW~KdG~~   77 (80)
                      ...|+.+.|.|.+.  ||.    .--|+|.|+|.+
T Consensus        18 ~~~g~~~tL~C~a~gF~P~----~i~v~W~kng~~   48 (111)
T cd05772          18 ANPGQSVNFTCSAHGFSPR----DITVKWLKNGNE   48 (111)
T ss_pred             cCCCCCEEEEEEEeeEeCC----CCEEEEEECCEE
Confidence            44688899999886  452    345999999976


No 161
>PRK10894 lipopolysaccharide transport periplasmic protein LptA; Provisional
Probab=59.48  E-value=12  Score=26.35  Aligned_cols=46  Identities=20%  Similarity=0.260  Sum_probs=25.4

Q ss_pred             chhHHHHHHHHHHHHhhcc--CCCCCCCCcceEEeec------CCeEEEeeecC
Q psy531           13 NLHHISLQVLLIITLVHFK--GVSPDISNAVHITALL------GESVVFNCGVD   58 (80)
Q Consensus        13 ~~~~~~~~~ll~i~l~~~s--g~~g~~~~P~~ltA~v------Ge~VVlnCdvd   58 (80)
                      |--|+.+++++++++++.+  ....+...|.+++|.-      ++.++|.=+|.
T Consensus         2 ~~~~~~~~~~~~ll~~~~~a~A~~~d~~~pI~I~AD~~~~~~~~~~~~~tGnV~   55 (180)
T PRK10894          2 NKLSLNLLLASSLLAASIPAFALTGDTDQPIHIDSDQQSLDMQGNVVTFTGNVV   55 (180)
T ss_pred             cchHHHHHHHHHHHHHHHHHhhcccccCCCEEEEeCceEeeccCCEEEEEeeEE
Confidence            3344555555555554322  3345678899988653      34455554443


No 162
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=59.03  E-value=11  Score=24.41  Aligned_cols=21  Identities=19%  Similarity=0.425  Sum_probs=15.8

Q ss_pred             cCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           47 LGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        47 vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      ..++|.|.|+++   .+     +.|+| |.
T Consensus         5 ~~~~V~L~C~~~---ts-----i~W~k-G~   25 (69)
T cd07691           5 SEGKVFLKCNGA---TN-----ITWKK-GK   25 (69)
T ss_pred             cCceEEEEecCC---Cc-----EEEec-Cc
Confidence            357899999885   23     89999 54


No 163
>PF03921 ICAM_N:  Intercellular adhesion molecule (ICAM), N-terminal domain;  InterPro: IPR013768 Intercellular adhesion molecules (ICAMs) and vascular cell adhesion molecule-1 (VCAM-1) are part of the immunoglobulin superfamily. They are important in inflammation, immune responses and in intracellular signalling events []. The ICAM family consists of five members, designated ICAM-1 to ICAM-5. They are known to bind to leucocyte integrins CD11/CD18 during inflammation and in immune responses. In addition, ICAMs may exist in soluble forms in human plasma, due to activation and proteolysis mechanisms at cell surfaces. ICAM-1 (CD54) contains five Ig-like domains. It is expressed on leucocytes, endothelial and epithelial cells, and is upregulated in response to bacterial invasion. The protein is a ligand for lymphocyte-function associated (LFA) antigens and also a receptor for CD11a,b/CD18, fibrinogen, human rhinovirus and Plasmodium falciparum-infected erythrocytes. ICAM-1 binding sites for CD11a/CD18 and its other binding partners are located in the first domain and are overlapping. ICAM-1 domain 2 seems to play an important role in maintaining the conformation of domain 1 and particularly the structural integrity of the LFA-1 ligand-binding site []. The 3-dimensional atomic structure of the tandem N-terminal Ig-like domains (D1 and D2) of ICAM-1 has been determined to 2.2A resolution and fitted into a cryoelectron microscopy reconstruction of a rhinovirus-ICAM-1 complex []. Extensive charge interactions between ICAM-1 and human rhinovirusesare largely conserved in major and minor receptor groups of rhinoviruses. The interaction of ICAMs with LFA-1 is mediated by a divalent cation bound to the insertion (I)-domain on the alpha chain of LFA-1 and the carboxyl group of a conserved glutamic acid residue on ICAMs. ICAM-2 (CD102) has two Ig-like domains. It is expressed on endothelial cells, leucocytes and platelets, and binds to CD11a'b/CD18. The protein is refractory to proinflammatory cytokines, and plays an important role in the adhesion of leucocytes to the uninduced endothelium []. ICAM-3 (CD50) contains five Ig-like domains and binds to leucocyte integrins CD11a'd/CD18. The protein plays an important role in the immune response and perhaps in signal transduction []. ICAM-4 (LW blood group Ag) is red blood cell (RBC) specific and binds to CD11a'b/CD18. It is associated with the RBC Rh antigens and could be important in retaining immature red cells in the bone marrow, or in the uptake of senescent cells into the spleen []. ICAM-5 (telencephalin) has nine Ig-like domains and is confined to the telencephalon of the brain. The role of this CD11a/CD18 binding molecule is not yet known []. VCAM-1 was first described as a cytokine-inducible endothelial adhesion molecule. It can bind to leucocyte integrin VL-4 (very late antigen-4) to recruit leucocytes to sites of inflammation []. The predominant form of VCAM-1 in vivo has an N-terminal extracellular region comprising seven Ig-like domains []. A conserved integrin-binding motif has been identified in domains 1 and 4, variants of which are present in the N-terminal domain of all members of the integrin-binding subgroup of the immunoglobulin superfamily. The structure of a VLA-4-binding fragment comprising the first two domains of VCAM-1 has been determined to 1.8A resolution. The integrin-binding motif is exposed and forms the N-terminal region of the loop between beta-strands C and D of domain 1 []. VCAM-1 domains 1 and 2 are structurally similar to ICAM-1 and ICAM-2 []. This entry represents the N-terminal domain of ICAM proteins such as ICAM-2, ICAM-3 and ICAM-4.; PDB: 3BN3_B 1T0P_B 1ZXQ_A 3TCX_A 1MQ8_A 1Z7Z_I 1IC1_A 1IAM_A.
Probab=57.94  E-value=8.1  Score=25.69  Aligned_cols=25  Identities=24%  Similarity=0.270  Sum_probs=21.1

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCC
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPG   61 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~   61 (80)
                      +-.|+...-+.|++|.+||--+=|+
T Consensus         7 ~v~P~~~vV~~G~Sv~VNCStsC~~   31 (91)
T PF03921_consen    7 RVSPEEPVVPPGGSVWVNCSTSCPQ   31 (91)
T ss_dssp             EEESSEEEEETTEEEEEEEEESSSS
T ss_pred             EEECCccEECCCCCEEEEEcCCCCC
Confidence            4478888899999999999887664


