Diaphorina citri psyllid: psy5323


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110
ELQGKLDYYIQTRLPPKVRLIRLKERAGLIRARIAGAENAKGDVLMFLDSHYELQGKLDYYIQTRLPPKVRLIRLKERAGLIRARIAGAENAKGDVLMFLDSHCELGTNW
cHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHHHHHccccEEEEEEccccccccHHHHHHHcccccEEEEEcccEEHHHHHHHHHHHHccccEEEEEEccEEEcccc
ELQGKLDYYIQTRLPPKVRLIRLKERAGLIRARIAGAENAKGDVLMFLDSHYELQGKLDYYIQTRLPPKVRLIRLKERAGLIRARIAGAENAKGDVLMFLDSHCELGTNW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ELQGKLDYYIQTRLPPKVRLIRLKERAGLIRARIAGAENAKGDVLMFLDSHYELQGKLDYYIQTRLPPKVRLIRLKERAGLIRARIAGAENAKGDVLMFLDSHCELGTNW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Polypeptide N-acetylgalactosaminyltransferase 11 Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays the same enzyme activity toward Muc1, Muc4.1, and EA2 than GALNT1. Does not appear to be involved in glycosylation of erythropoietin.confidentQ6P6V1
Polypeptide N-acetylgalactosaminyltransferase 11 Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. Displays the same enzyme activity toward Muc1, Muc4.1, and EA2 than GALNT1. Does not appear to be involved in glycosylation of erythropoietin.confidentQ921L8
Polypeptide N-acetylgalactosaminyltransferase 1 Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis, the transfer of an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor. It can both act as a peptide transferase that transfers GalNAc onto unmodified peptide substrates, and as a glycopeptide transferase that requires the prior addition of a GalNAc on a peptide before adding additional GalNAc moieties. Prefers the monoglycosylated Muc5AC-3 as substrate.confidentQ6WV20

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008376 [MF]acetylgalactosaminyltransferase activityprobableGO:0003824, GO:0016740, GO:0003674, GO:0016757, GO:0016758, GO:0008194
GO:0009312 [BP]oligosaccharide biosynthetic processprobableGO:1901576, GO:0005975, GO:0044238, GO:0009311, GO:0016051, GO:0071704, GO:0009058, GO:0008150, GO:0008152, GO:0044723

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2D7I, chain A
Confidence level:very confident
Coverage over the Query: 13-110
View the alignment between query and template
View the model in PyMOL