Query         psy534
Match_columns 145
No_of_seqs    124 out of 1174
Neff          9.5 
Searched_HMMs 46136
Date          Sat Aug 17 00:04:08 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy534.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/534hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3513|consensus               99.7 1.4E-16   3E-21  130.8  13.7  125    8-140   343-519 (1051)
  2 KOG3513|consensus               99.6 1.4E-14   3E-19  119.3  13.3  120    8-137   253-423 (1051)
  3 PHA02826 IL-1 receptor-like pr  99.5 8.8E-13 1.9E-17   94.1  11.1  127    8-134    34-218 (227)
  4 PHA02785 IL-beta-binding prote  99.4 9.6E-12 2.1E-16   93.3  11.1  112   12-134   137-321 (326)
  5 KOG4221|consensus               99.4 1.7E-11 3.8E-16  101.8  12.8  119   11-138   155-329 (1381)
  6 PHA02785 IL-beta-binding prote  99.4 1.3E-11 2.8E-16   92.6  11.2  109   10-129    40-201 (326)
  7 KOG4194|consensus               99.3 2.1E-11 4.6E-16   95.8  10.4  115   10-129   626-785 (873)
  8 cd05892 Ig_Myotilin_C C-termin  99.3 1.7E-11 3.7E-16   73.0   6.8   62   15-80      2-63  (75)
  9 cd05763 Ig_1 Subgroup of the i  99.3 3.1E-11 6.8E-16   71.6   7.2   61   15-80      2-62  (75)
 10 cd05852 Ig5_Contactin-1 Fifth   99.3   2E-11 4.2E-16   72.3   6.2   60   12-80      2-61  (73)
 11 cd05867 Ig4_L1-CAM_like Fourth  99.3 2.3E-11 4.9E-16   72.5   6.3   61   12-79      2-62  (76)
 12 KOG4221|consensus               99.2   2E-11 4.3E-16  101.5   7.5  124    6-137   247-418 (1381)
 13 cd05894 Ig_C5_MyBP-C C5 immuno  99.2 2.8E-11   6E-16   73.9   6.0   69    7-80      6-74  (86)
 14 cd05745 Ig3_Peroxidasin Third   99.2 3.4E-11 7.5E-16   71.3   5.7   61   11-80      2-62  (74)
 15 cd05893 Ig_Palladin_C C-termin  99.2 3.5E-11 7.5E-16   71.6   5.7   63   14-80      1-63  (75)
 16 cd05738 Ig2_RPTP_IIa_LAR_like   99.2 4.8E-11   1E-15   70.7   6.3   59   15-80      2-60  (74)
 17 cd05734 Ig7_DSCAM Seventh immu  99.2   1E-10 2.2E-15   70.1   6.7   60   15-80      2-66  (79)
 18 cd05855 Ig_TrkB_d5 Fifth domai  99.2 1.2E-10 2.6E-15   69.9   6.8   63   16-80      3-66  (79)
 19 cd05876 Ig3_L1-CAM Third immun  99.2   6E-11 1.3E-15   69.8   5.3   58   14-80      1-58  (71)
 20 cd05746 Ig4_Peroxidasin Fourth  99.2 6.5E-11 1.4E-15   69.2   5.4   58   14-80      1-58  (69)
 21 cd05857 Ig2_FGFR Second immuno  99.2 1.9E-10 4.1E-15   69.7   7.7   67    9-80      7-73  (85)
 22 cd05744 Ig_Myotilin_C_like Imm  99.2 1.6E-10 3.5E-15   68.7   7.2   62   15-80      2-63  (75)
 23 cd05743 Ig_Perlecan_D2_like Im  99.2 1.6E-10 3.4E-15   69.2   7.0   63   12-80      2-64  (78)
 24 cd07702 Ig2_VEGFR-1 Second imm  99.2 4.2E-11 9.1E-16   70.7   4.4   57   15-80      2-58  (72)
 25 cd05851 Ig3_Contactin-1 Third   99.2 1.5E-10 3.3E-15   70.9   7.0   63    8-80     13-75  (88)
 26 cd04969 Ig5_Contactin_like Fif  99.2 9.9E-11 2.1E-15   69.1   6.0   60   12-80      2-61  (73)
 27 cd05863 Ig2_VEGFR-3 Second imm  99.2 4.8E-11   1E-15   69.5   4.4   52   15-80      2-53  (67)
 28 cd05760 Ig2_PTK7 Second immuno  99.2 1.6E-10 3.6E-15   69.0   6.7   59   15-80      2-60  (77)
 29 cd05723 Ig4_Neogenin Fourth im  99.1 1.4E-10 3.1E-15   68.2   6.0   58   14-80      2-59  (71)
 30 cd05748 Ig_Titin_like Immunogl  99.1 2.5E-10 5.3E-15   67.5   7.1   61   14-80      2-62  (74)
 31 cd05868 Ig4_NrCAM Fourth immun  99.1 1.5E-10 3.3E-15   69.0   6.0   62   12-80      2-63  (76)
 32 cd05750 Ig_Pro_neuregulin Immu  99.1   6E-10 1.3E-14   65.8   8.1   63   14-80      1-65  (75)
 33 cd04976 Ig2_VEGFR Second immun  99.1 1.2E-10 2.5E-15   68.6   5.0   55   15-79      2-56  (71)
 34 cd05725 Ig3_Robo Third immunog  99.1 2.6E-10 5.5E-15   66.6   6.4   56   15-80      2-57  (69)
 35 cd05870 Ig5_NCAM-2 Fifth immun  99.1   3E-10 6.5E-15   70.9   7.0   71    7-80     12-86  (98)
 36 cd05726 Ig4_Robo Fhird immunog  99.1 3.8E-10 8.3E-15   69.3   7.3   63   12-80      2-69  (90)
 37 cd05848 Ig1_Contactin-5 First   99.1 3.2E-10 6.8E-15   70.3   6.7   64    9-80     17-81  (94)
 38 cd04971 Ig_TrKABC_d5 Fifth dom  99.1 4.7E-10   1E-14   67.7   7.2   64   16-80      3-68  (81)
 39 cd05765 Ig_3 Subgroup of the i  99.1 4.4E-10 9.5E-15   67.4   7.1   63   12-80      2-69  (81)
 40 cd05864 Ig2_VEGFR-2 Second imm  99.1 1.4E-10   3E-15   68.1   4.7   55   15-80      2-56  (70)
 41 KOG4222|consensus               99.1 6.1E-10 1.3E-14   92.4   9.9  114    9-129    44-211 (1281)
 42 cd04978 Ig4_L1-NrCAM_like Four  99.1 2.9E-10 6.2E-15   67.4   6.0   62   12-80      2-63  (76)
 43 cd05740 Ig_CEACAM_D4 Fourth im  99.1 3.4E-10 7.4E-15   69.8   6.5   64    7-80     14-77  (91)
 44 cd04975 Ig4_SCFR_like Fourth i  99.1 1.5E-10 3.2E-15   72.8   4.7   75    3-80     10-87  (101)
 45 cd05713 Ig_MOG_like Immunoglob  99.1 6.9E-10 1.5E-14   69.3   7.7   66   14-79     18-86  (100)
 46 cd05732 Ig5_NCAM-1_like Fifth   99.1 7.6E-10 1.6E-14   68.5   7.5   70    8-80     13-84  (96)
 47 cd05869 Ig5_NCAM-1 Fifth immun  99.1 8.6E-10 1.9E-14   68.7   7.8   68   10-80     16-85  (97)
 48 cd04972 Ig_TrkABC_d4 Fourth do  99.1   6E-10 1.3E-14   68.4   6.6   67    8-80     12-78  (90)
 49 cd05733 Ig6_L1-CAM_like Sixth   99.1   1E-09 2.2E-14   65.5   7.2   60   15-80      2-65  (77)
 50 cd04974 Ig3_FGFR Third immunog  99.1 1.2E-09 2.5E-14   67.2   7.5   69   12-80      2-77  (90)
 51 cd05737 Ig_Myomesin_like_C C-t  99.0   8E-10 1.7E-14   68.2   6.5   69    7-80     12-80  (92)
 52 cd05902 Ig_Neurocan Immunoglob  99.0 6.2E-10 1.4E-14   70.9   6.2   66   14-79     23-93  (110)
 53 cd05849 Ig1_Contactin-1 First   99.0 5.7E-10 1.2E-14   69.1   5.7   63    9-80     17-80  (93)
 54 cd05736 Ig2_Follistatin_like S  99.0 1.1E-09 2.4E-14   65.0   6.6   60   15-80      2-61  (76)
 55 cd05850 Ig1_Contactin-2 First   99.0 9.6E-10 2.1E-14   68.1   6.5   62   11-80     19-81  (94)
 56 cd05856 Ig2_FGFRL1-like Second  99.0 5.1E-10 1.1E-14   67.1   5.1   65    8-80      6-70  (82)
 57 cd05866 Ig1_NCAM-2 First immun  99.0   1E-09 2.2E-14   67.8   6.5   67    8-80     12-78  (92)
 58 cd05865 Ig1_NCAM-1 First immun  99.0 2.3E-09   5E-14   66.8   8.0   69    8-80     12-82  (96)
 59 cd05730 Ig3_NCAM-1_like Third   99.0 6.3E-10 1.4E-14   68.9   5.5   67    7-80     14-80  (95)
 60 KOG4194|consensus               99.0 3.7E-09   8E-14   83.5  10.7  128   10-137   517-706 (873)
 61 cd05874 Ig6_NrCAM Sixth immuno  99.0 1.8E-09   4E-14   64.5   7.2   60   15-80      2-65  (77)
 62 cd05764 Ig_2 Subgroup of the i  99.0 1.4E-09 2.9E-14   64.3   6.4   61   12-80      2-62  (74)
 63 cd05731 Ig3_L1-CAM_like Third   99.0 7.9E-10 1.7E-14   64.6   5.3   57   15-80      2-58  (71)
 64 cd05762 Ig8_MLCK Eighth immuno  99.0 1.4E-09   3E-14   68.0   6.7   66    9-80     13-78  (98)
 65 cd05859 Ig4_PDGFR-alpha Fourth  99.0 3.5E-10 7.6E-15   71.1   3.9   71    8-80     15-87  (101)
 66 cd05728 Ig4_Contactin-2-like F  99.0 7.4E-10 1.6E-14   67.3   5.0   63    7-79     10-72  (85)
 67 cd05854 Ig6_Contactin-2 Sixth   99.0 2.3E-09   5E-14   65.2   7.2   66   13-80      2-69  (85)
 68 cd05901 Ig_Versican Immunoglob  99.0   2E-09 4.4E-14   69.0   7.1   66   14-79     27-100 (117)
 69 cd05747 Ig5_Titin_like M5, fif  99.0 1.6E-09 3.6E-14   66.7   6.6   68    7-80     14-81  (92)
 70 cd05875 Ig6_hNeurofascin_like   99.0 2.8E-09 6.1E-14   63.6   7.4   60   15-80      2-65  (77)
 71 cd05878 Ig_Aggrecan_like Immun  99.0 2.1E-09 4.6E-14   68.5   7.0   66   14-79     26-93  (110)
 72 cd04968 Ig3_Contactin_like Thi  99.0 2.2E-09 4.7E-14   65.5   6.8   63    8-80     13-75  (88)
 73 KOG4222|consensus               99.0 1.2E-09 2.6E-14   90.6   7.2  110   22-138   158-316 (1281)
 74 cd05724 Ig2_Robo Second immuno  99.0 2.7E-09 5.9E-14   64.6   7.1   65    8-80      8-73  (86)
 75 cd05858 Ig3_FGFR-2 Third immun  99.0 3.1E-09 6.7E-14   65.2   7.1   69   12-80      2-77  (90)
 76 cd05735 Ig8_DSCAM Eight immuno  99.0 6.2E-09 1.4E-13   63.7   8.2   67   12-80      2-69  (88)
 77 cd05886 Ig1_Nectin-1_like Firs  99.0 3.6E-09 7.8E-14   66.2   7.1   66   12-79     16-84  (99)
 78 cd07690 Ig1_CD4 First immunogl  99.0 2.2E-09 4.8E-14   66.5   6.1   73    8-80      4-87  (94)
 79 cd05895 Ig_Pro_neuregulin-1 Im  99.0   7E-09 1.5E-13   61.5   7.9   64   14-80      1-66  (76)
 80 cd05722 Ig1_Neogenin First imm  98.9 4.2E-09 9.1E-14   65.2   6.9   65    9-80     12-81  (95)
 81 cd05756 Ig1_IL1R_like First im  98.9 1.9E-09 4.2E-14   66.8   5.0   65    8-79     11-81  (94)
 82 cd05727 Ig2_Contactin-2-like S  98.9 4.5E-09 9.8E-14   65.3   6.4   67    9-81     16-83  (96)
 83 cd05773 Ig8_hNephrin_like Eigh  98.9 8.5E-09 1.8E-13   65.6   7.8   70    9-80     21-92  (109)
 84 cd04970 Ig6_Contactin_like Six  98.9 5.3E-09 1.1E-13   63.4   6.5   65   13-79      2-68  (85)
 85 cd05900 Ig_Aggrecan Immunoglob  98.9 5.3E-09 1.2E-13   66.9   6.6   41   38-78     54-94  (112)
 86 cd04967 Ig1_Contactin First Ig  98.9 5.2E-09 1.1E-13   64.3   6.2   63   10-80     18-81  (91)
 87 cd05891 Ig_M-protein_C C-termi  98.9 4.6E-09   1E-13   64.8   5.9   70    5-79     10-79  (92)
 88 cd05882 Ig1_Necl-1 First (N-te  98.9 7.8E-09 1.7E-13   64.2   7.0   71    7-79      8-83  (95)
 89 cd05729 Ig2_FGFR_like Second i  98.9 6.6E-09 1.4E-13   62.5   6.3   70    6-80      4-73  (85)
 90 cd05739 Ig3_RPTP_IIa_LAR_like   98.9   8E-09 1.7E-13   60.4   6.3   57   12-80      2-58  (69)
 91 PF07679 I-set:  Immunoglobulin  98.9 1.1E-08 2.5E-13   62.2   7.0   67    8-80     12-78  (90)
 92 cd05775 Ig_SLAM-CD84_like_N N-  98.9 7.6E-09 1.6E-13   64.5   6.0   63   12-79     17-82  (97)
 93 cd05888 Ig1_Nectin-4_like Frst  98.9 2.4E-08 5.2E-13   62.5   8.3   64   14-79     17-85  (100)
 94 cd04973 Ig1_FGFR First immunog  98.9 1.9E-08 4.2E-13   60.2   7.2   61    8-79      6-66  (79)
 95 cd04977 Ig1_NCAM-1_like First   98.8 2.6E-08 5.7E-13   61.4   7.8   68    8-80     12-79  (92)
 96 cd05879 Ig_P0 Immunoglobulin (  98.8 2.7E-08 5.9E-13   64.0   8.1   40   39-79     62-101 (116)
 97 cd07701 Ig1_Necl-3 First (N-te  98.8 1.9E-08   4E-13   62.5   7.0   71    7-79      8-83  (95)
 98 cd05853 Ig6_Contactin-4 Sixth   98.8 1.3E-08 2.9E-13   61.9   6.1   65   13-80      2-69  (85)
 99 cd05889 Ig1_DNAM-1_like First   98.8 3.5E-08 7.6E-13   61.4   7.8   64   13-78     14-80  (96)
100 cd05741 Ig_CEACAM_D1_like Firs  98.8 2.2E-08 4.8E-13   61.4   6.9   35   39-79     44-78  (92)
101 cd05845 Ig2_L1-CAM_like Second  98.8 1.6E-08 3.5E-13   62.7   6.0   66    8-81     15-82  (95)
102 cd05887 Ig1_Nectin-3_like Firs  98.8 3.2E-08   7E-13   61.5   7.2   65   13-79     14-81  (96)
103 PF00047 ig:  Immunoglobulin do  98.8   2E-08 4.3E-13   57.4   5.8   62   12-77      2-64  (64)
104 cd05873 Ig_Sema4D_like Immunog  98.8   2E-08 4.3E-13   61.3   5.8   61    9-79      9-69  (87)
105 cd05758 Ig5_KIRREL3-like Fifth  98.8 5.9E-08 1.3E-12   60.4   7.8   72    8-80     13-87  (98)
106 cd07693 Ig1_Robo First immunog  98.8 3.5E-08 7.5E-13   61.0   6.2   68    7-80     12-86  (100)
107 cd05718 Ig1_PVR_like First imm  98.7 8.8E-08 1.9E-12   59.4   8.0   65   13-79     16-83  (98)
108 cd05880 Ig_EVA1 Immunoglobulin  98.7 4.9E-08 1.1E-12   62.7   6.5   42   38-80     60-101 (115)
109 cd05742 Ig1_VEGFR_like First i  98.7 5.8E-08 1.3E-12   58.7   6.5   67   12-80      2-71  (84)
110 smart00408 IGc2 Immunoglobulin  98.7   7E-08 1.5E-12   54.0   6.4   59   11-79      2-60  (63)
111 cd05846 Ig1_MRC-OX-2_like Firs  98.7 8.7E-08 1.9E-12   59.6   7.0   64   14-79     16-82  (97)
112 cd05861 Ig1_PDGFR-alphabeta Fr  98.7 1.5E-07 3.3E-12   57.0   7.8   65   12-80      2-68  (84)
113 cd05774 Ig_CEACAM_D1 First imm  98.7 1.2E-07 2.6E-12   59.9   7.4   36   39-80     57-92  (105)
114 cd05757 Ig2_IL1R_like Second i  98.7   2E-08 4.4E-13   62.0   3.8   62    8-79      7-73  (92)
115 cd04979 Ig_Semaphorin_C Immuno  98.7 1.2E-07 2.5E-12   58.0   6.5   63    9-79      9-72  (89)
116 cd05715 Ig_P0-like Immunoglobu  98.6 1.8E-07 3.9E-12   60.0   7.3   41   39-80     62-102 (116)
117 cd05717 Ig1_Necl-1-3_like Firs  98.6 2.5E-07 5.5E-12   57.2   7.5   71    7-79      8-83  (95)
118 cd05712 Ig_Siglec_N Immunoglob  98.6   2E-07 4.2E-12   60.2   7.2   39   40-79     63-101 (119)
119 cd04983 IgV_TCR_alpha_like Imm  98.6 1.6E-07 3.4E-12   59.4   6.6   73    6-79      8-91  (109)
120 PHA02826 IL-1 receptor-like pr  98.6 1.3E-07 2.8E-12   67.7   6.6   63    9-79    142-209 (227)
121 cd05745 Ig3_Peroxidasin Third   98.6 1.2E-07 2.5E-12   56.0   5.2   26  104-129    39-64  (74)
122 cd05749 Ig2_Tyro3_like Second   98.6 2.1E-07 4.6E-12   56.1   6.2   59    8-80     10-69  (81)
123 cd05852 Ig5_Contactin-1 Fifth   98.6 1.6E-07 3.4E-12   55.5   5.5   25  105-129    39-63  (73)
124 cd05714 Ig_CSPGs_LP Immunoglob  98.6 2.4E-07 5.2E-12   58.4   6.8   38   40-79     52-89  (106)
125 cd00099 IgV Immunoglobulin var  98.6 2.8E-07 6.1E-12   57.7   6.3   70    9-79      4-88  (105)