No 164
>PF08204 V-set_CD47:  CD47 immunoglobulin-like domain;  InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ].; PDB: 2VSC_B 2JJS_D 2JJT_C.
Probab=52.93  E-value=16  Score=25.75  Aligned_cols=34  Identities=18%  Similarity=0.307  Sum_probs=20.3

Q ss_pred             EeecCCeEEEeeecCC-CCCCCCceEEEeeecccc
Q psy531           44 TALLGESVVFNCGVDF-PGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        44 tA~vGe~VVlnCdvdf-P~~~PiPYVvqW~KdG~~   77 (80)
                      .+.-.+.|+++|.|+- +...-.=..|+|..+|.+
T Consensus        23 ~t~CN~tV~IPC~v~n~~~~ni~~m~VkWk~~~~~   57 (130)
T PF08204_consen   23 YTVCNDTVVIPCFVNNLEANNISEMYVKWKFKNKD   57 (130)
T ss_dssp             E-TT-SEEEE--BBSS---SSGGGEEEEEEETTEE
T ss_pred             EEecCCCEEEEeEeccccccccceEEEEEEECCeE
Confidence            3788999999999964 322222366999998864


No 165
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=52.75  E-value=21  Score=23.03  Aligned_cols=25  Identities=24%  Similarity=0.368  Sum_probs=17.2

Q ss_pred             eEEEeeecCCCCCCCCceEEEeeec
Q psy531           50 SVVFNCGVDFPGDTPVPYVLQWEKK   74 (80)
Q Consensus        50 ~VVlnCdvdfP~~~PiPYVvqW~Kd   74 (80)
                      .|.|.|.+..+....-..-|+|.|.
T Consensus         2 ~v~L~C~f~~~~~~~~~~~V~W~k~   26 (99)
T cd05886           2 DVVLHCSFINPLPPVKITQVTWQKL   26 (99)
T ss_pred             cEEEEeEeecCCCCCCeEEEEEEEC
Confidence            5899999986532212246999986


No 166
>PF12028 DUF3515:  Protein of unknown function (DUF3515);  InterPro: IPR021903  This family of proteins is functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 166 to 214 amino acids in length. This protein has a conserved RCG sequence motif. 
Probab=50.18  E-value=16  Score=26.09  Aligned_cols=30  Identities=33%  Similarity=0.546  Sum_probs=18.5

Q ss_pred             CCeEEEeeecCCCCC---CCCceE---EEeeecccc
Q psy531           48 GESVVFNCGVDFPGD---TPVPYV---LQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvdfP~~---~PiPYV---vqW~KdG~~   77 (80)
                      ++.|+|+|-|+.|..   ......   |+|+.+...
T Consensus        78 ~~~vvlRCGV~~P~~~~~~~~~~~VngV~W~~~~~~  113 (163)
T PF12028_consen   78 GEPVVLRCGVPRPAPYTPTSPCQQVNGVDWFEDEDD  113 (163)
T ss_pred             CCcEEEECCCCCCCCCCCCCcceEECCCceEEeccC
Confidence            356999999999953   111111   578776543


No 167
>TIGR02925 cis_trans_EpsD peptidyl-prolyl cis-trans isomerase, EpsD family. Members of this family belong to the peptidyl-prolyl cis-trans isomerase family and are found in loci associated with exopolysaccharide biosynthesis. All members are encoded near a homolog of EpsH, as detected by TIGR02602.
Probab=50.04  E-value=35  Score=24.01  Aligned_cols=19  Identities=11%  Similarity=0.088  Sum_probs=14.1

Q ss_pred             cceEEeecCCeEEEeeecC
Q psy531           40 AVHITALLGESVVFNCGVD   58 (80)
Q Consensus        40 P~~ltA~vGe~VVlnCdvd   58 (80)
                      ...+-|+||+.+|-.=+++
T Consensus        25 ~~~vvA~Vng~~It~~dl~   43 (232)
T TIGR02925        25 ASQVAAKVNGVEISVHQLN   43 (232)
T ss_pred             CCCeeEEECCEEeCHHHHH
Confidence            4556699999998766554


No 168
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=49.39  E-value=19  Score=23.31  Aligned_cols=26  Identities=15%  Similarity=0.447  Sum_probs=20.0

Q ss_pred             CCeEEEeeecC--CCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVD--FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvd--fP~~~PiPYVvqW~KdG~~   77 (80)
                      |+.+.|.|.+.  ||.+    --|.|.|+|.+
T Consensus        16 ~~~~tL~C~a~gFyP~~----I~v~W~kng~~   43 (96)
T cd07697          16 QGQGIYLCLLENFFPDV----IQVHWREGNSP   43 (96)
T ss_pred             CCCEEEEEEEEEEeCCC----eEEEEEECCEE
Confidence            56789999986  6632    34899999976


No 169
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=47.96  E-value=19  Score=23.17  Aligned_cols=28  Identities=21%  Similarity=0.405  Sum_probs=21.5

Q ss_pred             ecCCeEEEeeecC--CCCCCCCceEEEeeecccc
Q psy531           46 LLGESVVFNCGVD--FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        46 ~vGe~VVlnCdvd--fP~~~PiPYVvqW~KdG~~   77 (80)
                      ..|+.+.|.|.+.  ||.    ..-|.|.|+|++
T Consensus        14 ~~~~~~tL~C~a~gFyP~----~i~v~W~k~g~~   43 (102)
T cd05768          14 SLQETATLTCLVKGFSPS----DIFVKWLQNGQP   43 (102)
T ss_pred             CcCCceEEEEEEeeEeCC----CCEEEEEECCEE
Confidence            3478899999995  553    346999999875


No 170
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=47.71  E-value=26  Score=22.63  Aligned_cols=24  Identities=25%  Similarity=0.450  Sum_probs=17.2

Q ss_pred             CeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           49 ESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        49 e~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      |.|.|.|...-+.   .-.-|+|.|..
T Consensus         1 ~~vtL~C~~~~~~---~~~qV~W~k~~   24 (96)
T cd05889           1 EKMKLECVYPKTG---VLIQVSWTKHN   24 (96)
T ss_pred             CCEEEEeEcCCCC---cEEEEEEEEcC
Confidence            5689999986543   23567899974


No 171
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=47.63  E-value=25  Score=22.49  Aligned_cols=27  Identities=30%  Similarity=0.452  Sum_probs=20.1

Q ss_pred             ecCCeEEEeeecC---CCCCCCCceEEEeeeccc
Q psy531           46 LLGESVVFNCGVD---FPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        46 ~vGe~VVlnCdvd---fP~~~PiPYVvqW~KdG~   76 (80)
                      ..|+.+.|.|.+.   ||.    .-.|.|.|+|.
T Consensus        12 ~~~~~~tLtC~v~gf~yP~----~i~v~W~r~~~   41 (96)
T cd07696          12 LLTKSVKLTCLVTNLTSPE----GVNVTWTRGSG   41 (96)
T ss_pred             ccCCCeEEEEEEeCCCCCC----CcEEEEEECCe
Confidence            3589999999874   453    33689999864


No 172
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=47.60  E-value=15  Score=24.71  Aligned_cols=27  Identities=15%  Similarity=0.351  Sum_probs=20.3

Q ss_pred             cCCeEEEeeecC--CCCCCCCceEEEeeecccc
Q psy531           47 LGESVVFNCGVD--FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        47 vGe~VVlnCdvd--fP~~~PiPYVvqW~KdG~~   77 (80)
                      .++.+.|.|.+.  ||.+    --|.|.|+|.+
T Consensus        17 ~~~~~tL~Cla~gFyP~~----I~V~W~kng~~   45 (115)
T cd05769          17 NKRKATLVCLATGFYPDH----VSLSWKVNGKE   45 (115)
T ss_pred             cCCCcEEEEEEEeEeCCC----cEEEEEECCEE
Confidence            357799999886  5643    35999999865


No 173
>PF13624 SurA_N_3:  SurA N-terminal domain; PDB: 3NRK_A.
Probab=44.37  E-value=17  Score=23.78  Aligned_cols=18  Identities=6%  Similarity=0.075  Sum_probs=10.6

Q ss_pred             CcceEEeecCCeEEEeee
Q psy531           39 NAVHITALLGESVVFNCG   56 (80)
Q Consensus        39 ~P~~ltA~vGe~VVlnCd   56 (80)
                      .+....|+||+.-|-.=+
T Consensus        37 ~~~~~vA~V~g~~It~~e   54 (154)
T PF13624_consen   37 SNNNVVAKVNGEKITKSE   54 (154)
T ss_dssp             ----EEEEETTEEEEHHH
T ss_pred             CCCCEEEEECCEEeCHHH
Confidence            666777999998875433


No 174
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE). IgC_CH2_IgE: The second constant domain of the heavy chain of immunoglobulin E (IgE). The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma, and mu, all consisting of a variable domain (VH) and three (in alpha, delta, and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). The different classes of antibodies vary in their heavy chains; the IgE class has the epsilon type. This domain (Cepsilon2) of IgE is in place of the flexible hinge region found in IgG.
Probab=42.51  E-value=30  Score=22.00  Aligned_cols=26  Identities=19%  Similarity=0.414  Sum_probs=19.6

Q ss_pred             CCeEEEeeecC--CCCCCCCceEEEeeecccc
Q psy531           48 GESVVFNCGVD--FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        48 Ge~VVlnCdvd--fP~~~PiPYVvqW~KdG~~   77 (80)
                      .+.+.|.|.+.  ||.+    --|.|.|+|.+
T Consensus        14 ~~~~~L~C~a~gFyP~~----I~vtW~~dg~~   41 (94)
T cd05847          14 SETIQLLCLISGYTPGT----IEVEWLVDGQV   41 (94)
T ss_pred             CCCEEEEEEEEeEECCC----CEEEEEECCEE
Confidence            45688999986  6743    34899999876


No 175
>COG5660 Predicted integral membrane protein [Function unknown]
Probab=40.58  E-value=21  Score=28.06  Aligned_cols=33  Identities=39%  Similarity=0.419  Sum_probs=24.9

Q ss_pred             hchhHHHHHHHHHHHHhhccCCCCCCCCcceEE
Q psy531           12 TNLHHISLQVLLIITLVHFKGVSPDISNAVHIT   44 (80)
Q Consensus        12 ~~~~~~~~~~ll~i~l~~~sg~~g~~~~P~~lt   44 (80)
                      +.+|||.-++++|+.|.++||-...+.+..-+.
T Consensus       180 ~h~p~~i~av~l~~~l~nssgp~~~~~~~~a~d  212 (238)
T COG5660         180 AHLPVIIGAVLLIIVLRNSSGPRPARDDAVAID  212 (238)
T ss_pred             hcccHHHHHHHHhhhhhccCCCCcccchhhhcC
Confidence            567899999999999999998755444444443


No 176
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=40.08  E-value=25  Score=20.74  Aligned_cols=33  Identities=24%  Similarity=0.456  Sum_probs=22.3

Q ss_pred             eEEeecCCeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           42 HITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      .++.. |+.+.+.|...  .+.|.| .|.|.+++...
T Consensus         9 ~~~~~-~~~~~~~C~s~--~~~P~~-~i~W~~~~~~~   41 (89)
T PF08205_consen    9 LLEGE-GEEVTLTCSSS--GGYPPP-QITWYLDGGPV   41 (89)
T ss_dssp             EEESS-TEEEEEEEEEE--EEBS-E-EEEEEETTCEE
T ss_pred             eEccc-ceEEEEEEEeC--CeECCe-EEEEEECCCce
Confidence            44444 89999999854  244544 68999988653


No 177
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=40.06  E-value=27  Score=18.74  Aligned_cols=19  Identities=21%  Similarity=0.518  Sum_probs=16.1

Q ss_pred             EEEeeecCCCCCCCCceEEEee
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWE   72 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~   72 (80)
                      +.|.|.+..+..   +..++|.
T Consensus        18 ~~l~C~~~~~~~---~~~~~W~   36 (75)
T PF13927_consen   18 VTLTCSAEGGPP---PPSISWY   36 (75)
T ss_dssp             EEEEEEESSEES---SEEEEEE
T ss_pred             EEEEEEEccccC---CeEEEEE
Confidence            999999987633   7889999


No 178
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig2_Necl-1: second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myel
Probab=39.20  E-value=44  Score=20.39  Aligned_cols=24  Identities=21%  Similarity=0.562  Sum_probs=16.5

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +.|.|.+  ....|.+ -|-|.|+|++
T Consensus         2 ~~LtC~a--~g~~P~~-~ItW~k~g~~   25 (83)
T cd07705           2 AKLRCTS--SGSKPAA-NIKWRKGDQE   25 (83)
T ss_pred             EEEEEEe--cCccCCC-EeEEEECCEE
Confidence            4677877  2334555 6899999875