126 cd05885 Ig2_Necl-4 Second immu  98.6 3.8E-07 8.2E-12   54.8   6.4   60   14-81      2-66  (80)
127 cd05871 Ig_Semaphorin_classIII  98.5 3.8E-07 8.3E-12   56.1   6.4   63    9-79      9-74  (91)
128 cd05851 Ig3_Contactin-1 Third   98.5 3.6E-07 7.7E-12   55.8   5.8   26  104-129    52-77  (88)
129 cd04969 Ig5_Contactin_like Fif  98.5   3E-07 6.4E-12   54.0   5.2   25  105-129    39-63  (73)
130 cd05754 Ig3_Perlecan_like Thir  98.5 4.2E-07 9.1E-12   55.0   6.0   61    8-80     13-74  (85)
131 cd05726 Ig4_Robo Fhird immunog  98.5 4.2E-07 9.1E-12   55.6   5.9   36  105-140    47-87  (90)
132 cd05867 Ig4_L1-CAM_like Fourth  98.5 4.2E-07 9.1E-12   53.9   5.6   25  105-129    41-65  (76)
133 cd05881 Ig1_Necl-2 First (N-te  98.5   9E-07 1.9E-11   54.9   7.3   70    7-78      8-82  (95)
134 cd05753 Ig2_FcgammaR_like Seco  98.5 4.9E-07 1.1E-11   54.6   5.8   60    7-80     10-70  (83)
135 cd05752 Ig1_FcgammaR_like Frst  98.5 3.4E-07 7.4E-12   54.7   4.7   55    8-79     12-67  (78)
136 cd05730 Ig3_NCAM-1_like Third   98.5 7.5E-07 1.6E-11   55.0   6.2   27  103-129    56-82  (95)
137 cd04978 Ig4_L1-NrCAM_like Four  98.4 6.4E-07 1.4E-11   52.8   5.5   26  104-129    40-65  (76)
138 cd04968 Ig3_Contactin_like Thi  98.4 9.3E-07   2E-11   53.8   5.9   26  104-129    52-77  (88)
139 cd05762 Ig8_MLCK Eighth immuno  98.4 9.6E-07 2.1E-11   55.1   5.9   26  104-129    55-80  (98)
140 cd05759 Ig2_KIRREL3-like Secon  98.4 1.1E-06 2.4E-11   52.7   5.9   67   13-81      1-69  (82)
141 cd05897 Ig2_IL1R2_like Second   98.4 6.3E-07 1.4E-11   55.6   4.8   64   10-80      9-77  (95)
142 cd05740 Ig_CEACAM_D4 Fourth im  98.4 1.1E-06 2.3E-11   54.1   5.7   27  103-129    53-79  (91)
143 cd05764 Ig_2 Subgroup of the i  98.4 1.2E-06 2.6E-11   51.4   5.4   25  105-129    40-64  (74)
144 cd05894 Ig_C5_MyBP-C C5 immuno  98.4 1.1E-06 2.4E-11   53.4   5.3   25  105-129    52-76  (86)
145 cd05877 Ig_LP_like Immunoglobu  98.4 2.1E-06 4.6E-11   54.0   6.7   38   40-79     52-89  (106)
146 PHA02987 Ig domain OX-2-like p  98.4 1.4E-06   3E-11   59.9   6.0   70    8-79     27-106 (189)
147 cd05876 Ig3_L1-CAM Third immun  98.4 1.1E-06 2.5E-11   51.3   4.9   27  103-129    34-60  (71)
148 smart00406 IGv Immunoglobulin   98.3 2.1E-06 4.5E-11   50.9   6.1   36   41-77     46-81  (81)
149 cd04982 IgV_TCR_gamma Immunogl  98.3 1.3E-06 2.9E-11   55.8   5.4   73    6-79      8-98  (116)
150 cd05743 Ig_Perlecan_D2_like Im  98.3 1.1E-06 2.3E-11   52.4   4.6   25  105-129    42-66  (78)
151 cd05853 Ig6_Contactin-4 Sixth   98.3 4.2E-07 9.2E-12   55.3   2.8   33  104-136    46-83  (85)
152 cd04984 IgV_L_lambda Immunoglo  98.3 3.7E-06 8.1E-11   52.2   7.1   68    8-78      3-83  (98)
153 cd05716 Ig_pIgR Immunoglobulin  98.3 1.6E-06 3.5E-11   53.8   5.4   70    8-78      4-84  (98)
154 cd05868 Ig4_NrCAM Fourth immun  98.3 1.7E-06 3.6E-11   51.3   5.2   27  103-129    39-65  (76)
155 cd05899 IgV_TCR_beta Immunoglo  98.3 2.2E-06 4.8E-11   54.4   6.0   71    6-79      8-93  (110)
156 cd05723 Ig4_Neogenin Fourth im  98.3 1.5E-06 3.2E-11   50.8   4.6   24  106-129    38-61  (71)
157 PF07686 V-set:  Immunoglobulin  98.3   2E-06 4.4E-11   54.0   5.5   70    9-79     14-100 (114)
158 cd05760 Ig2_PTK7 Second immuno  98.3 3.1E-06 6.8E-11   50.2   5.9   26  104-129    37-62  (77)
159 cd05746 Ig4_Peroxidasin Fourth  98.3 1.6E-06 3.5E-11   50.4   4.5   26  104-129    35-60  (69)
160 cd05765 Ig_3 Subgroup of the i  98.3 2.4E-06 5.3E-11   50.9   5.4   25  105-129    47-71  (81)
161 cd05728 Ig4_Contactin-2-like F  98.3 1.6E-06 3.4E-11   52.5   4.6   25  105-129    51-75  (85)
162 cd07706 IgV_TCR_delta Immunogl  98.3 2.3E-06   5E-11   54.8   5.5   72    7-79     10-93  (116)
163 cd05724 Ig2_Robo Second immuno  98.3 2.7E-06   6E-11   51.2   5.5   26  105-130    51-76  (86)
164 cd05862 Ig1_VEGFR First immuno  98.3   6E-06 1.3E-10   50.2   6.9   66   12-79      2-71  (86)
165 PF13927 Ig_3:  Immunoglobulin   98.3 2.8E-06 6.2E-11   49.3   5.3   57   14-79     18-75  (75)
166 cd05863 Ig2_VEGFR-3 Second imm  98.2 1.3E-06 2.7E-11   50.8   3.4   27  103-129    29-55  (67)
167 cd04980 IgV_L_kappa Immunoglob  98.2 3.6E-06 7.8E-11   53.0   5.6   71    5-78      9-91  (106)
168 cd05735 Ig8_DSCAM Eight immuno  98.2 1.6E-06 3.5E-11   52.9   3.8   25  105-129    47-71  (88)
169 cd05731 Ig3_L1-CAM_like Third   98.2 2.2E-06 4.8E-11   49.7   4.2   26  104-129    35-60  (71)
170 cd05737 Ig_Myomesin_like_C C-t  98.2 3.5E-06 7.6E-11   51.7   5.2   25  105-129    58-82  (92)
171 cd05856 Ig2_FGFRL1-like Second  98.2 2.8E-06   6E-11   50.6   4.6   25  105-129    48-72  (82)
172 cd05896 Ig1_IL1RAPL-1_like Fir  98.2 5.9E-06 1.3E-10   51.8   6.1   47   26-79     41-91  (104)
173 cd05892 Ig_Myotilin_C C-termin  98.2 1.2E-06 2.5E-11   52.0   2.8   24  106-129    42-65  (75)
174 cd04973 Ig1_FGFR First immunog  98.2 3.5E-06 7.7E-11   50.3   4.8   26  104-129    44-69  (79)
175 cd05763 Ig_1 Subgroup of the i  98.2 2.3E-06 4.9E-11   50.5   3.9   27  103-129    38-64  (75)
176 cd05725 Ig3_Robo Third immunog  98.2 1.4E-06 3.1E-11   50.5   3.0   26  104-129    34-59  (69)
177 cd05854 Ig6_Contactin-2 Sixth   98.2 1.9E-06 4.1E-11   52.3   3.6   25  105-129    47-71  (85)
178 PHA03376 BARF1; Provisional     98.2 6.8E-06 1.5E-10   56.6   6.6   64   13-79     42-108 (221)
179 cd05857 Ig2_FGFR Second immuno  98.2   7E-06 1.5E-10   49.4   6.0   25  105-129    51-75  (85)
180 smart00409 IG Immunoglobulin.   98.2 1.1E-05 2.5E-10   47.3   6.8   65    8-78      6-71  (86)
181 smart00410 IG_like Immunoglobu  98.2 1.1E-05 2.5E-10   47.3   6.8   65    8-78      6-71  (86)
182 cd05866 Ig1_NCAM-2 First immun  98.2 4.2E-06 9.1E-11   51.6   4.9   25  105-129    56-80  (92)
183 cd04971 Ig_TrKABC_d5 Fifth dom  98.2 2.8E-06 6.1E-11   51.1   3.9   24  106-129    47-70  (81)
184 cd04972 Ig_TrkABC_d4 Fourth do  98.2 4.9E-06 1.1E-10   50.8   4.9   25  105-129    56-80  (90)
185 cd04974 Ig3_FGFR Third immunog  98.1 2.4E-06 5.2E-11   52.3   3.3   25  105-129    55-79  (90)
186 cd05771 IgC_Tapasin_R Tapasin-  98.1 9.1E-06   2E-10   53.7   6.4   22   58-79      1-22  (139)
187 cd05891 Ig_M-protein_C C-termi  98.1 1.4E-05   3E-10   49.1   6.7   24  106-129    59-82  (92)
188 cd05893 Ig_Palladin_C C-termin  98.1 1.8E-06   4E-11   51.2   2.5   24  106-129    42-65  (75)
189 cd05864 Ig2_VEGFR-2 Second imm  98.1 1.8E-06 3.8E-11   50.6   2.4   27  103-129    32-58  (70)
190 cd04970 Ig6_Contactin_like Six  98.1 2.5E-06 5.4E-11   51.5   3.1   26  104-129    46-71  (85)
191 cd05898 Ig5_KIRREL3 Fifth immu  98.1 2.2E-05 4.7E-10   49.0   7.4   73    7-80     12-87  (98)
192 cd05858 Ig3_FGFR-2 Third immun  98.1 1.6E-06 3.6E-11   53.0   2.3   25  105-129    55-79  (90)
193 cd05855 Ig_TrkB_d5 Fifth domai  98.1 4.8E-06   1E-10   49.9   4.2   24  106-129    45-68  (79)
194 PF07679 I-set:  Immunoglobulin  98.1 6.3E-06 1.4E-10   49.9   4.7   26  104-129    55-80  (90)
195 cd05751 Ig1_LILRB1_like First   98.1 1.2E-05 2.5E-10   49.4   5.9   64    7-80     12-75  (91)
196 cd05748 Ig_Titin_like Immunogl  98.1 3.3E-06 7.1E-11   49.6   3.3   26  104-129    39-64  (74)
197 cd05747 Ig5_Titin_like M5, fif  98.1 9.8E-06 2.1E-10   49.7   5.5   25  105-129    59-83  (92)
198 cd04976 Ig2_VEGFR Second immun  98.1 3.9E-06 8.5E-11   49.1   3.3   27  103-129    33-59  (71)
199 cd05753 Ig2_FcgammaR_like Seco  98.1   7E-06 1.5E-10   49.6   4.3   26  104-129    47-72  (83)
200 cd05848 Ig1_Contactin-5 First   98.1 1.4E-05 3.1E-10   49.3   5.8   25  105-129    58-83  (94)
201 cd05744 Ig_Myotilin_C_like Imm  98.1 4.1E-06 8.8E-11   49.5   3.1   24  106-129    42-65  (75)
202 cd04975 Ig4_SCFR_like Fourth i  98.1 3.7E-06 8.1E-11   52.7   3.0   25  105-129    65-89  (101)
203 cd05752 Ig1_FcgammaR_like Frst  98.1   1E-05 2.2E-10   48.3   4.7   25  103-128    45-69  (78)
204 cd05865 Ig1_NCAM-1 First immun  98.0 5.3E-06 1.1E-10   51.5   3.5   25  105-129    60-84  (96)
205 cd05738 Ig2_RPTP_IIa_LAR_like   98.0 8.4E-06 1.8E-10   48.0   3.9   26  105-130    38-63  (74)
206 cd04977 Ig1_NCAM-1_like First   98.0 5.8E-06 1.2E-10   50.9   3.1   25  105-129    57-81  (92)
207 cd05736 Ig2_Follistatin_like S  98.0 1.3E-05 2.8E-10   47.3   4.5   27  103-129    37-63  (76)
208 cd00096 Ig Immunoglobulin doma  98.0 3.5E-05 7.6E-10   43.0   6.1   63   15-79      2-64  (74)
209 smart00408 IGc2 Immunoglobulin  98.0 3.4E-05 7.3E-10   42.7   5.9   27  103-129    37-63  (63)
210 cd05742 Ig1_VEGFR_like First i  98.0 7.3E-06 1.6E-10   49.4   3.1   25  105-129    49-73  (84)
211 cd05870 Ig5_NCAM-2 Fifth immun  98.0 7.1E-06 1.5E-10   50.9   3.1   25  105-129    64-88  (98)
212 cd05754 Ig3_Perlecan_like Thir  98.0 1.2E-05 2.7E-10   48.4   4.1   26  104-129    51-76  (85)
213 cd05850 Ig1_Contactin-2 First   98.0 3.1E-05 6.8E-10   47.7   5.9   26  105-130    58-84  (94)
214 cd05732 Ig5_NCAM-1_like Fifth   98.0   8E-06 1.7E-10   50.3   3.2   26  105-130    62-87  (96)
215 cd05895 Ig_Pro_neuregulin-1 Im  97.9 1.7E-05 3.8E-10   46.7   4.3   27  105-131    44-70  (76)
216 cd05859 Ig4_PDGFR-alpha Fourth  97.9 7.9E-06 1.7E-10   51.2   2.8   25  105-129    65-89  (101)
217 cd05869 Ig5_NCAM-1 Fifth immun  97.9 9.8E-06 2.1E-10   50.2   3.2   26  105-130    63-88  (97)
218 cd05734 Ig7_DSCAM Seventh immu  97.9 1.2E-05 2.7E-10   47.8   3.5   25  105-129    44-68  (79)
219 cd05750 Ig_Pro_neuregulin Immu  97.9 1.3E-05 2.8E-10   46.9   3.2   26  105-130    43-68  (75)
220 cd05773 Ig8_hNephrin_like Eigh  97.9 3.4E-05 7.4E-10   48.9   5.4   25  105-129    69-94  (109)
221 cd05757 Ig2_IL1R_like Second i  97.9 3.5E-05 7.7E-10   47.5   5.3   28  103-130    50-77  (92)
222 cd07700 IgV_CD8_beta Immunoglo  97.9 4.6E-05   1E-09   48.1   5.9   70    8-78      3-92  (107)
223 cd05739 Ig3_RPTP_IIa_LAR_like   97.9 4.6E-05   1E-09   44.3   5.5   22  106-129    39-60  (69)
224 cd05727 Ig2_Contactin-2-like S  97.9 1.9E-05 4.2E-10   49.0   4.0   25  105-129    60-84  (96)
225 cd05862 Ig1_VEGFR First immuno  97.9 1.6E-05 3.4E-10   48.4   3.5   25  105-129    50-74  (86)
226 cd05720 Ig_CD8_alpha Immunoglo  97.9 7.3E-05 1.6E-09   47.0   6.7   23   56-78     67-89  (104)
227 PF13895 Ig_2:  Immunoglobulin   97.9 2.1E-05 4.6E-10   46.2   4.0   55    9-79     12-66  (80)
228 cd05849 Ig1_Contactin-1 First   97.9 3.4E-05 7.4E-10   47.5   4.9   25  105-129    57-82  (93)
229 cd05872 Ig_Sema4B_like Immunog  97.9 3.8E-05 8.3E-10   46.6   4.9   59    9-78      9-67  (85)
230 cd04967 Ig1_Contactin First Ig  97.9 6.7E-05 1.5E-09   45.8   6.0   26  105-130    58-84  (91)
231 PF00047 ig:  Immunoglobulin do  97.9 4.5E-05 9.7E-10   43.2   4.8   18  107-124    47-64  (64)
232 cd05722 Ig1_Neogenin First imm  97.8 6.1E-05 1.3E-09   46.3   5.5   24  106-129    55-84  (95)
233 cd05756 Ig1_IL1R_like First im  97.8 2.3E-05 4.9E-10   48.5   3.2   26  104-129    59-84  (94)
234 cd05871 Ig_Semaphorin_classIII  97.8   7E-05 1.5E-09   46.0   5.0   25  105-129    53-78  (91)
235 cd07702 Ig2_VEGFR-1 Second imm  97.8 1.9E-05 4.2E-10   46.4   2.3   26  104-129    35-60  (72)
236 cd05861 Ig1_PDGFR-alphabeta Fr  97.7 4.6E-05 9.9E-10   46.0   3.7   25  105-129    46-70  (84)
237 cd00098 IgC Immunoglobulin Con  97.7 6.2E-05 1.3E-09   46.1   4.3   70   10-80     12-84  (95)
238 cd05874 Ig6_NrCAM Sixth immuno  97.7 0.00015 3.4E-09   43.0   5.7   26  104-129    38-67  (77)
239 cd04979 Ig_Semaphorin_C Immuno  97.7 0.00011 2.5E-09   44.6   4.9   24  106-129    52-75  (89)
240 cd05873 Ig_Sema4D_like Immunog  97.7 7.7E-05 1.7E-09   45.5   4.1   24  105-128    48-71  (87)
241 cd04981 IgV_H Immunoglobulin (  97.7 0.00019 4.2E-09   46.1   6.0   36   42-78     61-96  (117)
242 cd05774 Ig_CEACAM_D1 First imm  97.7 0.00017 3.6E-09   45.6   5.5   27  102-129    68-94  (105)
243 cd07693 Ig1_Robo First immunog  97.7 0.00019 4.2E-09   44.0   5.8   18  112-129    71-88  (100)
244 cd05733 Ig6_L1-CAM_like Sixth   97.6 9.4E-05   2E-09   43.8   4.1   25  105-129    39-67  (77)
245 cd05897 Ig2_IL1R2_like Second   97.6 0.00017 3.6E-09   44.7   5.1   26  104-129    54-79  (95)
246 cd05711 Ig_FcalphaRI Immunoglo  97.6  0.0003 6.6E-09   43.4   5.9   66    7-79     11-76  (94)
247 cd05882 Ig1_Necl-1 First (N-te  97.6 0.00016 3.4E-09   44.8   4.4   24  105-128    62-85  (95)
248 cd05883 Ig2_Necl-2 Second immu  97.5 0.00042 9.2E-09   41.7   6.0   65   14-81      2-67  (82)
249 cd05741 Ig_CEACAM_D1_like Firs  97.5 0.00029 6.3E-09   42.8   4.9   25  105-129    57-81  (92)
250 cd05886 Ig1_Nectin-1_like Firs  97.5 0.00019 4.2E-09   44.8   4.0   26  104-129    62-88  (99)
251 cd05729 Ig2_FGFR_like Second i  97.5 0.00032   7E-09   41.7   4.8   24  106-129    52-75  (85)
252 cd05758 Ig5_KIRREL3-like Fifth  97.5 0.00023 4.9E-09   44.1   4.1   24  106-129    65-89  (98)
253 cd05845 Ig2_L1-CAM_like Second  97.4 0.00023 4.9E-09   44.1   4.0   25  105-129    58-83  (95)