No 179
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=38.84  E-value=45  Score=21.15  Aligned_cols=25  Identities=16%  Similarity=0.276  Sum_probs=17.6

Q ss_pred             EEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      |.|.|--.   +.-||=.+.|.|+|++-
T Consensus         2 ~~L~C~s~---~skP~a~i~W~k~~~~l   26 (80)
T cd05885           2 VELTCLSP---RSKPAATLRWYRDRKEL   26 (80)
T ss_pred             EEEEEeCC---CccCCCeEEEEECCEEC
Confidence            67888653   44455669999998763


No 180
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=37.38  E-value=28  Score=22.10  Aligned_cols=27  Identities=19%  Similarity=0.457  Sum_probs=20.4

Q ss_pred             cCCeEEEeeecC--CCCCCCCceEEEeeecccc
Q psy531           47 LGESVVFNCGVD--FPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        47 vGe~VVlnCdvd--fP~~~PiPYVvqW~KdG~~   77 (80)
                      -|+.+.|.|.+.  ||.+    --|.|.|+|++
T Consensus        16 ~~~~~~L~C~~~gfyP~~----i~v~W~~~g~~   44 (100)
T cd07699          16 KSGKATLVCLINDFYPGF----ATVQWKVDGAT   44 (100)
T ss_pred             cCCCcEEEEEEEeEECCC----CEEEEEECCEE
Confidence            357799999986  5533    35999999876


No 181
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig2_Necl-3: second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons.  It is observed at the interface between the axon shaft and the myelin sheath. Ig domains are likely to participate in ligand binding and recognition.
Probab=36.99  E-value=47  Score=20.48  Aligned_cols=24  Identities=13%  Similarity=0.310  Sum_probs=16.4

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      |.|-|.+.   |.-|+=-|.|.|+|..
T Consensus         2 ~~LtC~a~---gf~P~~~itW~kng~~   25 (83)
T cd05884           2 MQLTCKTS---GSKPAADIRWFKNDKE   25 (83)
T ss_pred             EEEEEEeC---CccCCCEEEEEECCEE
Confidence            56778872   3333466899999875


No 182
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=36.54  E-value=62  Score=20.16  Aligned_cols=25  Identities=8%  Similarity=0.266  Sum_probs=16.7

Q ss_pred             eEEEeeecCCCCCCCCceEEEeeecc
Q psy531           50 SVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        50 ~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      .|.|.|.+....+ +...-|.|.|..
T Consensus         2 ~v~L~C~~~~~~~-~~~~~v~W~k~~   26 (100)
T cd05888           2 DTRLPCRYNVSDG-ETVVQVLWIREN   26 (100)
T ss_pred             CEEEEeEEecCCC-CcEEEEEEEEcc
Confidence            5889999864322 334568899864


No 183
>PRK15315 outer membrane protein RatA; Provisional
Probab=35.44  E-value=35  Score=33.54  Aligned_cols=42  Identities=26%  Similarity=0.346  Sum_probs=29.5

Q ss_pred             HhhccCCCCCCCCcce-------EEeecCCeEEEeeec-CCCCCCCCceE
Q psy531           27 LVHFKGVSPDISNAVH-------ITALLGESVVFNCGV-DFPGDTPVPYV   68 (80)
Q Consensus        27 l~~~sg~~g~~~~P~~-------ltA~vGe~VVlnCdv-dfP~~~PiPYV   68 (80)
                      +++|+|-....-+|..       ..|||||++.|.-.+ +--.+.|+||-
T Consensus       456 ~vSC~~k~~~~v~~~~~~s~~~~akakVGe~i~m~~~~~~~~n~~plpy~  505 (1865)
T PRK15315        456 LVSCVDKAQPAAHPQITLSPQGPYKAQVGESIDLTMTVVDRDTQKPLPYR  505 (1865)
T ss_pred             EEEecCCCCCccccceeecCCcccceecCceEEEEEEEEccCCCCcccce
Confidence            4566665333333333       459999999999987 65589999985


No 184
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=34.45  E-value=23  Score=20.63  Aligned_cols=19  Identities=26%  Similarity=0.574  Sum_probs=12.6

Q ss_pred             EEEeeecCCCCCCCCceEEEee
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWE   72 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~   72 (80)
                      |.|.|.++   |.|.|.+-=..
T Consensus         1 v~l~C~~~---G~P~P~v~W~~   19 (79)
T cd05734           1 VTLNCSAE---GYPPPTIVWKH   19 (79)
T ss_pred             CEeEeeCe---EeCCCEEEEEE
Confidence            57899875   66777655444


No 185
>TIGR02657 amicyanin amicyanin. Members of this family are amicyanin, a type I blue copper protein that accepts electrons from the tryptophan tryptophylquinone (TTQ) cofactor of the methylamine dehydrogenase light chain and then transfers them to the heme group of cytochrome c-551i. Amicyanin, methylamine dehydrogenase, and cytochrome c-551i are periplasmic and form a complex. This system has been studied primarily in Paracoccus denitrificans and Methylobacterium extorquens. Related type I blue copper proteins include plastocyanin, pseudoazurin, halocyanin, etc.
Probab=33.82  E-value=39  Score=20.70  Aligned_cols=18  Identities=11%  Similarity=0.250  Sum_probs=15.5

Q ss_pred             CCCcceEEeecCCeEEEe
Q psy531           37 ISNAVHITALLGESVVFN   54 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVln   54 (80)
                      .=+|..+++++|+.|.+.
T Consensus         7 ~F~P~~i~v~~GdtVt~~   24 (83)
T TIGR02657         7 KYETPELHVKVGDTVTWI   24 (83)
T ss_pred             EEcCCEEEECCCCEEEEE
Confidence            347899999999999986


No 186
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=33.07  E-value=70  Score=22.14  Aligned_cols=32  Identities=13%  Similarity=0.168  Sum_probs=23.1

Q ss_pred             EEeecCCeEEEeeecCCCCCCCCceEEEeeecc
Q psy531           43 ITALLGESVVFNCGVDFPGDTPVPYVLQWEKKI   75 (80)
Q Consensus        43 ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG   75 (80)
                      +..+.|++|-|.|....+. ..==|-++|.|+-
T Consensus         8 ~lv~p~~sv~LsC~~sg~~-~s~e~~~~wvRq~   39 (115)
T cd05721           8 VLASSNGAASLVCEYTYNG-FSKEFRASLLKGA   39 (115)
T ss_pred             eEEcCCCCEEEEEEecCCc-cccEEEEEEEEeC
Confidence            4478899999999886552 1112789999974