254 cd05898 Ig5_KIRREL3 Fifth immu  97.4 0.00051 1.1E-08   42.8   5.4   66   64-129    12-89  (98)
255 cd07690 Ig1_CD4 First immunogl  97.4 8.9E-05 1.9E-09   45.9   1.8   25  105-129    65-89  (94)
256 cd05888 Ig1_Nectin-4_like Frst  97.4 0.00021 4.6E-09   44.5   3.5   26  104-129    63-89  (100)
257 cd05860 Ig4_SCFR Fourth immuno  97.4 0.00065 1.4E-08   42.5   5.6   74    6-80     13-87  (101)
258 cd05713 Ig_MOG_like Immunoglob  97.4 0.00019   4E-09   44.5   3.3   25  105-129    65-89  (100)
259 cd05761 Ig2_Necl-1-4_like Seco  97.4 0.00093   2E-08   40.0   6.2   65   14-81      2-68  (82)
260 cd05714 Ig_CSPGs_LP Immunoglob  97.4 0.00021 4.5E-09   44.9   3.4   26  104-129    67-92  (106)
261 cd05875 Ig6_hNeurofascin_like   97.4 0.00028   6E-09   41.8   3.7   26  104-129    38-67  (77)
262 cd05751 Ig1_LILRB1_like First   97.3 0.00036 7.8E-09   42.7   4.0   22  106-127    54-75  (91)
263 cd05877 Ig_LP_like Immunoglobu  97.3 0.00026 5.6E-09   44.4   3.3   26  104-129    67-92  (106)
264 cd05749 Ig2_Tyro3_like Second   97.3 0.00057 1.2E-08   41.0   4.5   24  104-129    48-71  (81)
265 cd05884 Ig2_Necl-3 Second immu  97.3   0.002 4.2E-08   38.8   6.8   66   14-81      2-69  (83)
266 PF13895 Ig_2:  Immunoglobulin   97.2 0.00079 1.7E-08   39.3   4.4   24  106-129    46-69  (80)
267 cd05900 Ig_Aggrecan Immunoglob  97.2 0.00064 1.4E-08   43.4   3.9   27  103-129    72-98  (112)
268 cd07701 Ig1_Necl-3 First (N-te  97.1 0.00046 9.9E-09   42.6   3.0   25  105-129    62-86  (95)
269 PF13927 Ig_3:  Immunoglobulin   97.1 0.00037 8.1E-09   40.1   2.2   23  104-126    53-75  (75)
270 cd05846 Ig1_MRC-OX-2_like Firs  97.1  0.0012 2.5E-08   40.8   4.5   24  104-127    60-83  (97)
271 smart00407 IGc1 Immunoglobulin  97.1   0.003 6.5E-08   37.1   6.0   67   13-80      1-70  (75)
272 cd05717 Ig1_Necl-1-3_like Firs  97.1 0.00063 1.4E-08   41.8   3.2   25  105-129    62-86  (95)
273 cd07705 Ig2_Necl-1 Second immu  97.1  0.0041 8.9E-08   37.4   6.6   64   14-81      2-69  (83)
274 cd05879 Ig_P0 Immunoglobulin (  97.0 0.00068 1.5E-08   43.6   3.0   26  104-129    79-104 (116)
275 PF11465 Receptor_2B4:  Natural  97.0   0.002 4.3E-08   40.5   4.8   65   10-79     23-92  (108)
276 cd05718 Ig1_PVR_like First imm  97.0 0.00093   2E-08   41.1   3.4   26  104-129    61-87  (98)
277 cd05878 Ig_Aggrecan_like Immun  97.0  0.0011 2.4E-08   42.1   3.6   25  105-129    72-96  (110)
278 cd05901 Ig_Versican Immunoglob  96.9  0.0016 3.4E-08   41.9   3.8   26  104-129    78-103 (117)
279 cd05880 Ig_EVA1 Immunoglobulin  96.9 0.00094   2E-08   42.7   2.8   26  104-129    78-103 (115)
280 cd05902 Ig_Neurocan Immunoglob  96.9  0.0011 2.3E-08   42.3   2.8   26  104-129    71-96  (110)
281 cd05775 Ig_SLAM-CD84_like_N N-  96.8  0.0012 2.7E-08   40.8   3.0   25  105-129    61-85  (97)
282 cd05721 IgV_CTLA-4 Immunoglobu  96.8  0.0087 1.9E-07   38.3   6.7   39   42-81     59-97  (115)
283 cd05715 Ig_P0-like Immunoglobu  96.8  0.0015 3.4E-08   41.6   3.0   25  105-129    80-104 (116)
284 KOG3515|consensus               96.7  0.0061 1.3E-07   50.4   6.8  109    9-128    20-186 (741)
285 cd05887 Ig1_Nectin-3_like Firs  96.7  0.0021 4.5E-08   39.9   3.1   26  104-129    59-85  (96)
286 cd05889 Ig1_DNAM-1_like First   96.7  0.0023   5E-08   39.7   3.2   26  104-129    59-85  (96)
287 cd05896 Ig1_IL1RAPL-1_like Fir  96.6  0.0025 5.5E-08   40.0   3.1   28  102-129    67-94  (104)
288 smart00409 IG Immunoglobulin.   96.6  0.0035 7.5E-08   36.4   3.7   25  105-129    51-75  (86)
289 smart00410 IG_like Immunoglobu  96.6  0.0035 7.5E-08   36.4   3.7   25  105-129    51-75  (86)
290 cd00099 IgV Immunoglobulin var  96.6  0.0015 3.2E-08   40.6   2.1   26  104-129    66-91  (105)
291 cd04983 IgV_TCR_alpha_like Imm  96.5   0.005 1.1E-07   38.5   4.2   26  104-129    69-94  (109)
292 cd05755 Ig2_ICAM-1_like Second  96.5   0.016 3.4E-07   36.3   6.2   68    9-81     14-85  (100)
293 cd05766 IgC_MHC_II_beta Class   96.5   0.014 3.1E-07   35.9   6.0   67    8-80     11-82  (94)
294 PHA02633 hypothetical protein;  96.5  0.0053 1.1E-07   34.7   3.6   36  103-138    16-56  (63)
295 cd05770 IgC_beta2m Class I maj  96.5   0.012 2.6E-07   36.2   5.4   65    9-80     13-82  (93)
296 cd05771 IgC_Tapasin_R Tapasin-  96.4   0.029 6.3E-07   36.8   7.6   70   10-80     52-130 (139)
297 cd07703 Ig2_Nectin-2_like Seco  96.4   0.016 3.5E-07   35.9   5.6   60   13-80     17-81  (95)
298 cd05881 Ig1_Necl-2 First (N-te  96.4   0.004 8.7E-08   38.5   2.9   23  106-128    63-85  (95)
299 PHA02633 hypothetical protein;  96.4  0.0037   8E-08   35.3   2.5   24   56-79     16-39  (63)
300 cd05872 Ig_Sema4B_like Immunog  96.3   0.012 2.6E-07   35.6   4.8   23  106-129    48-70  (85)
301 cd07698 IgC_MHC_I_alpha3 Class  96.3   0.012 2.6E-07   36.0   4.9   64   11-80     14-82  (93)
302 cd07694 Ig2_CD4 Second immunog  96.2   0.024 5.2E-07   34.5   5.7   25  103-127    49-73  (88)
303 cd07694 Ig2_CD4 Second immunog  96.2   0.031 6.7E-07   34.0   6.1   56   11-78     14-71  (88)
304 cd05899 IgV_TCR_beta Immunoglo  96.2  0.0073 1.6E-07   38.0   3.6   25  104-128    71-95  (110)
305 cd05712 Ig_Siglec_N Immunoglob  96.2  0.0082 1.8E-07   38.5   3.9   33  105-137    80-112 (119)
306 cd05767 IgC_MHC_II_alpha Class  96.2    0.02 4.3E-07   35.3   5.4   66    9-80     13-83  (94)
307 PF07686 V-set:  Immunoglobulin  96.1  0.0046   1E-07   38.4   2.1   23  105-127    79-101 (114)
308 cd07704 Ig2_Nectin-3-4_like Se  96.0   0.023 4.9E-07   35.3   5.1   66    7-80     12-83  (97)
309 cd05860 Ig4_SCFR Fourth immuno  95.9   0.012 2.5E-07   36.9   3.4   25  105-129    65-89  (101)
310 PF07354 Sp38:  Zona-pellucida-  95.9   0.013 2.8E-07   42.6   4.0   50   23-80     10-59  (271)
311 cd05719 Ig2_PVR_like Second im  95.9   0.039 8.5E-07   34.1   5.7   61   12-80     16-81  (95)
312 cd04984 IgV_L_lambda Immunoglo  95.8  0.0084 1.8E-07   36.9   2.6   23  105-127    63-85  (98)
313 smart00406 IGv Immunoglobulin   95.8  0.0043 9.3E-08   36.3   1.1   20  105-124    62-81  (81)
314 cd04980 IgV_L_kappa Immunoglob  95.7  0.0066 1.4E-07   38.0   1.8   23  105-127    71-93  (106)
315 cd05711 Ig_FcalphaRI Immunoglo  95.7   0.026 5.6E-07   34.6   4.2   20  106-125    56-75  (94)
316 cd05716 Ig_pIgR Immunoglobulin  95.6  0.0071 1.5E-07   37.2   1.6   24  105-128    64-87  (98)
317 cd05885 Ig2_Necl-4 Second immu  95.4   0.015 3.4E-07   34.8   2.5   24  106-129    44-67  (80)
318 PF08205 C2-set_2:  CD80-like C  95.4   0.077 1.7E-06   31.8   5.6   68   11-80     14-83  (89)
319 cd04982 IgV_TCR_gamma Immunogl  95.2   0.014 3.1E-07   37.0   2.1   23  105-127    77-99  (116)
320 PHA03376 BARF1; Provisional     95.1    0.03 6.5E-07   39.0   3.5   25  105-129    87-111 (221)
321 cd07699 IgC_L Immunoglobulin C  95.1   0.071 1.5E-06   33.1   5.0   69   11-80     17-88  (100)
322 cd05720 Ig_CD8_alpha Immunoglo  94.9   0.016 3.5E-07   36.2   1.7   22  105-126    69-90  (104)
323 cd07706 IgV_TCR_delta Immunogl  94.8   0.018 3.9E-07   36.6   1.7   22  105-126    72-93  (116)
324 cd00096 Ig Immunoglobulin doma  94.8   0.037   8E-07   30.1   2.8   24  105-128    43-66  (74)
325 cd07700 IgV_CD8_beta Immunoglo  94.7   0.022 4.7E-07   35.7   1.8   21  106-126    73-93  (107)
326 cd05847 IgC_CH2_IgE CH2 domain  94.7    0.12 2.7E-06   31.7   5.2   68   12-80     15-85  (94)
327 cd05772 IgC_SIRP Signal-regula  94.1    0.34 7.3E-06   30.8   6.4   67   10-80     20-91  (111)
328 PF07654 C1-set:  Immunoglobuli  93.7    0.17 3.7E-06   30.0   4.3   69    8-80      5-76  (83)
329 cd07692 Ig_CD3_epsilon Immunog  93.7    0.13 2.9E-06   29.4   3.6   38   89-127     6-56  (65)
330 cd07697 IgC_TCR_gamma T cell r  93.6    0.26 5.6E-06   30.5   5.0   26   11-36     16-43  (96)
331 cd05759 Ig2_KIRREL3-like Secon  93.4   0.085 1.8E-06   31.2   2.5   24  106-129    47-70  (82)
332 PHA02987 Ig domain OX-2-like p  93.3   0.078 1.7E-06   36.8   2.5   24  103-126    83-106 (189)
333 cd07692 Ig_CD3_epsilon Immunog  93.1    0.34 7.4E-06   27.7   4.6   48   11-78      7-54  (65)
334 cd05768 IgC_CH4 CH4 domain (fo  93.1    0.49 1.1E-05   29.5   5.7   27   10-36     15-43  (102)
335 cd04981 IgV_H Immunoglobulin (  92.7   0.077 1.7E-06   33.9   1.7   21  106-126    77-97  (117)
336 KOG3515|consensus               92.7    0.57 1.2E-05   39.2   7.0   38  106-143   459-496 (741)
337 cd05769 IgC_TCR_beta T cell re  91.6     0.7 1.5E-05   29.6   5.2   69   12-81     19-92  (115)
338 PF08204 V-set_CD47:  CD47 immu  91.5    0.28 6.1E-06   32.1   3.3   33   45-80     75-107 (130)
339 cd07696 IgC_CH3 CH3 domain (th  91.0     1.6 3.5E-05   26.9   6.3   65    9-80     12-85  (96)
340 cd07691 Ig_CD3_gamma_delta Imm  90.9    0.36 7.8E-06   27.9   2.9   47   13-79      8-54  (69)
341 cd00098 IgC Immunoglobulin Con  90.6    0.29 6.3E-06   29.5   2.7   24  106-129    63-86  (95)
342 cd07689 Ig2_VCAM-1 Second immu  90.3     1.4   3E-05   27.5   5.5   71    6-79     10-84  (99)
343 cd04985 IgC_CH1 CH1 domain (fi  89.5     1.3 2.7E-05   27.3   4.8   26   11-36     16-43  (95)
344 PHA02982 hypothetical protein;  88.3     1.9 4.1E-05   30.7   5.5   67   10-79     38-121 (251)
345 PHA02982 hypothetical protein;  87.1     1.9 4.2E-05   30.7   5.0   27  103-129    98-124 (251)
346 KOG1480|consensus               87.1    0.22 4.7E-06   41.6   0.3   58   14-80    147-205 (909)
347 cd05755 Ig2_ICAM-1_like Second  84.5     2.8   6E-05   26.1   4.4   23  106-129    63-86  (100)
348 PHA02865 MHC-like TNF binding   82.6     4.1 8.9E-05   31.1   5.3   20   14-33    217-238 (338)
349 PF07354 Sp38:  Zona-pellucida-  81.8     1.5 3.2E-05   32.2   2.6   25  103-128    36-60  (271)
350 cd05721 IgV_CTLA-4 Immunoglobu  75.3     2.6 5.5E-05   27.1   2.0   32   96-127    64-96  (115)
351 cd05883 Ig2_Necl-2 Second immu  74.0     3.6 7.9E-05   24.6   2.4   23  106-129    45-68  (82)
352 PHA03282 envelope glycoprotein  73.7     4.5 9.7E-05   32.2   3.3   21   57-77    123-143 (540)
353 PF11465 Receptor_2B4:  Natural  72.9     5.8 0.00012   25.1   3.1   25  105-129    71-95  (108)
354 KOG4597|consensus               71.8     5.3 0.00011   31.9   3.3   59   17-79    217-278 (560)
355 PF05790 C2-set:  Immunoglobuli  68.3      22 0.00049   21.0   6.5   22  104-125    42-63  (80)
356 PHA03189 UL14 tegument protein  66.0      21 0.00046   26.9   5.3   19  111-129   139-157 (348)
357 PHA02914 Immunoglobulin-like d  64.6       6 0.00013   31.0   2.3   24  105-128   346-369 (500)
358 PF01688 Herpes_gI:  Alphaherpe  63.8     9.2  0.0002   26.0   2.9   24   57-80    123-146 (161)
359 cd04986 IgC_CH2 CH2 domain (se  59.8      39 0.00085   20.9   5.2   26   11-36     19-47  (99)
360 PHA03286 envelope glycoprotein  58.3      14 0.00031   29.3   3.4   24   56-79    305-328 (492)
361 PHA02914 Immunoglobulin-like d  54.8      20 0.00042   28.3   3.6   21   57-77     80-100 (500)
362 PHA03282 envelope glycoprotein  49.2      23  0.0005   28.4   3.3   23   57-79    332-354 (540)
363 PHA03290 envelope glycoprotein  45.9      29 0.00064   26.5   3.3   23   57-79    128-150 (357)
364 KOG1480|consensus               45.6      11 0.00023   32.1   1.1   25  105-129   183-207 (909)
365 COG5475 Uncharacterized small   42.8      54  0.0012   18.2   3.2   26  102-129    15-40  (60)
366 PHA03289 envelope glycoprotein  41.0      39 0.00085   25.7   3.3   24   57-80    121-144 (352)
367 KOG4597|consensus               40.7      27 0.00059   28.1   2.5   24  106-129   258-281 (560)
368 PHA03052 Hypothetical protein;  40.3      57  0.0012   18.9   3.2   29    8-36      9-40  (69)
369 PHA03292 envelope glycoprotein  39.9      40 0.00086   26.3   3.2   23   57-79    127-149 (413)
370 PHA03042 CD47-like protein; Pr  39.1      17 0.00037   27.0   1.2   22  106-128    72-93  (286)
371 PF02480 Herpes_gE:  Alphaherpe  38.2      28 0.00061   27.7   2.3   24   56-79    267-290 (439)
372 PHA03283 envelope glycoprotein  34.3      54  0.0012   26.7   3.3   24   56-79    313-336 (542)
373 PF06214 SLAM:  Signaling lymph  31.9      59  0.0013   20.8   2.6   30   43-77     93-122 (126)
374 PF09969 DUF2203:  Uncharacteri  30.2      56  0.0012   21.0   2.4   28   13-46     90-117 (120)
375 PHA03291 envelope glycoprotein  28.8      77  0.0017   24.6   3.2   23   57-79    128-150 (401)
376 PHA03286 envelope glycoprotein  27.5      62  0.0013   25.9   2.6   22  106-127   308-329 (492)
377 PHA03240 envelope glycoprotein  27.2      28  0.0006   25.0   0.6   20   56-75    103-122 (258)
378 PHA03281 envelope glycoprotein  25.7      78  0.0017   26.1   2.9   24   56-79    473-496 (642)
379 PF02480 Herpes_gE:  Alphaherpe  23.3      60  0.0013   25.9   1.9   25  103-127   267-291 (439)
380 PHA03283 envelope glycoprotein  20.9 1.1E+02  0.0024   25.0   2.9   25  103-127   313-337 (542)

No 1  
>KOG3513|consensus
Probab=99.72  E-value=1.4e-16  Score=130.78  Aligned_cols=125  Identities=26%  Similarity=0.356  Sum_probs=95.1

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEec------
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLN------   81 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~------   81 (145)
                      .+.+.++...|-+-|.|.|.+.|+||+.+....+..-|..+       .++.|.|++|+.+|+|.|+|.|.|.-      
T Consensus       343 ~~~gs~v~~eC~a~g~P~p~v~WlkNg~pl~~~~r~~~~~i-------~~g~L~is~v~~~dsg~YQC~A~Nk~G~i~an  415 (1051)
T KOG3513|consen  343 ADTGSNVTLECKASGKPNPTVKWLKNGEPLEPAERDPRYKI-------DDGTLIISNVQESDSGVYQCIAENKYGTIYAN  415 (1051)
T ss_pred             ecCCCCeEEEEEecCCCCCceEEeeCCeecCccCCCcceEE-------eCCEEEEEecccccCeEEEeeeecccceEeee
Confidence            46677889999999999999999999865332222222333       38999999999999999999996532      


Q ss_pred             ----C---CC----CC------CCCCcEEEEEEeE------------------------EecCCcEEEEcccCCCCCeee
Q psy534           82 ----R---SP----NS------HKNGTWFHLDVHG------------------------VFNDGTELRISNIRSQDIGDY  120 (145)
Q Consensus        82 ----~---~~----~~------~~~g~~~~l~c~~------------------------~~~~~~~L~i~~v~~~d~G~Y  120 (145)
                          +   .|    ++      +..|..+.+.|..                        ...+| +|.|.+++++|+|.|
T Consensus       416 A~L~V~a~~P~f~~~p~~~~~~a~~g~~v~i~C~~~asP~p~~~W~k~~~~~~~~~r~~i~edG-tL~I~n~t~~DaG~Y  494 (1051)
T KOG3513|consen  416 AELKVLASAPVFPLNPVERKVMAVVGGTVTIDCKPFASPKPKVSWLKGGEKLLQSGRIRILEDG-TLEISNVTRSDAGKY  494 (1051)
T ss_pred             eEEEEEccCCCCCCCccceEEEEEeCCeEEEeeccCCCCcceEEEEcCCcccccCceEEECCCC-cEEecccCcccCcEE
Confidence                1   11    11      3359999999980                        11344 999999999999999


Q ss_pred             EEEEecCCC-----CcEEEEeCeeE
Q psy534          121 TCLATHVLY-----PDLLVVLGSFH  140 (145)
Q Consensus       121 ~C~a~n~~g-----~~~~v~~~~~~  140 (145)
                      +|.|+|.+|     .+|.|.....+
T Consensus       495 tC~A~N~~G~a~~~~~L~Vkd~tri  519 (1051)
T KOG3513|consen  495 TCVAENKLGKAESTGNLIVKDATRI  519 (1051)
T ss_pred             EEEEEcccCccceEEEEEEecCceE
Confidence            999999999     67777776655


No 2  
>KOG3513|consensus
Probab=99.61  E-value=1.4e-14  Score=119.26  Aligned_cols=120  Identities=23%  Similarity=0.278  Sum_probs=92.7

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEecC-----
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLNR-----   82 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~~-----   82 (145)
                      +.-+..+.+-|.+.|+|.|.+.|.|.++.    ...+|....     .....|.|.+++.+|+|.|+|.+.|...     
T Consensus       253 a~~G~~v~LECfA~G~P~P~i~W~k~~g~----~~~~r~~~~-----~~~~vL~I~nv~~~D~G~Y~C~AeN~~G~~~~~  323 (1051)
T KOG3513|consen  253 ALKGQSVKLECFALGNPTPQIKWRKVDGK----PPPRRATYS-----NYGKVLKIPNVQYEDAGEYECIAENSRGSATHS  323 (1051)
T ss_pred             ccCCCeEEEEEEecCCCCCcEEEEeCCCC----CCCcceeee-----ccccEEEecccCcCCCeEEEEEEecccccceee
Confidence            34466788889999999999999999864    244555542     3488999999999999999999976531     


Q ss_pred             -------CCC--------CCCCCcEEEEEEeE--------------------------EecCCcEEEEcccCCCCCeeeE
Q psy534           83 -------SPN--------SHKNGTWFHLDVHG--------------------------VFNDGTELRISNIRSQDIGDYT  121 (145)
Q Consensus        83 -------~~~--------~~~~g~~~~l~c~~--------------------------~~~~~~~L~i~~v~~~d~G~Y~  121 (145)
                             +|.        ....|+++.+.|..                          .... +.|.|.+|+.+|+|.|.
T Consensus       324 ~~v~v~a~P~w~~~~~d~~~~~gs~v~~eC~a~g~P~p~v~WlkNg~pl~~~~r~~~~~i~~-g~L~is~v~~~dsg~YQ  402 (1051)
T KOG3513|consen  324 GHVTVYAPPYWLQKPQDTEADTGSNVTLECKASGKPNPTVKWLKNGEPLEPAERDPRYKIDD-GTLIISNVQESDSGVYQ  402 (1051)
T ss_pred             EEEEEecCchhhcccceeEecCCCCeEEEEEecCCCCCceEEeeCCeecCccCCCcceEEeC-CEEEEEecccccCeEEE
Confidence                   221        13459999999981                          1123 48999999999999999