No 187
>PRK15249 fimbrial chaperone protein StbB; Provisional
Probab=32.49  E-value=1.1e+02  Score=22.94  Aligned_cols=52  Identities=19%  Similarity=0.278  Sum_probs=27.1

Q ss_pred             HHHHHHHHHhhccCCCCCCCCcceEE---eecCCeEEEeeecCCCCCCCCceEEE-eeeccc
Q psy531           19 LQVLLIITLVHFKGVSPDISNAVHIT---ALLGESVVFNCGVDFPGDTPVPYVLQ-WEKKIV   76 (80)
Q Consensus        19 ~~~ll~i~l~~~sg~~g~~~~P~~lt---A~vGe~VVlnCdvdfP~~~PiPYVvq-W~KdG~   76 (80)
                      +++|++.++.+++...+...+|.++.   ..-+.++-+.      +...-||.+| |..++.
T Consensus        13 ~~~~~~~~~~~~~a~A~l~l~~TRviy~~~~~~~sl~l~------N~~~~p~LvQsWv~~~~   68 (253)
T PRK15249         13 LIVFLFLALPATASWASVTILGSRIIYPSTASSVDVQLK------NNDAIPYIVQTWFDDGD   68 (253)
T ss_pred             HHHHHHHHhhhHhheeEEEeCceEEEEeCCCcceeEEEE------cCCCCcEEEEEEEeCCC
Confidence            34555555555444455556666654   2333445442      2223478887 875554


No 188
>KOG4194|consensus
Probab=31.12  E-value=52  Score=30.00  Aligned_cols=33  Identities=24%  Similarity=0.422  Sum_probs=24.0

Q ss_pred             eEEeecCCeEEEeeecCCCCCCCCceEEEeeecccc
Q psy531           42 HITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +.+-.+||.++|-|--+--   |.--.++|+|+.++
T Consensus       715 ~~~V~~get~vlqC~a~~~---~a~pr~~W~k~d~p  747 (873)
T KOG4194|consen  715 DQLVVVGETLVLQCLAEGA---PADPRLEWFKEDKP  747 (873)
T ss_pred             ceEEEecceEEEEEecCCC---CCCccccccCCCCc
Confidence            3567899999999986643   33123799999875


No 189
>KOG3513|consensus
Probab=29.65  E-value=74  Score=29.64  Aligned_cols=38  Identities=21%  Similarity=0.391  Sum_probs=31.5

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      -+.|+..++..||.|.|-|-..   |.|-|- +.|.|.|.+-
T Consensus       335 ~~~~~d~~~~~gs~v~~eC~a~---g~P~p~-v~WlkNg~pl  372 (1051)
T KOG3513|consen  335 LQKPQDTEADTGSNVTLECKAS---GKPNPT-VKWLKNGEPL  372 (1051)
T ss_pred             hcccceeEecCCCCeEEEEEec---CCCCCc-eEEeeCCeec
Confidence            3478889999999999999986   666665 6999999764


No 190
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=29.31  E-value=61  Score=20.78  Aligned_cols=29  Identities=14%  Similarity=0.313  Sum_probs=20.9

Q ss_pred             EEeecCCeEEEeeecCCCCCCCCceEEEee
Q psy531           43 ITALLGESVVFNCGVDFPGDTPVPYVLQWE   72 (80)
Q Consensus        43 ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~   72 (80)
                      ++-..++.-.+.|.|+|. +.+-|-++.|+
T Consensus        65 l~~~~~~~~~ysC~V~H~-~l~~p~~~~we   93 (93)
T cd05770          65 TEFTPTKGDEYACRVRHN-SMSEPKKYKWD   93 (93)
T ss_pred             EEECCCCCCeEEEEEEEC-CCCCCEEEeCC
Confidence            444567777899999997 44456677884


No 191
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated. Members of this protein family are exclusive to the Bacteroidetes phylum (previously Cytophaga-Flavobacteria-Bacteroides). GldI is a FKBP-type peptidyl-prolyl cis-trans isomerase (pfam00254) linked to a type of rapid surface gliding motility found in certain Bacteroidetes, such as Flavobacterium johnsoniae and Cytophaga hutchinsonii. Knockout of this gene abolishes the gliding phenotype. Gliding motility appears closely linked to chitin utilization in the model species Flavobacterium johnsoniae. This family is only found in Bacteroidetes containing the suite of genes proposed to confer the gliding motility phenotype.
Probab=29.03  E-value=48  Score=23.76  Aligned_cols=24  Identities=25%  Similarity=0.487  Sum_probs=12.5

Q ss_pred             HHHHHHHHHHHhhccCCCCCCCCcceE
Q psy531           17 ISLQVLLIITLVHFKGVSPDISNAVHI   43 (80)
Q Consensus        17 ~~~~~ll~i~l~~~sg~~g~~~~P~~l   43 (80)
                      |++++++ +++.+|+  ..+.++|+-.
T Consensus         5 ~~~~~~~-~~~~~c~--~~~~~~pv~~   28 (177)
T TIGR03516         5 IAVILLL-LLLLGCK--TPEARRPISR   28 (177)
T ss_pred             HHHHHHH-HHHhhcC--CCCCCCCcCC
Confidence            3444433 4444554  5567777653


No 192
>PF15092 UPF0728:  Uncharacterised protein family UPF0728
Probab=28.95  E-value=55  Score=22.32  Aligned_cols=22  Identities=14%  Similarity=0.335  Sum_probs=17.7

Q ss_pred             CcceEEeecCCeEEEeeecCCC
Q psy531           39 NAVHITALLGESVVFNCGVDFP   60 (80)
Q Consensus        39 ~P~~ltA~vGe~VVlnCdvdfP   60 (80)
                      +=+.++-.+++.+||+|++.+-
T Consensus        48 d~n~vel~vnge~VF~CnI~~L   69 (88)
T PF15092_consen   48 DWNVVELVVNGEIVFQCNITDL   69 (88)
T ss_pred             cccEEEEEECCeEEEEeCCcee
Confidence            3345778999999999998765


No 193
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=28.39  E-value=66  Score=21.81  Aligned_cols=27  Identities=26%  Similarity=0.400  Sum_probs=19.7

Q ss_pred             eecCCeEEEeeecC--CCCCCCCceEEEeeec
Q psy531           45 ALLGESVVFNCGVD--FPGDTPVPYVLQWEKK   74 (80)
Q Consensus        45 A~vGe~VVlnCdvd--fP~~~PiPYVvqW~Kd   74 (80)
                      ..+|+.|.+.|.+.  +|.++   -.|.|.|-
T Consensus        12 l~~G~~vtv~C~v~~v~P~~~---l~v~LlkG   40 (99)
T cd07689          12 LEEGKPVTVKCEVPDVYPFDR---LEIELLKG   40 (99)
T ss_pred             ccCCceEEEEEEecCcccCCc---eEEEEecC
Confidence            47899999999996  55444   34788763