Q ss_pred             EEEecCCC-----CcEEEEeC
Q psy534          122 CLATHVLY-----PDLLVVLG  137 (145)
Q Consensus       122 C~a~n~~g-----~~~~v~~~  137 (145)
                      |.|+|..|     +.+.|+..
T Consensus       403 C~A~Nk~G~i~anA~L~V~a~  423 (1051)
T KOG3513|consen  403 CIAENKYGTIYANAELKVLAS  423 (1051)
T ss_pred             eeeecccceEeeeeEEEEEcc
Confidence            99999999     66666554


No 3  
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=99.47  E-value=8.8e-13  Score=94.14  Aligned_cols=127  Identities=16%  Similarity=0.136  Sum_probs=80.3

Q ss_pred             hhhccceeeEEeecCCC-----------ccEEEEecCCCCcccccccce---EEEecCCCCCCeeeEEEcccCCCCCEEE
Q psy534            8 KSIFQMLSVGDFADDED-----------IPVYIWYDSYPTHEAEEYKGR---ISRVDKESPFGMASLNLTKIRESDQGWY   73 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p-----------~p~~~w~k~~~~~~~~~~~~R---~~~~~~~~~~~~~sL~I~~v~~~D~G~Y   73 (145)
                      +.++.|+.+.|-..+.|           .+.+.|+|++....-.....|   ..+..++....+.+|.|.+++.+|+|.|
T Consensus        34 v~eGe~v~L~C~~~~~~~~~~~~~~~~~~~~V~W~k~~s~~~v~~~~~~~~~~~i~~~~~~~r~~~L~I~~v~~~DsG~Y  113 (227)
T PHA02826         34 AKFGDPMVLLCTGKHYKKSIFFDKTFITSYNVTWSKTDSLAFVRDSGARTKIKKITHNEIGDRSENLWIGNVINIDEGIY  113 (227)
T ss_pred             ecCCCCEEEEccccccccccccccccCCCccEEEEeCCeEEEEEcCCCccccccccccceecCCCeEEECCCChHHCEEE
Confidence            35677888888766543           347889988642100000011   0000111112367899999999999999


Q ss_pred             EEEEEEecC------------CCC--CCCCCcEEEEEEeE--------------------Ee---------cCCcEEEEc
Q psy534           74 ECKVVFLNR------------SPN--SHKNGTWFHLDVHG--------------------VF---------NDGTELRIS  110 (145)
Q Consensus        74 ~C~~~~~~~------------~~~--~~~~g~~~~l~c~~--------------------~~---------~~~~~L~i~  110 (145)
                      .|.+.+...            ++.  ....|+.+.|.|..                    ..         ..+..|.|.
T Consensus       114 ~C~a~N~~~~~~~~i~L~V~~~~~~~~~~~G~~v~L~C~~~~~~~~~~p~p~I~WyKng~~l~~~~r~~~~~~~~~L~I~  193 (227)
T PHA02826        114 ICTISSGNICEESTIRLTFDSGTINYQFNSGKDSKLHCYGTDGISSTFKDYTLTWYKNGNIVLYTDRIQLRNNNSTLVIK  193 (227)
T ss_pred             EEEEEECCcceEEEEEEEEecCCccceEecCCCEEEEeeCCCCccccCCCceEEEEECCEECCCCCCEEEeCCCCEEEEC
Confidence            999976431            111  12358889999961                    00         123479999


Q ss_pred             ccCCCCCeeeEEEEecCC-CCcEEE
Q psy534          111 NIRSQDIGDYTCLATHVL-YPDLLV  134 (145)
Q Consensus       111 ~v~~~d~G~Y~C~a~n~~-g~~~~v  134 (145)
                      +++.+|+|.|+|.|+... |.++.+
T Consensus       194 ~V~~~DsG~YtC~a~~~~~g~~y~~  218 (227)
T PHA02826        194 SATHDDSGIYTCNLRFNKNSNNYNI  218 (227)
T ss_pred             cCCHHhCEEEEEEEEEeECCEEEEE
Confidence            999999999999999975 444443


No 4  
>PHA02785 IL-beta-binding protein; Provisional
Probab=99.36  E-value=9.6e-12  Score=93.35  Aligned_cols=112  Identities=16%  Similarity=0.312  Sum_probs=76.8

Q ss_pred             cceeeEE-----eecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEec-----
Q psy534           12 QMLSVGD-----FADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLN-----   81 (145)
Q Consensus        12 ~~~~~~~-----w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~-----   81 (145)
                      ....+.|     |..+.|.|.+.|+++..  +   ...|+..      ..++.|.|.+++.+|+|.|+|.+.+..     
T Consensus       137 ~~~~i~C~~~~~~~~~~~~~~i~W~k~~~--~---~~~r~~~------~~~~~L~i~~v~~~d~G~Y~C~~~n~~g~~~~  205 (326)
T PHA02785        137 STGEMVCPNINAFIASNVNADIIWSGHRR--L---RNKRLKQ------RTPGIITIEDVRKNDAGYYTCVLKYIYGDKTY  205 (326)
T ss_pred             CcEEEECCChhhcccCCCCceEEEccCCc--c---CCcceEe------cCCCeEEEeecChhhCeEEEEEEEeccCCEEE
Confidence            3344556     34567889999988642  1   1234443      235789999999999999999996521     


Q ss_pred             ---------C-----CC-----C--CCCCCcEEEEEEeEE------------ecC-------------------------
Q psy534           82 ---------R-----SP-----N--SHKNGTWFHLDVHGV------------FND-------------------------  103 (145)
Q Consensus        82 ---------~-----~~-----~--~~~~g~~~~l~c~~~------------~~~-------------------------  103 (145)
                               +     +|     .  ....|+.+.|.|...            ..+                         
T Consensus       206 ~~t~~v~l~V~~~~~pp~~~~p~~~~~~~G~~v~L~C~a~g~P~~~~~~v~W~kng~~i~~~~~~~~~~~~~~~~~~~~~  285 (326)
T PHA02785        206 NVTRIVKLEVRDRIIPPTMQLPEGVVTSIGSNLTIACRVSLRPPTTDADVFWISNGMYYEEDDEDGDGRISVANKIYTTD  285 (326)
T ss_pred             eEEEEEEEEEeccCCCceecCCCcEEecCCCcEEEEEEEECCCCCCCceEEEEECCEECCCcCCCCceeEEEecCccccc
Confidence                     0     11     0  013488999999810            000                         


Q ss_pred             -----CcEEEEcccCCCCCeeeEEEEecCCCCcEEE
Q psy534          104 -----GTELRISNIRSQDIGDYTCLATHVLYPDLLV  134 (145)
Q Consensus       104 -----~~~L~i~~v~~~d~G~Y~C~a~n~~g~~~~v  134 (145)
                           ...|.|.+|+.+|+|.|+|.|.|..|.+..+
T Consensus       286 ~~~~~~~~L~I~~V~~~D~G~Y~C~A~n~~~~~~~~  321 (326)
T PHA02785        286 KRRVITSRLNINPVKEEDATTFTCMAFTIPSISKTV  321 (326)
T ss_pred             cceeeeEEEEECCcchhcCeeeEEEEEeccCceEee
Confidence                 1268999999999999999999999855543


No 5  
>KOG4221|consensus
Probab=99.35  E-value=1.7e-11  Score=101.78  Aligned_cols=119  Identities=24%  Similarity=0.322  Sum_probs=88.1

Q ss_pred             ccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEecC--------
Q psy534           11 FQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLNR--------   82 (145)
Q Consensus        11 ~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~~--------   82 (145)
                      +.+..+-|-..+.|.|++.|.|+..+   ...++|+-.      ..++.|.|.+++..|.|.|+|.+....+        
T Consensus       155 g~ta~f~c~vn~e~~p~i~w~kn~~p---l~~~~r~i~------lpsG~L~I~~~qp~d~g~yrc~vt~g~~~r~S~~a~  225 (1381)
T KOG4221|consen  155 GQTALFSCEVNAEPVPTIMWLKNDQP---LPLDSRVIV------LPSGALEISGLQPSDTGEYRCVVTGGASQRTSNEAE  225 (1381)
T ss_pred             CCcEEEEEEEcCccCceeEEeccccc---ccCCCcEEE------cCCCcEEecccccCCCceEEEEEecCCcCCccceeE
Confidence            45566678777889999999999864   234557765      3499999999999999999999954321        


Q ss_pred             -----------------CCC--CCCCCcEEEEEEeE---------E---------------ecCCcEEEEcccCCCCCee
Q psy534           83 -----------------SPN--SHKNGTWFHLDVHG---------V---------------FNDGTELRISNIRSQDIGD  119 (145)
Q Consensus        83 -----------------~~~--~~~~g~~~~l~c~~---------~---------------~~~~~~L~i~~v~~~d~G~  119 (145)
                                       .|.  ....|+.+.|.|..         +               ...+.+|.|.+++..|+|.
T Consensus       226 ltv~s~~~~~~~~~fl~~p~~~~v~~g~~v~leCvvs~~p~p~v~Wlrng~~i~~ds~rivl~g~~slliS~a~~~dSg~  305 (1381)
T KOG4221|consen  226 LTVLSDPGALNKLVFLDEPSNAVVVEGDDVVLECVVSGVPKPSVKWLRNGEKISVDSYRIVLVGGSSLLISNATDDDSGK  305 (1381)
T ss_pred             EEecCCcccccceeeecCCCccccccCCcEEEEEEecCCCCCceEEeeCCeeeeecceEEEEecccceEEeccccccCce
Confidence                             111  13459999999981         0               1123578999999999999


Q ss_pred             eEEEEecC--CC---CcEEEEeCe
Q psy534          120 YTCLATHV--LY---PDLLVVLGS  138 (145)
Q Consensus       120 Y~C~a~n~--~g---~~~~v~~~~  138 (145)
                      |+|+|.|.  .+   ++|.|....
T Consensus       306 YtC~Atn~~D~idasaev~V~a~P  329 (1381)
T KOG4221|consen  306 YTCRATNTNDSIDASAEVTVLAPP  329 (1381)
T ss_pred             EEEEecCCCcccccceEEEEEcCC
Confidence            99999993  33   677776654


No 6  
>PHA02785 IL-beta-binding protein; Provisional
Probab=99.35  E-value=1.3e-11  Score=92.62  Aligned_cols=109  Identities=17%  Similarity=0.166  Sum_probs=76.4

Q ss_pred             hccceeeEEee-----cCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEecC--
Q psy534           10 IFQMLSVGDFA-----DDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLNR--   82 (145)
Q Consensus        10 ~~~~~~~~~w~-----~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~~--   82 (145)
                      .+.|+.+.|-.     .|.|.+.++|+|++.. .     .|.....     ....|.|.+++.+|+|.|+|.+.+...  
T Consensus        40 ~ge~~~l~C~~~~~~~~g~p~~~i~W~K~g~~-~-----~~~~~~~-----~g~~l~i~~~~~~DsG~Y~C~a~N~~g~~  108 (326)
T PHA02785         40 ENEPVILPCPQINTLSSGYNILDILWEKRGAD-N-----DRIIPID-----NGSNMLILNPTQSDSGIYICITKNETYCD  108 (326)
T ss_pred             cCCCEEEECCCccccccCCCCceEEEEECCCc-c-----ceEEEcc-----CCceEEEcccCcccCeEEEEEEECCCcce
Confidence            36788888875     5889999999999742 1     1222211     134588999999999999999965321  


Q ss_pred             -----------CC---------CCCCCCcEEEEEEeE-----------E---------------ecCCcEEEEcccCCCC
Q psy534           83 -----------SP---------NSHKNGTWFHLDVHG-----------V---------------FNDGTELRISNIRSQD  116 (145)
Q Consensus        83 -----------~~---------~~~~~g~~~~l~c~~-----------~---------------~~~~~~L~i~~v~~~d  116 (145)
                                 .+         .....|....+.|..           .               ...++.|.|.+++.+|
T Consensus       109 ~~s~~L~V~~~~~~~~~~~~~~~~~~~g~~~~i~C~~~~~~~~~~~~~~i~W~k~~~~~~~r~~~~~~~~L~i~~v~~~d  188 (326)
T PHA02785        109 MMSLNLTIVSVSESNIDLISYPQIVNERSTGEMVCPNINAFIASNVNADIIWSGHRRLRNKRLKQRTPGIITIEDVRKND  188 (326)
T ss_pred             EEEEEEEEEecCCCccceeeccceecccCcEEEECCChhhcccCCCCceEEEccCCccCCcceEecCCCeEEEeecChhh
Confidence                       11         112347778888950           0               0112479999999999


Q ss_pred             CeeeEEEEecCCC
Q psy534          117 IGDYTCLATHVLY  129 (145)
Q Consensus       117 ~G~Y~C~a~n~~g  129 (145)
                      +|.|+|.|.|..|
T Consensus       189 ~G~Y~C~~~n~~g  201 (326)
T PHA02785        189 AGYYTCVLKYIYG  201 (326)
T ss_pred             CeEEEEEEEeccC
Confidence            9999999999887


No 7  
>KOG4194|consensus
Probab=99.31  E-value=2.1e-11  Score=95.80  Aligned_cols=115  Identities=22%  Similarity=0.262  Sum_probs=87.0

Q ss_pred             hccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEecC-------
Q psy534           10 IFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLNR-------   82 (145)
Q Consensus        10 ~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~~-------   82 (145)
                      -++...+.|-+.|.|.|.|.|.|.++.........|.+...+     +..+-|.||+.+|+|.|.|.|.+...       
T Consensus       626 tg~mArl~CaAtG~P~PeIawqkdggtdFPAA~eRRl~Vmpe-----dd~f~Itnvk~eD~GiYtC~A~n~AG~isanAt  700 (873)
T KOG4194|consen  626 TGQMARLECAATGHPRPEIAWQKDGGTDFPAARERRLHVMPE-----DDVFFITNVKIEDQGIYTCTAQNVAGQISANAT  700 (873)
T ss_pred             cccceeeeeeccCCCCcceeehhcCCCCCchhhhheeeecCC-----CCEEEEecccccccceeEEeeeccccceeeceE
Confidence            345566789899999999999998876444445668887654     78899999999999999999976531       


Q ss_pred             -----CCC--------CCCCCcEEEEEEeE------------------------EecC-CcEEEEcccCCCCCeeeEEEE
Q psy534           83 -----SPN--------SHKNGTWFHLDVHG------------------------VFND-GTELRISNIRSQDIGDYTCLA  124 (145)
Q Consensus        83 -----~~~--------~~~~g~~~~l~c~~------------------------~~~~-~~~L~i~~v~~~d~G~Y~C~a  124 (145)
                           .|.        ....|+.+.|.|..                        .+.+ +-.|.+.+...+|+|.|+|..
T Consensus       701 L~V~e~p~f~~PL~~~~V~~get~vlqC~a~~~~a~pr~~W~k~d~pil~t~rh~f~d~dQllvv~~~~~~daG~yTcem  780 (873)
T KOG4194|consen  701 LTVLETPSFSIPLEDQLVVVGETLVLQCLAEGAPADPRLEWFKEDKPILITERHTFPDGDQLLVVKENLVEDAGIYTCEM  780 (873)
T ss_pred             EEEecCCcccccccceEEEecceEEEEEecCCCCCCccccccCCCCceEEeecccCCCCCeEEEEEehhhhhcceEEEEE
Confidence                 111        12349999999981                        1122 235777888899999999999