No 194
>TIGR03352 VI_chp_3 type VI secretion lipoprotein, VC_A0113 family. Work by Mougous, et al. (2006), describes IAHP-related loci as a type VI secretion system (PubMed:16763151). This protein family is associated with type VI secretion loci, although not treated explicitly by Mougous, et al.
Probab=28.26  E-value=1.5e+02  Score=20.60  Aligned_cols=47  Identities=13%  Similarity=0.150  Sum_probs=22.2

Q ss_pred             HHHHHHHHHHhhccCCCCCCCCcce--EEeecCCeEEEeeecCCCCCCCCceEEE
Q psy531           18 SLQVLLIITLVHFKGVSPDISNAVH--ITALLGESVVFNCGVDFPGDTPVPYVLQ   70 (80)
Q Consensus        18 ~~~~ll~i~l~~~sg~~g~~~~P~~--ltA~vGe~VVlnCdvdfP~~~PiPYVvq   70 (80)
                      ++.+++|++|..|+.... ..+|..  ++-.++..  +|   ....|+|-|-+|.
T Consensus         4 ~~~l~~~llL~gC~s~~~-~~~~~~v~l~i~a~~~--lN---p~~~g~p~Pvvvr   52 (146)
T TIGR03352         4 AVLLAACLLLAGCSSAPP-PKEPTYVTLTLTAAPD--VN---PDEDGRASPVVVR   52 (146)
T ss_pred             HHHHHHHHHHhhccCCCC-CCCCeEEEEEEEecCC--cC---CCCCCCccCeEEE
Confidence            345566667766664432 234433  33222222  22   1234677776664


No 195
>TIGR02656 cyanin_plasto plastocyanin. Members of this family are plastocyanin, a blue copper protein related to pseudoazurin, halocyanin, amicyanin, etc. This protein, located in the thylakoid luman, performs electron transport to photosystem I in Cyanobacteria and chloroplasts.
Probab=28.18  E-value=52  Score=20.80  Aligned_cols=18  Identities=17%  Similarity=0.338  Sum_probs=16.0

Q ss_pred             CCCcceEEeecCCeEEEe
Q psy531           37 ISNAVHITALLGESVVFN   54 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVln   54 (80)
                      .=+|..++.++|+.|.|-
T Consensus        13 ~F~P~~i~v~~G~~V~~~   30 (99)
T TIGR02656        13 VFEPAKISIAAGDTVEWV   30 (99)
T ss_pred             eEeCCEEEECCCCEEEEE
Confidence            458999999999999987


No 196
>TIGR03042 PS_II_psbQ_bact photosystem II protein PsbQ. This protein through the member sll1638 from Synechocystis sp. PCC 6803, was shown to be part of the cyanobacteria photosystem II. It is homologous to (but quite diverged from) the chloroplast PsbQ protein, called oxygen-evolving enhancer protein 3 (OEE3). We designate this cyanobacteria protein PsbQ by homology.
Probab=27.84  E-value=74  Score=22.90  Aligned_cols=21  Identities=33%  Similarity=0.463  Sum_probs=14.5

Q ss_pred             hhHHHHHHHHHHHHhhccCCCC
Q psy531           14 LHHISLQVLLIITLVHFKGVSP   35 (80)
Q Consensus        14 ~~~~~~~~ll~i~l~~~sg~~g   35 (80)
                      +-++.+++++|+ |++|+|-..
T Consensus         4 ~~s~~Lv~~~~~-Lvsc~~p~~   24 (142)
T TIGR03042         4 LASLLLVLLLTF-LVSCSGPAA   24 (142)
T ss_pred             HHHHHHHHHHHH-HHHcCCCcc
Confidence            345667777777 889887544


No 197
>KOG4222|consensus
Probab=27.64  E-value=59  Score=31.00  Aligned_cols=39  Identities=28%  Similarity=0.508  Sum_probs=30.6

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccccc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKN   78 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~   78 (80)
                      +.+|-.+.|-+||.++|-|-  -|.++|-|- |-|.|||++-
T Consensus       135 rv~prd~~~a~ge~avlEcg--pP~ghpept-vSw~Kdg~pl  173 (1281)
T KOG4222|consen  135 RVSPRDVQAAVGEEAVLECG--PPRGHPEPT-VSWVKDGKPL  173 (1281)
T ss_pred             ccCcccccccccceeEEecc--CCCCCCCCc-ceeecCCCcc
Confidence            44777788999999999996  456666654 7899999763


No 198
>KOG3515|consensus
Probab=27.47  E-value=53  Score=29.36  Aligned_cols=30  Identities=27%  Similarity=0.490  Sum_probs=25.9

Q ss_pred             EeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           44 TALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        44 tA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      -++.||.|-|.|++   .+.|++--+||.+-+.
T Consensus        18 ~~~~g~~v~l~C~v---~~~pp~~~~eW~h~~~   47 (741)
T KOG3515|consen   18 GLRLGEDVPLPCRV---NSNPPEIDVEWYHSTS   47 (741)
T ss_pred             hhccCCcceeeeec---CCCCCCcceEEEecCc
Confidence            57999999999998   4788889999998654


No 199
>PRK02710 plastocyanin; Provisional
Probab=27.03  E-value=1.2e+02  Score=19.86  Aligned_cols=16  Identities=19%  Similarity=0.314  Sum_probs=14.2

Q ss_pred             CcceEEeecCCeEEEe
Q psy531           39 NAVHITALLGESVVFN   54 (80)
Q Consensus        39 ~P~~ltA~vGe~VVln   54 (80)
                      +|..+++++|+.|.|.
T Consensus        45 ~P~~i~v~~Gd~V~~~   60 (119)
T PRK02710         45 EPSTLTIKAGDTVKWV   60 (119)
T ss_pred             eCCEEEEcCCCEEEEE
Confidence            7888999999999885


No 200
>TIGR02375 pseudoazurin pseudoazurin. Pseudoazurin, also called cupredoxin, is a small, blue periplasmic protein with a single bound copper atom. Pseudoazurin is related plastocyanins. Several examples of pseudoazurin are encoded by a neighboring gene for, or have been shown to transfer electrons to, copper-containing nitrite reductases (TIGR02376) of the same species.
Probab=26.74  E-value=54  Score=22.26  Aligned_cols=18  Identities=28%  Similarity=0.392  Sum_probs=15.9

Q ss_pred             CCCcceEEeecCCeEEEe
Q psy531           37 ISNAVHITALLGESVVFN   54 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVln   54 (80)
                      .=+|..++.++|+.|.|-
T Consensus        11 ~F~P~~v~V~~GdTV~f~   28 (116)
T TIGR02375        11 VFEPAYIRAAPGDTVTFV   28 (116)
T ss_pred             EEeCCEEEECCCCEEEEE
Confidence            458999999999999984


No 201
>KOG3073|consensus
Probab=26.52  E-value=25  Score=27.67  Aligned_cols=13  Identities=31%  Similarity=0.432  Sum_probs=12.0

Q ss_pred             EeecCCeEEEeee
Q psy531           44 TALLGESVVFNCG   56 (80)
Q Consensus        44 tA~vGe~VVlnCd   56 (80)
                      ++|+|.|++||||
T Consensus        44 ~~Kvg~y~ll~~d   56 (236)
T KOG3073|consen   44 TAKVGKYQLLNSD   56 (236)
T ss_pred             hhhhhheeeeccc
Confidence            5899999999998


No 202
>TIGR02408 ectoine_ThpD ectoine hydroxylase. Both ectoine and hydroxyectoine are compatible solvents that serve as protectants against osmotic and thermal stresses. A number of genomes synthesize ectoine. This enzyme allows conversion of ectoine to hydroxyectoine, which may be more effective for some purposes, and is found in a subset of ectoine-producing organisms.
Probab=25.91  E-value=44  Score=24.80  Aligned_cols=19  Identities=26%  Similarity=0.448  Sum_probs=17.0

Q ss_pred             eEEeecCCeEEEeeecCCC
Q psy531           42 HITALLGESVVFNCGVDFP   60 (80)
Q Consensus        42 ~ltA~vGe~VVlnCdvdfP   60 (80)
                      .+++++|+-++|+|.+-|-
T Consensus       212 ~~~~~aGDvl~f~~~~~H~  230 (277)
T TIGR02408       212 TFTGKAGSAVWFDCNTMHG  230 (277)
T ss_pred             eeccCCceEEEEccccccC
Confidence            4678999999999999886


No 203
>PF15284 PAGK:  Phage-encoded virulence factor
Probab=24.91  E-value=37  Score=21.78  Aligned_cols=12  Identities=33%  Similarity=0.930  Sum_probs=9.9

Q ss_pred             eeecCCCCCCCCc
Q psy531           54 NCGVDFPGDTPVP   66 (80)
Q Consensus        54 nCdvdfP~~~PiP   66 (80)
                      =|+ -+|.|.|+|
T Consensus        42 wC~-lwP~g~~iP   53 (61)
T PF15284_consen   42 WCD-LWPAGIPIP   53 (61)
T ss_pred             HHh-cCCCCCCCC
Confidence            699 569999887


No 204
>PF07172 GRP:  Glycine rich protein family;  InterPro: IPR010800 This family consists of glycine rich proteins. Some of them may be involved in resistance to environmental stress [].
Probab=24.51  E-value=35  Score=22.66  Aligned_cols=8  Identities=13%  Similarity=0.152  Sum_probs=3.3

Q ss_pred             HHHHHhhc
Q psy531           23 LIITLVHF   30 (80)
Q Consensus        23 l~i~l~~~   30 (80)
                      ++++|+++
T Consensus        14 A~lLlisS   21 (95)
T PF07172_consen   14 AALLLISS   21 (95)
T ss_pred             HHHHHHHh
Confidence            33444443


No 205
>KOG4194|consensus
Probab=24.47  E-value=55  Score=29.88  Aligned_cols=38  Identities=24%  Similarity=0.614  Sum_probs=31.8

Q ss_pred             CCCcceEEeecCCeEEEeeecCCCCCCCCceEEEeeeccc
Q psy531           37 ISNAVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        37 ~~~P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      .++|+-+-|-.|+.+-|-|...-|..+  |--++|-||..
T Consensus       507 ~~qPe~~~al~g~nirftC~a~sssas--plsi~WR~dne  544 (873)
T KOG4194|consen  507 VTQPETVSALIGENIRFTCNAYSSSAS--PLSIEWRKDNE  544 (873)
T ss_pred             ecCchHhhhhhccceEEEEEeccCCCC--CceeEeeeccc
Confidence            447777779999999999999999777  55789999864


No 206
>PF11153 DUF2931:  Protein of unknown function (DUF2931);  InterPro: IPR021326  Some members in this family of proteins are annotated as lipoproteins however this cannot be confirmed. Currently, there is no known function. 
Probab=23.22  E-value=99  Score=22.14  Aligned_cols=18  Identities=22%  Similarity=0.239  Sum_probs=11.2

Q ss_pred             HHHHHHHHHHhhccCCCC
Q psy531           18 SLQVLLIITLVHFKGVSP   35 (80)
Q Consensus        18 ~~~~ll~i~l~~~sg~~g   35 (80)
                      .+.+++|++|.+|+....
T Consensus         4 i~~l~l~lll~~C~~~~~   21 (216)
T PF11153_consen    4 ILLLLLLLLLTGCSTNPN   21 (216)
T ss_pred             HHHHHHHHHHHhhcCCCc
Confidence            344556677777776544


No 207
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=23.12  E-value=1.2e+02  Score=19.42  Aligned_cols=24  Identities=17%  Similarity=0.346  Sum_probs=17.2

Q ss_pred             EEEeeecCCCCCCCCceEEEeeecccc
Q psy531           51 VVFNCGVDFPGDTPVPYVLQWEKKIVK   77 (80)
Q Consensus        51 VVlnCdvdfP~~~PiPYVvqW~KdG~~   77 (80)
                      +.|.|...   |+-|+=.+.|.|+|++
T Consensus         2 ~~L~C~s~---gSkP~A~I~W~k~~~~   25 (82)
T cd05883           2 IELNCTAM---ASKPAATIRWFKGNKE   25 (82)
T ss_pred             EEEEEEec---CCCCCCEEEEEECCEE
Confidence            56778764   5556667899999865