Q ss_pred             ecCCC
Q psy534          125 THVLY  129 (145)
Q Consensus       125 ~n~~g  129 (145)
                      .|..|
T Consensus       781 ~~~~~  785 (873)
T KOG4194|consen  781 SNTLG  785 (873)
T ss_pred             Eeecc
Confidence            99988


No 8  
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=99.28  E-value=1.7e-11  Score=72.97  Aligned_cols=62  Identities=19%  Similarity=0.288  Sum_probs=46.4

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+-|.+.|.|.|.+.|+|++... ... .+|+.+..+  ..+..+|.|.+++.+|+|.|.|.+.|.
T Consensus         2 ~l~C~v~G~P~P~i~W~k~~~~i-~~~-~~r~~~~~~--~~g~~~L~I~~~~~~D~G~Y~C~A~N~   63 (75)
T cd05892           2 KLECQISAIPPPKIFWKRNNEMV-QYN-TDRISLYQD--NSGRVTLLIKNVNKKDAGWYTVSAVNE   63 (75)
T ss_pred             EEEEEEEecCCCeEEEEECCEEC-cCC-CCeEEEEEc--CCCcEEEEECCCChhhCEEEEEEEEcC
Confidence            56788899999999999997542 211 246665432  123458999999999999999999864


No 9  
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=99.26  E-value=3.1e-11  Score=71.61  Aligned_cols=61  Identities=15%  Similarity=0.198  Sum_probs=44.9

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.|-+.|.|.|.+.|+|++..........|++...     ....|.|.+++.+|+|.|.|.|.+.
T Consensus         2 ~l~C~~~G~P~P~v~W~k~~~~~~~~~~~~~~~~~~-----~~~~L~I~~~~~~D~G~Y~C~A~N~   62 (75)
T cd05763           2 RLECAATGHPTPQIAWQKDGGTDFPAARERRMHVMP-----EDDVFFIVDVKIEDTGVYSCTAQNT   62 (75)
T ss_pred             EeEeecccccCCEEEEEeCCCccCCcccccceEEec-----CCCEEEEeeCCcccCEEEEEEEEcC
Confidence            457888899999999999875322222234444422     2568999999999999999999753


No 10 
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.26  E-value=2e-11  Score=72.35  Aligned_cols=60  Identities=20%  Similarity=0.218  Sum_probs=47.6

Q ss_pred             cceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+-|-+.|.|.|.+.|+|++....   -..|+.+.      .+++|.|.+++.+|+|.|.|.|.+.
T Consensus         2 ~~~~l~C~~~g~P~p~v~W~k~~~~l~---~~~r~~~~------~~g~L~I~~v~~~D~G~Y~C~A~N~   61 (73)
T cd05852           2 GRVIIECKPKAAPKPKFSWSKGTELLV---NNSRISIW------DDGSLEILNITKLDEGSYTCFAENN   61 (73)
T ss_pred             CeEEEEEecceeCCCEEEEEeCCEecc---cCCCEEEc------CCCEEEECcCChhHCEEEEEEEECC
Confidence            456788988999999999999875422   12466552      3678999999999999999999864


No 11 
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=99.26  E-value=2.3e-11  Score=72.47  Aligned_cols=61  Identities=18%  Similarity=0.220  Sum_probs=46.3

Q ss_pred             cceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..+.+.|-+.|.|.|.+.|+|++..........|...       .+++|.|.+++.+|+|.|.|.+.+
T Consensus         2 ~~v~l~C~~~G~P~p~i~W~k~g~~i~~~~~~~~~~~-------~~~~L~I~~~~~~D~G~Y~C~a~N   62 (76)
T cd05867           2 ETARLDCQVEGIPTPNITWSINGAPIEGTDPDPRRHV-------SSGALILTDVQPSDTAVYQCEARN   62 (76)
T ss_pred             CeEEEEEEeeEeCCCeEEEEECCEECCCCCCCceEEe-------eCCEEEECCCChhhCEEEEEEEEC
Confidence            4567889999999999999998854222122223332       267899999999999999999975


No 12 
>KOG4221|consensus
Probab=99.25  E-value=2e-11  Score=101.47  Aligned_cols=124  Identities=23%  Similarity=0.256  Sum_probs=93.2

Q ss_pred             HHhhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEecC---
Q psy534            6 AVKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLNR---   82 (145)
Q Consensus         6 ~~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~~---   82 (145)
                      ++...+.++.+-|-+.|.|.|.+.|.+++.. ++.+- .|+.+      .+.++|.|++++..|+|.|+|+|.+...   
T Consensus       247 ~~v~~g~~v~leCvvs~~p~p~v~Wlrng~~-i~~ds-~rivl------~g~~slliS~a~~~dSg~YtC~Atn~~D~id  318 (1381)
T KOG4221|consen  247 AVVVEGDDVVLECVVSGVPKPSVKWLRNGEK-ISVDS-YRIVL------VGGSSLLISNATDDDSGKYTCRATNTNDSID  318 (1381)
T ss_pred             cccccCCcEEEEEEecCCCCCceEEeeCCee-eeecc-eEEEE------ecccceEEeccccccCceEEEEecCCCcccc
Confidence            4566788999999999999999999998754 22221 45655      3488999999999999999999976321   


Q ss_pred             ---------CC------CC--CCCCcEEEEEEeE-----------------------EecCCcEEEEcccCCCCCeeeEE
Q psy534           83 ---------SP------NS--HKNGTWFHLDVHG-----------------------VFNDGTELRISNIRSQDIGDYTC  122 (145)
Q Consensus        83 ---------~~------~~--~~~g~~~~l~c~~-----------------------~~~~~~~L~i~~v~~~d~G~Y~C  122 (145)
                               +|      ..  +..+.++.+.|..                       ....+..|+|.-+-..|+|.|.|
T Consensus       319 asaev~V~a~P~~~~~p~~l~A~e~~die~ec~~~g~p~p~v~w~kNgd~~ipsdy~ki~~~~~lrIlgi~~sdeg~yQc  398 (1381)
T KOG4221|consen  319 ASAEVTVLAPPGFTKAPTTLVAHESMDIEFECPVSGKPIPTVRWYKNGDRIIPSDYFKIVGGGNLRILGIVKSDEGFYQC  398 (1381)
T ss_pred             cceEEEEEcCCCCCCCCcceeeeeccceeEeCCCCCCCcceEEEEecCcccCcccceEecCCCCcEEEEEecccchhhhh
Confidence                     11      11  2347788888971                       11223358999899999999999


Q ss_pred             EEecCCC-----CcEEEEeC
Q psy534          123 LATHVLY-----PDLLVVLG  137 (145)
Q Consensus       123 ~a~n~~g-----~~~~v~~~  137 (145)
                      .++|.+|     +++.|+.+
T Consensus       399 vaen~~G~a~a~a~l~vv~~  418 (1381)
T KOG4221|consen  399 VAENDAGSAQAAAQLEVVPQ  418 (1381)
T ss_pred             hhccCcccccchhhheeccC
Confidence            9999999     77777666


No 13 
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=99.23  E-value=2.8e-11  Score=73.91  Aligned_cols=69  Identities=17%  Similarity=0.193  Sum_probs=52.6

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ....+.++.+.|.+.|.|.|.+.|++++......  .+|+.+...   ...++|.|.++..+|+|.|.|.+.|.
T Consensus         6 ~v~~G~~v~l~c~~~G~P~P~v~W~k~~~~i~~~--~~r~~~~~~---~~~~~L~I~~~~~~D~G~Y~c~a~N~   74 (86)
T cd05894           6 VVVAGNKLRLDVPISGEPAPTVTWSRGDKAFTET--EGRVRVESY---KDLSSFVIEGAEREDEGVYTITVTNP   74 (86)
T ss_pred             EEEcCCEEEEEeeEeecCCCeEEEEECCEECccC--CCeEEEEEc---CCeEEEEECCCccCcCEEEEEEEEeC
Confidence            3456778999999999999999999998543221  235554321   23678999999999999999999864


No 14 
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=99.22  E-value=3.4e-11  Score=71.31  Aligned_cols=61  Identities=23%  Similarity=0.286  Sum_probs=47.3

Q ss_pred             ccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           11 FQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        11 ~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +..+.+.|-+.|.|.|.+.|+|++.. +..  ..+...      ..+++|.|.+++.+|+|.|.|.|.+.
T Consensus         2 G~~v~l~C~~~g~P~p~i~W~k~g~~-~~~--~~~~~~------~~~~~L~I~~v~~~D~G~Y~C~A~N~   62 (74)
T cd05745           2 GQTVDFLCEAQGYPQPVIAWTKGGSQ-LSV--DRRHLV------LSSGTLRISRVALHDQGQYECQAVNI   62 (74)
T ss_pred             CCeEEEEeECCEecCCEEEEEECCEE-CCC--CCCeEE------ccCCeEEEeeCCHHhCEEEEEEEEeC
Confidence            46778899999999999999998753 221  223333      23679999999999999999999864


No 15 
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=99.22  E-value=3.5e-11  Score=71.65  Aligned_cols=63  Identities=16%  Similarity=0.252  Sum_probs=46.1

Q ss_pred             eeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           14 LSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        14 ~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +.+-|.+.|.|.|.+.|+|++.....  -..|+.+..+  ..+..+|.|.+++.+|+|.|.|.|.|.
T Consensus         1 v~l~C~v~G~P~P~v~W~k~~~~l~~--~~~~~~~~~~--~~~~~~L~I~~v~~~D~G~Y~C~A~N~   63 (75)
T cd05893           1 VRLECRVSGVPHPQIFWKKENESLTH--NTDRVSMHQD--NCGYICLLIQGATKEDAGWYTVSAKNE   63 (75)
T ss_pred             CEEEEEEeEecCCEEEEEECCEECCC--CCCeEEEEEc--CCCEEEEEECCCCHHHCEEEEEEEEcC
Confidence            35679999999999999999854321  1245555322  112347999999999999999999863


No 16 
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=99.22  E-value=4.8e-11  Score=70.74  Aligned_cols=59  Identities=25%  Similarity=0.419  Sum_probs=45.4

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.|.+.|.|.|.+.|+|++.. +......|+..      ..+++|.|.+++.+|+|.|.|.+.+.
T Consensus         2 ~l~C~~~G~P~p~v~W~k~~~~-~~~~~~~~~~~------~~~g~L~i~~~~~~D~G~Y~C~a~N~   60 (74)
T cd05738           2 TMLCAASGNPDPEITWFKDFLP-VDTTSNGRIKQ------LRSGALQIENSEESDQGKYECVATNS   60 (74)
T ss_pred             EEEEEEeEecCCEEEEEECCEE-CccCCCCCEEE------cCCcEEEECCCChhhCEEEEEEEECC
Confidence            4678889999999999998753 22223345554      23678999999999999999999853


No 17 
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=99.19  E-value=1e-10  Score=70.13  Aligned_cols=60  Identities=27%  Similarity=0.396  Sum_probs=44.9

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccc-----cccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAE-----EYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~-----~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.|.+.|.|.|.+.|++++......     ...+|+...      .+++|.|.+++.+|+|.|.|.|.+.
T Consensus         2 ~l~C~~~G~P~P~v~W~~~~~~~~~~~~~~~~~~~r~~~~------~~~~L~I~~v~~~D~G~Y~C~a~N~   66 (79)
T cd05734           2 TLNCSAEGYPPPTIVWKHSKGRGHPQHTHTCCLAGRIQLL------SNGSLLIKHVLEEDSGYYLCKVSND   66 (79)
T ss_pred             EeEeeCeEeCCCEEEEEECCCccccccccccccCCCEEEe------cCCeEEECcCCcccCEEEEEEEEeC
Confidence            46798999999999999975321100     133555542      3689999999999999999999864


No 18 
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=99.18  E-value=1.2e-10  Score=69.92  Aligned_cols=63  Identities=14%  Similarity=0.179  Sum_probs=43.4

Q ss_pred             eEEeecCCCccEEEEecCCCCcccccc-cceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           16 VGDFADDEDIPVYIWYDSYPTHEAEEY-KGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        16 ~~~w~~g~p~p~~~w~k~~~~~~~~~~-~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +-|-+.|+|.|.+.|||++.......+ ..+.....  .....++|.|.+++.+|+|.|.|.|.|.
T Consensus         3 i~~~v~G~P~Pti~W~kng~~l~~~~~~~~~~~~~~--~~~~~~~L~i~~~~~~D~G~YtC~A~N~   66 (79)
T cd05855           3 IPFTVKGNPKPTLQWFHEGAILNESEYICTKIHVIN--NTEYHGCLQLDNPTHLNNGIYTLVAKNE   66 (79)
T ss_pred             EEEEEeEeCCCceEEEECCEECCCCcceeeeeEeec--ccceEEEEEECCCCcccCEEEEEEEEcC
Confidence            445667999999999999865322221 11111111  1233678999999999999999999864


No 19 
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=99.18  E-value=6e-11  Score=69.77  Aligned_cols=58  Identities=22%  Similarity=0.282  Sum_probs=44.4

Q ss_pred             eeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           14 LSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        14 ~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +.+.|.+.|.|.|.+.|++++.....    .+....     ....+|.|.+++.+|+|.|.|.|.+.
T Consensus         1 ~~L~C~~~G~P~P~v~W~k~~~~~~~----~~~~~~-----~~~~~L~I~~v~~~D~G~Y~C~a~N~   58 (71)
T cd05876           1 LVLECIAEGLPTPEVHWDRIDGPLSP----NRTKKL-----NNNKTLQLDNVLESDDGEYVCTAENS   58 (71)
T ss_pred             CEEEEEeeEecCCeEEEEECCcCCCC----CceeEE-----cCCCEEEEcccCHHhCEEEEEEEEcC
Confidence            35679999999999999999754321    122221     23789999999999999999999853


No 20 
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=99.18  E-value=6.5e-11  Score=69.19  Aligned_cols=58  Identities=19%  Similarity=0.266  Sum_probs=44.6

Q ss_pred             eeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           14 LSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        14 ~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +.+.|.+.|.|.|.+.|+|++.. +.  ...|..+      ..++.|.|.+++.+|+|.|.|.+.+.
T Consensus         1 v~L~C~~~g~P~p~i~W~k~g~~-~~--~~~~~~~------~~~~~L~I~~~~~~D~G~Y~C~a~N~   58 (69)
T cd05746           1 VQIPCSAQGDPEPTITWNKDGVQ-VT--ESGKFHI------SPEGYLAIRDVGVADQGRYECVARNT   58 (69)
T ss_pred             CEeEecceEeCCCEEEEEECCEE-CC--CCCCEEE------CCCCEEEECcCChhhCEEEEEEEECC
Confidence            35779889999999999998743 22  1234444      22678999999999999999999753


No 21 
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=99.18  E-value=1.9e-10  Score=69.71  Aligned_cols=67  Identities=19%  Similarity=0.174  Sum_probs=49.4

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.++.+.|.+.|.|.|.+.|+|++..........+...     .....+|.|.+++.+|+|.|.|.+.+.
T Consensus         7 ~~G~~~~L~C~~~g~P~p~i~W~k~g~~l~~~~~~~~~~~-----~~~~~~l~i~~~~~~D~G~Y~C~a~N~   73 (85)
T cd05857           7 PAANTVKFRCPAAGNPTPTMRWLKNGKEFKQEHRIGGYKV-----RNQHWSLIMESVVPSDKGNYTCVVENE   73 (85)
T ss_pred             CCCCEEEEEEEcCCCCCCEEEEEECCEECCCCCceeeeEE-----eCCceEEEEccCCcccCEEEEEEEEeC
Confidence            4577889999999999999999999754222111112222     123678999999999999999999863


No 22 
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=99.18  E-value=1.6e-10  Score=68.68  Aligned_cols=62  Identities=19%  Similarity=0.270  Sum_probs=45.7

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.|.+.|.|.|.+.|+|++.. +... ..|+.+..+  ..+..+|.|.+++.+|+|.|.|.+.+.
T Consensus         2 ~L~C~v~G~P~P~v~W~k~~~~-i~~~-~~r~~~~~~--~~~~~~L~I~~~~~~D~G~Y~C~a~N~   63 (75)
T cd05744           2 RLECRVSAIPPPQIFWKKNNEM-LTYN-TDRISLYQD--NCGRICLLIQNANKEDAGWYTVSAVNE   63 (75)
T ss_pred             EEEEEEeecCCCeEEEEECCEE-CCCC-CCcEEEEEc--CCCeEEEEECCCCcccCEEEEEEEEcC
Confidence            5678899999999999999854 2211 235554321  123457999999999999999999864


No 23 
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=99.17  E-value=1.6e-10  Score=69.18  Aligned_cols=63  Identities=22%  Similarity=0.395  Sum_probs=47.5

Q ss_pred             cceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.|-+.|.|.|.+.|++++.....   ..|+.+..   ..+.+.|.|.+++.+|+|.|.|.+.+.
T Consensus         2 ~~v~l~C~~~g~P~p~v~W~~~~~~~~~---~~~~~~~~---~~~~~~L~I~~v~~~D~G~Y~C~a~N~   64 (78)
T cd05743           2 ETVEFTCVATGVPTPIINWRLNWGHVPD---SARVSITS---EGGYGTLTIRDVKESDQGAYTCEAINT   64 (78)
T ss_pred             CEEEEEEEEEEecCCEEEEEECCeECCC---CCCEEEEE---CCCEEEEEECCCChHHCEEEEEEEEec
Confidence            4678889999999999999998753221   22443322   134678999999999999999999764


No 24 
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=99.17  E-value=4.2e-11  Score=70.68  Aligned_cols=57  Identities=21%  Similarity=0.204  Sum_probs=43.2

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.|.+.|.|.|.+.|+|++.+. ... ..+...       ...+|.|.+++.+|+|.|.|.+.+.
T Consensus         2 ~l~c~v~g~P~P~v~W~kdg~~l-~~~-~~~~~~-------~~~~L~I~~v~~~D~G~YtC~a~~~   58 (72)
T cd07702           2 RLTPKVKAFPAPEVIWLKDGLPA-AEK-CSRYHV-------DGYSLVIKDVTEEDAGIYTILLGIK   58 (72)
T ss_pred             eEEeeEEEcCCCeEEEEECCEEC-CCC-CcEEEe-------CCCEEEECcCCHHHCEEEEEEEEcc
Confidence            46788899999999999998542 211 123332       1458999999999999999999864


No 25 
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.17  E-value=1.5e-10  Score=70.90  Aligned_cols=63  Identities=25%  Similarity=0.344  Sum_probs=49.0

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+..+.+.|.+.|.|.|.+.|+|++... ...  .++..       .+..|.|.+++.+|+|.|.|.|.|.
T Consensus        13 ~~~G~~v~l~C~~~G~P~P~v~W~k~~~~~-~~~--~~~~~-------~~~~L~I~~v~~~D~G~Y~C~A~N~   75 (88)
T cd05851          13 ALKGQNVTLECFALGNPVPVIRWRKILEPM-PAT--AEISM-------SGAVLKIFNIQPEDEGTYECEAENI   75 (88)
T ss_pred             EeCCCcEEEEEEecccCCCEEEEEECCcCC-CCC--CEEec-------CCCEEEECcCChhhCEEEEEEEEcC
Confidence            346788999999999999999999987542 111  22221       2568999999999999999999864


No 26 
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=99.17  E-value=9.9e-11  Score=69.12  Aligned_cols=60  Identities=18%  Similarity=0.223  Sum_probs=47.0

Q ss_pred             cceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.|.+.|.|.|.+.|+|++... .  ...|+.+.      .+++|.|.+++.+|+|.|.|.+.+.
T Consensus         2 ~~v~L~C~~~g~P~p~v~W~k~~~~~-~--~~~~~~~~------~~~~L~i~~v~~~D~G~Y~C~a~N~   61 (73)
T cd04969           2 GDVIIECKPKAAPKPTISWSKGTELL-T--NSSRICIW------PDGSLEILNVTKSDEGKYTCFAENF   61 (73)
T ss_pred             CeEEEEEeeeEcCCCEEEEEECCEEc-c--cCCCEEEC------CCCeEEEccCChhHCEEEEEEEECC
Confidence            35678899999999999999997542 1  23455552      3578999999999999999999864


No 27 
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=99.16  E-value=4.8e-11  Score=69.49  Aligned_cols=52  Identities=17%  Similarity=0.256  Sum_probs=42.0

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.|.+.|.|.|.+.|||++.. +.    .+         .....|.|.++..+|+|.|.|.+.|.
T Consensus         2 ~l~c~v~g~P~P~v~W~kdg~~-l~----~~---------~~~~~L~i~~v~~~D~G~YtC~a~N~   53 (67)
T cd05863           2 KLPVKVAAYPPPEFQWYKDGKL-IS----GK---------HSQHSLQIKDVTEASAGTYTLVLWNS   53 (67)
T ss_pred             EEEEEEEEeCCCEEEEEECCEE-Cc----cc---------CCcCEEEECCCCHHHCEEEEEEEEEC
Confidence            4678889999999999999854 21    11         23678999999999999999999853


No 28 
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=99.16  E-value=1.6e-10  Score=68.96  Aligned_cols=59  Identities=20%  Similarity=0.321  Sum_probs=44.3

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.|.+.|.|.|.+.|+|++.. +... ..+..+.     ....+|.|.+++.+|+|.|.|.+.+.
T Consensus         2 ~L~C~~~g~P~p~v~W~k~g~~-l~~~-~~~~~~~-----~~~~~L~I~~~~~~D~G~Y~C~a~N~   60 (77)
T cd05760           2 TLRCHIDGHPRPTYQWFRDGTP-LSDG-QGNYSVS-----SKERTLTLRSAGPDDSGLYYCCAHNA   60 (77)
T ss_pred             EEEEEeeecCCCcEEEEECCEE-CCCC-CccEEEe-----CCCCEEEEeeCCcccCEEEEEEEEeC
Confidence            5678888999999999998754 2211 1233332     22568999999999999999999863


No 29 
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=99.15  E-value=1.4e-10  Score=68.15  Aligned_cols=58  Identities=16%  Similarity=0.197  Sum_probs=44.5

Q ss_pred             eeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           14 LSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        14 ~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +.+.|-+.|.|.|.+.|+|++.....   ..++.+.      .++.|.|.+++.+|+|.|.|.|.|.
T Consensus         2 v~l~C~~~G~P~p~v~W~k~g~~~~~---~~~~~~~------~~~~l~i~~v~~~D~G~Y~C~A~N~   59 (71)
T cd05723           2 VIFECEVTGKPTPTVKWVKNGDMVIP---SDYFKIV------KEHNLQVLGLVKSDEGFYQCIAEND   59 (71)
T ss_pred             EEEEEEEEEeCCCEEEEEECCeECCC---CCCEEEE------ecCCEEEEcCCcccCEEEEEEEEcC
Confidence            56789899999999999999854321   1234432      2567899999999999999999863


No 30 
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=99.15  E-value=2.5e-10  Score=67.51  Aligned_cols=61  Identities=16%  Similarity=0.187  Sum_probs=46.3

Q ss_pred             eeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           14 LSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        14 ~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +.+-|.+.|.|.|.+.|++++... .  ...|+.+..   ......|.|.+++.+|+|.|.|.+.|.
T Consensus         2 ~~l~c~~~G~P~p~v~W~k~g~~l-~--~~~~~~~~~---~~~~~~L~I~~~~~~D~G~Y~C~a~N~   62 (74)
T cd05748           2 VRLEVPISGRPTPTVTWSKDGKPL-K--LSGRVQIET---TASSTSLVIKNAERSDSGKYTLTLKNP   62 (74)
T ss_pred             EEEEeeEeeeCCCeEEEEECCEEc-C--CCCeEEEEE---CCCeEEEEECCCCcCcCEEEEEEEECC
Confidence            567788999999999999997542 1  223444422   134788999999999999999999853


No 31 
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=99.14  E-value=1.5e-10  Score=68.96  Aligned_cols=62  Identities=11%  Similarity=0.116  Sum_probs=45.3

Q ss_pred             cceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .++.+.|.+.|.|.|.++|++++... ......+...      .....|.|.+++.+|+|.|+|.|.+.
T Consensus         2 ~~~~l~C~a~G~P~P~i~W~k~g~~i-~~~~~~~~~~------~~~~~l~i~~v~~~D~G~Y~C~A~N~   63 (76)
T cd05868           2 EDGTLICRANGNPKPSISWLTNGVPI-EIAPTDPSRK------VDGDTIIFSKVQERSSAVYQCNASNE   63 (76)
T ss_pred             CCEEEEEEeeEeCCCeEEEEECCEEc-cccCCCceEE------ecCCEEEECCCCHhhCEEEEEEEEcC
Confidence            56788999999999999999987542 2111111111      11458999999999999999999763


No 32 
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=99.13  E-value=6e-10  Score=65.80  Aligned_cols=63  Identities=21%  Similarity=0.246  Sum_probs=44.6

Q ss_pred             eeeEEeecC-CCccEEEEecCCCCcccccccce-EEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           14 LSVGDFADD-EDIPVYIWYDSYPTHEAEEYKGR-ISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        14 ~~~~~w~~g-~p~p~~~w~k~~~~~~~~~~~~R-~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +.+.|.+.| .|.|.+.|+|++... ......+ ..+..   .....+|.|.+++.+|+|.|.|.+.+.
T Consensus         1 ~~l~C~~~g~~P~p~~~W~k~g~~l-~~~~~~~~~~~~~---~~~~~~L~I~~~~~~D~G~Y~C~a~N~   65 (75)
T cd05750           1 LVLKCEATSEYPSLRFKWFKDGKEL-NRKNKPRNIKIRN---KKKNSELQINKAKLADSGEYTCVVENI   65 (75)
T ss_pred             CEEEEEccCCCCCceEEEEcCCeec-cccCCcceEEEEe---cCceEEEEEccCCcccCeEEEEEEEEc
Confidence            357899998 999999999987542 2111111 11211   123678999999999999999999864


No 33 
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=99.13  E-value=1.2e-10  Score=68.57  Aligned_cols=55  Identities=20%  Similarity=0.234  Sum_probs=42.9

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      .+.|.+.|.|.|.+.|+|++.. +...  .+..       ....+|.|.+++.+|+|.|.|.+.+
T Consensus         2 ~l~c~v~g~P~p~v~W~k~g~~-l~~~--~~~~-------~~~~~L~I~~v~~~D~G~YtC~a~N   56 (71)
T cd04976           2 RLPVKVKAYPPPEIQWYKNGKL-ISEK--NRTK-------KSGHSLTIKDVTEEDAGNYTVVLTN   56 (71)
T ss_pred             EEEeEEEEeCCCEEEEEECCEE-CCCC--CEEE-------cCCCEEEECcCCHHHCEEEEEEEEc
Confidence            4678889999999999998754 2222  2222       2367899999999999999999985


No 34 
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=99.13  E-value=2.6e-10  Score=66.56  Aligned_cols=56  Identities=20%  Similarity=0.372  Sum_probs=43.9

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.|-+.|.|.|.+.|+|++...    ..+|....      ...+|.|.+++.+|+|.|.|.+.+.
T Consensus         2 ~l~C~~~g~P~p~v~W~k~~~~~----~~~~~~~~------~~~~L~I~~v~~~D~G~Y~C~a~N~   57 (69)
T cd05725           2 EFQCEVGGDPVPTVLWRKEDGEL----PKGRAEIL------DDKSLKIRNVTAGDEGSYTCEAENM   57 (69)
T ss_pred             EEEEECccCCCCEEEEEECCccC----CCCcEEEe------eCCEEEECcCChhHCEEEEEEEEcC
Confidence            46788889999999999986532    22344442      2668999999999999999999763


No 35 
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=99.12  E-value=3e-10  Score=70.87  Aligned_cols=71  Identities=23%  Similarity=0.337  Sum_probs=52.1

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCC-Cccc---ccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYP-THEA---EEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~-~~~~---~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +...+..+.+.|-+.|.|.|.+.|++... ..+.   ....+|+.+..   ..+..+|.|.+++.+|+|.|.|.|.+.
T Consensus        12 ~~~~G~~v~l~C~~~G~P~p~i~W~k~~~g~~~~~~~~~~~~r~~v~~---~~~~~~L~I~~v~~~D~G~Y~C~A~N~   86 (98)
T cd05870          12 TTVENGAATLSCKAEGEPIPEITWKRASDGHTFSEGDKSPDGRIEVKG---QHGESSLHIKDVKLSDSGRYDCEAASR   86 (98)
T ss_pred             EEcCCCcEEEEEecccCCCCeEEEEECCCCceeccCCcCcCceEEEee---cCCeeEEEEeeCCcCCCEEEEEEEecc
Confidence            34567889999999999999999998632 1111   12345666532   134678999999999999999999853


No 36 
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=99.12  E-value=3.8e-10  Score=69.29  Aligned_cols=63  Identities=19%  Similarity=0.352  Sum_probs=46.9

Q ss_pred             cceeeEEeecCCCccEEEEecCCCCccc-----ccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPTHEA-----EEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~~~~-----~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.|-+.|.|.|.+.|+|++...+.     .....|+.+.      .+++|.|.+++.+|+|.|+|.+.+.
T Consensus         2 ~~v~L~C~~~g~P~p~v~W~k~g~~~~~~~~~~~~~~~r~~v~------~~~~L~I~~v~~~D~G~Y~C~a~N~   69 (90)
T cd05726           2 RTVTFQCEATGNPQPAIFWQKEGSQNLLFSYQPPQSSSRFSVS------QTGDLTITNVQRSDVGYYICQTLNV   69 (90)
T ss_pred             CEEEEEEECCccCCCEEEEEeCCCcceeecccCCCCCCeEEEC------CCCeEEEeeCChhhCEEEEEEEEcC
Confidence            4567889888999999999998643210     1123455542      2568999999999999999999863


No 37 
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=99.11  E-value=3.2e-10  Score=70.34  Aligned_cols=64  Identities=20%  Similarity=0.197  Sum_probs=48.0