No 208
>PF00084 Sushi:  Sushi domain (SCR repeat);  InterPro: IPR000436 Sushi domains are also known as Complement control protein (CCP) modules, or short consensus repeats (SCR), exist in a wide variety of complement and adhesion proteins. The structure is known for this domain, it is based on a beta-sandwich arrangement; one face made up of three beta-strands hydrogen-bonded to form a triple-stranded region at its centre and the other face formed from two separate beta-strands []. CD21 (also called C3d receptor, CR2, Epstein Barr virus receptor or EBV-R) is the receptor for EBV and for C3d, C3dg and iC3b. Complement components may activate B cells through CD21. CD21 is part of a large signal-transduction complex that also involves CD19, CD81, and Leu13.  Some of the proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane. Most of these markers are proteins, but some are carbohydrates attached to lipids or proteins [Reid M.E., Lomas-Francis C. The Blood Group Antigen FactsBook Academic Press, London / San Diego, (1997)]. Complement decay-accelerating factor (Antigen CD55) belongs to the Cromer blood group system and is associated with Cr(a), Dr(a), Es(a), Tc(a/b/c), Wd(a), WES(a/b), IFC and UMC antigens. Complement receptor type 1 (C3b/C4b receptor) (Antigen CD35) belongs to the Knops blood group system and is associated with Kn(a/b), McC(a), Sl(a) and Yk(a) antigens. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; PDB: 1HFH_A 1HFI_A 1E5G_A 2UWN_A 2V8E_A 2XWB_H 3HS0_I 2OK5_A 2XWJ_J 3HRZ_D ....
Probab=22.59  E-value=52  Score=17.49  Aligned_cols=16  Identities=25%  Similarity=0.627  Sum_probs=13.2

Q ss_pred             eecCCeEEEeeecCCC
Q psy531           45 ALLGESVVFNCGVDFP   60 (80)
Q Consensus        45 A~vGe~VVlnCdvdfP   60 (80)
                      -..|+.|.|.|+--|=
T Consensus        19 ~~~g~~~~~~C~~Gy~   34 (56)
T PF00084_consen   19 YSYGSTVTFSCNPGYE   34 (56)
T ss_dssp             EETTEEEEEEESTTEE
T ss_pred             ccCCCEEEEcCCCCCE
Confidence            5789999999987664


No 209
>KOG4222|consensus
Probab=22.49  E-value=55  Score=31.19  Aligned_cols=36  Identities=22%  Similarity=0.421  Sum_probs=26.5

Q ss_pred             cceEEeecCCeEEEeeecCCCCCCCCceEEEeeecccccC
Q psy531           40 AVHITALLGESVVFNCGVDFPGDTPVPYVLQWEKKIVKNN   79 (80)
Q Consensus        40 P~~ltA~vGe~VVlnCdvdfP~~~PiPYVvqW~KdG~~~~   79 (80)
                      |..+--+-||-+-|||...   |+|+|- +||.|+|..+.
T Consensus        38 p~d~vvs~~~patlnc~as---G~ppPt-i~w~k~G~~~~   73 (1281)
T KOG4222|consen   38 PHDLVVSKGEPATLNCKAS---GDPPPT-IEWYKDGENVF   73 (1281)
T ss_pred             chhhhccCCCCceeecCCC---CCCCCc-eecccCCcccC
Confidence            3344478899999999764   665554 79999997554


No 210
>COG1952 SecB Preprotein translocase subunit SecB [Intracellular trafficking and secretion]
Probab=21.37  E-value=69  Score=23.74  Aligned_cols=18  Identities=44%  Similarity=0.685  Sum_probs=15.7

Q ss_pred             EEeecCCeEEEeeecCCC
Q psy531           43 ITALLGESVVFNCGVDFP   60 (80)
Q Consensus        43 ltA~vGe~VVlnCdvdfP   60 (80)
                      +|||.|+.+.|.|.|.+-
T Consensus        66 v~ak~~~~~~F~~Ev~qa   83 (157)
T COG1952          66 VTAKLGEKTAFLCEVQQA   83 (157)
T ss_pred             EEEEcCCeeEEEEEEEEe
Confidence            569999999999999764


No 211
>PF14509 GH97_C:  Glycosyl-hydrolase 97 C-terminal, oligomerisation; PDB: 3A24_A 2JKP_A 2JKE_A 2D73_B 2ZQ0_B 2JKA_A.
Probab=20.59  E-value=75  Score=21.12  Aligned_cols=23  Identities=9%  Similarity=-0.012  Sum_probs=10.0

Q ss_pred             EeeecCCCCCCCCceEEEeeeccc
Q psy531           53 FNCGVDFPGDTPVPYVLQWEKKIV   76 (80)
Q Consensus        53 lnCdvdfP~~~PiPYVvqW~KdG~   76 (80)
                      +..+++|-... ..|.++=.+||.
T Consensus        42 i~l~L~FL~~g-~~y~a~i~~D~~   64 (103)
T PF14509_consen   42 ITLPLSFLDKG-KKYTATIYTDGP   64 (103)
T ss_dssp             EEEEGCCS-TT---EEEEEEEE-T
T ss_pred             EEEECcccCCC-CcEEEEEEEeCC
Confidence            44555665311 235555555554


No 212
>COG5510 Predicted small secreted protein [Function unknown]
Probab=20.20  E-value=85  Score=19.03  Aligned_cols=23  Identities=17%  Similarity=0.118  Sum_probs=15.1

Q ss_pred             HHHHHHHHHHHhhccCCCCCCCC
Q psy531           17 ISLQVLLIITLVHFKGVSPDISN   39 (80)
Q Consensus        17 ~~~~~ll~i~l~~~sg~~g~~~~   39 (80)
                      |++.++.+.+|-.|-...|..+|
T Consensus         9 i~~vll~s~llaaCNT~rG~G~D   31 (44)
T COG5510           9 IALVLLASTLLAACNTMRGAGKD   31 (44)
T ss_pred             HHHHHHHHHHHHHhhhhhccchh
Confidence            67777888888777555554433


No 213
>PF13623 SurA_N_2:  SurA N-terminal domain
Probab=20.07  E-value=2.3e+02  Score=19.82  Aligned_cols=34  Identities=15%  Similarity=-0.018  Sum_probs=15.8

Q ss_pred             HHHHHHHHHHHhhccCCCCCCCCcceEEeecCCeE
Q psy531           17 ISLQVLLIITLVHFKGVSPDISNAVHITALLGESV   51 (80)
Q Consensus        17 ~~~~~ll~i~l~~~sg~~g~~~~P~~ltA~vGe~V   51 (80)
                      |+++||+.|+=-..++...-..++..+ |++.+.-
T Consensus        15 IglAL~aFIv~d~~~~~~~~~~~~~~V-G~VnGe~   48 (145)
T PF13623_consen   15 IGLALFAFIVGDFRSGSGFFGSSQNVV-GEVNGEK   48 (145)
T ss_pred             HHHHHHHHHHHHHhccCCCcCCCCCee-EeECCEE
Confidence            556666655422223222223445555 6665543


Done!