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccC-CCCCEEEEEEEEEe
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIR-ESDQGWYECKVVFL   80 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~-~~D~G~Y~C~~~~~   80 (145)
                      +.+.++.+.|-+.|.|.|.++|+|++.. +...-..|..+       .+++|.|.++. .+|+|.|+|.|.|.
T Consensus        17 ~~g~~v~l~C~~~G~P~P~i~W~k~g~~-l~~~~~~~~~~-------~~g~L~i~~~~~~~D~G~Y~C~A~N~   81 (94)
T cd05848          17 SDEKKVILNCEARGNPVPTYRWLRNGTE-IDTESDYRYSL-------IDGNLIISNPSEVKDSGRYQCLATNS   81 (94)
T ss_pred             CCCCEEEEEEEeeecCCCEEEEEECCeE-CccCCCceEEe-------eCCeEEEccCCccCcCEEEEEEEEcC
Confidence            4467889999999999999999998754 22221223332       25789999985 69999999999864


No 38 
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=99.11  E-value=4.7e-10  Score=67.71  Aligned_cols=64  Identities=11%  Similarity=0.067  Sum_probs=43.3

Q ss_pred             eEEeecCCCccEEEEecCCCCcccccccceEEEecC--CCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           16 VGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDK--ESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        16 ~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~--~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +-|-++|.|.|.++|||++....... ..+......  ......+.|.|.+++.+|+|.|+|.|.|.
T Consensus         3 i~~~v~G~P~P~v~W~k~g~~i~~~~-~~~~~~~~~~~~~~~~~~~L~I~~~~~~D~G~YtC~A~N~   68 (81)
T cd04971           3 IPFTVRGNPKPTLTWYHNGAVLNESD-YIRTEIHYEVTTPTEYHGCLQFDNPTHVNNGNYTLVASNE   68 (81)
T ss_pred             EEEEeEeeCCCcEEEEECCEECcCCC-ceeEEEEeecccccccEEEEEECCCCcccCeEEEEEEEeC
Confidence            45667899999999999985432222 111111110  01233678999999999999999999864


No 39 
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=99.11  E-value=4.4e-10  Score=67.38  Aligned_cols=63  Identities=14%  Similarity=0.189  Sum_probs=45.3

Q ss_pred             cceeeEEeecCCCccEEEEecCCCC----cccc-cccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPT----HEAE-EYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~----~~~~-~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.|.+.|.|.|.+.|||+...    .+.+ .+..++..      ...++|.|.+++.+|+|.|+|.+.+.
T Consensus         2 ~~v~l~C~~~g~P~p~v~W~k~~~~~~~~~~~~~~~~~~~~~------~~~~~L~I~~~~~~D~G~Y~C~a~N~   69 (81)
T cd05765           2 ETASFHCDVTGRPPPEITWEKQVHGKENLIMRPNHVRGNVVV------TNIGQLVIYNAQPQDAGLYTCTARNS   69 (81)
T ss_pred             CcEEEEeeccccCCCcEEEEecCCCCcceeecCCcccCCEEE------ccccEEEEccCCcccCEEEEEEEecC
Confidence            4678899999999999999997421    1111 11122222      23578999999999999999999864


No 40 
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=99.11  E-value=1.4e-10  Score=68.14  Aligned_cols=55  Identities=15%  Similarity=0.117  Sum_probs=42.3

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+-|.+.|.|.|.+.|||++... ...  .++.        ....|.|.++..+|+|.|.|.+.|.
T Consensus         2 ~~~c~v~G~P~P~v~W~k~g~~l-~~~--~~~~--------~~~~L~I~~v~~~D~G~YtC~a~N~   56 (70)
T cd05864           2 KIPVKYYGYPPPEVKWYKNGQLI-VLN--HTFK--------RGVHLTIYEVTEKDAGNYTVVLTNP   56 (70)
T ss_pred             EEEeEEEEeCCCEEEEEECCEEC-CCC--CEEc--------cCCEEEECcCCHHHCEEEEEEEEEC
Confidence            35688899999999999998542 221  1221        2567999999999999999999864


No 41 
>KOG4222|consensus
Probab=99.11  E-value=6.1e-10  Score=92.38  Aligned_cols=114  Identities=26%  Similarity=0.306  Sum_probs=79.4

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCCCccccc-ccceEEEecCCCCCCeeeEEEccc----C-CCCCEEEEEEEEEecC
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEE-YKGRISRVDKESPFGMASLNLTKI----R-ESDQGWYECKVVFLNR   82 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~-~~~R~~~~~~~~~~~~~sL~I~~v----~-~~D~G~Y~C~~~~~~~   82 (145)
                      +-..|...=|-+.|.|.|.|.|||++......+ -.-|+.       ..+++|.+..+    + ..|.|.|+|.+.+...
T Consensus        44 s~~~patlnc~asG~ppPti~w~k~G~~~~~~e~~shR~~-------lp~gsLf~l~~ahg~~a~~d~G~y~cvasn~~g  116 (1281)
T KOG4222|consen   44 SKGEPATLNCKASGDPPPTIEWYKDGENVFKGEPGSHRFL-------LPDGSLFLLRLAHGKKAGHDHGVYSCVASNRLG  116 (1281)
T ss_pred             cCCCCceeecCCCCCCCCceecccCCcccCCCCCCCccee-------cCCccEEEEecccCCcccCCCceeEeeecCccc
Confidence            445566667888899999999999985322222 222433       23677666433    1 3399999999954320


Q ss_pred             --------------------CC--CCCCCCcEEEEEEe--------------------------EEecCCcEEEEcccCC
Q psy534           83 --------------------SP--NSHKNGTWFHLDVH--------------------------GVFNDGTELRISNIRS  114 (145)
Q Consensus        83 --------------------~~--~~~~~g~~~~l~c~--------------------------~~~~~~~~L~i~~v~~  114 (145)
                                          .+  .....|+.+.|.|.                          ....+++.|.|.+++.
T Consensus       117 ~avSr~a~L~vavlrddfrv~prd~~~a~ge~avlEcgpP~ghpeptvSw~Kdg~pl~~~~~~~~~lisgG~LlIsnvrk  196 (1281)
T KOG4222|consen  117 EAVSRGASLIVAVLRDDFRVSPRDVQAAVGEEAVLECGPPRGHPEPTVSWVKDGKPLDHYDVPIIALISGGNLLISNVRK  196 (1281)
T ss_pred             eeeecCceEEEEEechhcccCcccccccccceeEEeccCCCCCCCCcceeecCCCccccccceeEEEecCCcEEEecccc
Confidence                                11  23456999999997                          0123455899999999


Q ss_pred             CCCeeeEEEEecCCC
Q psy534          115 QDIGDYTCLATHVLY  129 (145)
Q Consensus       115 ~d~G~Y~C~a~n~~g  129 (145)
                      +|+|.|.|+|.|.+|
T Consensus       197 sD~GtY~CVatNmvG  211 (1281)
T KOG4222|consen  197 SDEGTYACVATNMVG  211 (1281)
T ss_pred             CCCceeeeeeccccc
Confidence            999999999999999


No 42 
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=99.10  E-value=2.9e-10  Score=67.40  Aligned_cols=62  Identities=16%  Similarity=0.167  Sum_probs=45.7

Q ss_pred             cceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.|-+.|.|.|.+.|++++..... ....+...      .....|.|.+++.+|+|.|+|.|.+.
T Consensus         2 ~~~~l~C~~~g~P~p~i~W~~~g~~~~~-~~~~~~~~------~~~~~L~i~~v~~~D~G~Y~C~A~N~   63 (76)
T cd04978           2 ETGRLDCEAEGIPQPTITWRLNGVPIEE-LPPDPRRR------VDGGTLILSNVQPNDTAVYQCNASNV   63 (76)
T ss_pred             CeEEEEEEceeeCCCEEEEEECCEECCC-CCCcceEE------ccCCEEEECCCChhhCEEEEEEEEcc
Confidence            4577889999999999999998754221 11111111      23688999999999999999999753


No 43 
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=99.10  E-value=3.4e-10  Score=69.80  Aligned_cols=64  Identities=16%  Similarity=0.190  Sum_probs=51.1

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +...+.++.+.|-+.|. .|.+.|+|++...    ..+|+.+.     ....+|.|.+++++|+|.|+|.|.+.
T Consensus        14 ~v~~g~~v~l~C~a~g~-~p~i~W~kng~~l----~~~~~~~~-----~~~~~L~I~~v~~~D~G~Y~C~a~N~   77 (91)
T cd05740          14 PPEDNQPVTLTCEAEGQ-ATYIWWVNNGSLL----VPPRLQLS-----NDNRTLTFNNVTRSDTGHYQCEASNE   77 (91)
T ss_pred             ccccCCcEEEEEEeCCC-CCEEEEEECCEEC----CCCCEEEe-----CCCCEEEECcCChhhCEEEEEEEEcC
Confidence            56778899999999999 9999999997542    22445442     23578999999999999999999853


No 44 
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=99.10  E-value=1.5e-10  Score=72.81  Aligned_cols=75  Identities=15%  Similarity=0.104  Sum_probs=53.2

Q ss_pred             chHHHhhhccceeeEEeecC-CCccEEEEecCCCCcccccccceEEEecCC--CCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            3 NSFAVKSIFQMLSVGDFADD-EDIPVYIWYDSYPTHEAEEYKGRISRVDKE--SPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         3 ~~~~~~~~~~~~~~~~w~~g-~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~--~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +.......+.++.+.|-+.| .|+|.+.|+|++.+. ....  +......+  ......+|.|.+++++|+|.|+|.|.|
T Consensus        10 ~~~~~v~~G~~v~L~c~v~g~~P~p~v~W~Kdg~~i-~~~~--~~~~~~~~~~~~~~~~~L~i~~v~~~D~G~Ytc~A~N   86 (101)
T cd04975          10 NTTIFVNLGENLNLVVEVEAYPPPPHINWTYDNRTL-TNKL--TEIVTSENESEYRYVSELKLVRLKESEAGTYTFLASN   86 (101)
T ss_pred             CceEEEECCCCEEEEEEEEecCCCCccEEEeCCeeC-CCCc--ceeEEEeccCcceEEEEEEEeecCHhhCeeEEEEEEC
Confidence            44556677888999999999 899999999998543 2221  11111110  011257899999999999999999985


Q ss_pred             e
Q psy534           80 L   80 (145)
Q Consensus        80 ~   80 (145)
                      .
T Consensus        87 ~   87 (101)
T cd04975          87 S   87 (101)
T ss_pred             C
Confidence            3


No 45 
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=99.09  E-value=6.9e-10  Score=69.33  Aligned_cols=66  Identities=21%  Similarity=0.332  Sum_probs=51.0

Q ss_pred             eeeEEeecCCCccEEEEecCCCCc---ccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           14 LSVGDFADDEDIPVYIWYDSYPTH---EAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        14 ~~~~~w~~g~p~p~~~w~k~~~~~---~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ...+.|.+..+.+.+.||+++...   ...+|++|+.+..+....++.+|.|.+++.+|+|.|+|.+.+
T Consensus        18 ~~~v~W~k~~~~~~v~~~~~~~~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~v~~   86 (100)
T cd05713          18 HMEVRWFRSQFSPAVHLYRDGQDQYGEQMPEYRGRTELLKDAIAEGSVALRIHNVRASDEGLYTCFFQS   86 (100)
T ss_pred             eeEEEEEECCCceeEEEEcCCcccccccCccccceEEeecccccCCcEEEEEEcCChhhCEEEEEEEec
Confidence            345779998777788888765432   335688999886554556789999999999999999999974


No 46 
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=99.08  E-value=7.6e-10  Score=68.54  Aligned_cols=70  Identities=20%  Similarity=0.348  Sum_probs=51.8

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccc--cccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAE--EYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~--~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+.++.+.|.+.|.|.|.+.|++++......  ...+|+....   ......|.|.+++.+|+|.|.|.+.+.
T Consensus        13 ~~~g~~v~l~C~~~g~p~p~v~W~~~~~~~~~~~~~~~~~~~~~~---~~~~~~L~I~~v~~~D~G~Y~C~a~N~   84 (96)
T cd05732          13 AVELEQITLTCEAEGDPIPEITWRRATRNFSEGDKSLDGRIVVRG---HARVSSLTLKDVQLTDAGRYDCEASNR   84 (96)
T ss_pred             EecCCcEEEEEEEeEcCCCcEEEEECCcccCCCCccccceEEEeC---CccEEEEEECcCCcCcCEEeEEEEEeC
Confidence            345678899999999999999999987432211  1234554422   133678999999999999999999864


No 47 
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=99.08  E-value=8.6e-10  Score=68.66  Aligned_cols=68  Identities=24%  Similarity=0.320  Sum_probs=49.9

Q ss_pred             hccceeeEEeecCCCccEEEEecCCCCcccc--cccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           10 IFQMLSVGDFADDEDIPVYIWYDSYPTHEAE--EYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        10 ~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~--~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+..+.+.|.+.|.|.|.+.|++++......  ...+|+.+...   ...+.|.|.+++.+|+|.|.|.|.+.
T Consensus        16 ~g~~v~l~C~~~G~P~P~v~W~~~~~~~~~~~~~~~~~~~v~~~---~~~~~L~I~~v~~~D~G~Y~C~A~N~   85 (97)
T cd05869          16 LEEQITLTCEASGDPIPSITWRTSTRNISSEEKTLDGHIVVRSH---ARVSSLTLKYIQYTDAGEYLCTASNT   85 (97)
T ss_pred             cCCCEEEEEEeeEeCCCEEEEEECCccccCCccccCccEEEEcC---ccEEEEEEecCccCcCEEEEEEEecC
Confidence            4577889999999999999999986432211  12345443221   23478999999999999999999764


No 48 
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=99.07  E-value=6e-10  Score=68.39  Aligned_cols=67  Identities=12%  Similarity=0.047  Sum_probs=49.6

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+.++.+.|.+.|.|.|.+.|++++......   .+... .  ......+|.|.+++.+|.|.|.|.|.+.
T Consensus        12 v~~G~~v~l~C~~~G~P~p~v~W~~~g~~~~~~---~~~~~-~--~~~~~~~L~I~~v~~~D~g~Y~C~A~N~   78 (90)
T cd04972          12 VYEGGTATIRCTAEGSPLPKVEWIIAGLIVIQT---RTDTL-E--TTVDIYNLQLSNITSETQTTVTCTAENP   78 (90)
T ss_pred             EcCCCcEEEEEEEEEcCCCeEEEEECCEEccCC---ccEEE-E--ecCCEEEEEEecCCcccCEEEEEEEECC
Confidence            456889999999999999999999998532111   11111 0  0123678999999999999999999853


No 49 
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=99.06  E-value=1e-09  Score=65.53  Aligned_cols=60  Identities=15%  Similarity=0.190  Sum_probs=43.6

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCC----CCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRE----SDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~----~D~G~Y~C~~~~~   80 (145)
                      .+.|-+.|.|.|.+.|+|++.. +......++...     ..+++|.|.+++.    +|+|.|.|.|.|.
T Consensus         2 ~l~C~~~G~P~P~v~W~k~g~~-l~~~~~~~~~~~-----~~~g~L~i~~~~~~~~~~d~G~Y~C~A~N~   65 (77)
T cd05733           2 VIKCEAKGNPPPTFSWTRNGTH-FDPEKDPRVTMK-----PDSGTLVIDNMNGGRAEDYEGEYQCYASNE   65 (77)
T ss_pred             EEEeeCcccCCCeEEEEECCeE-CCCCCCCCEEEe-----CCCCEEEEeccCCCCCcCCCEEEEEEEEcC
Confidence            4678888999999999998753 222223344432     2378899998854    7999999999864


No 50 
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=99.06  E-value=1.2e-09  Score=67.17  Aligned_cols=69  Identities=12%  Similarity=0.089  Sum_probs=44.6

Q ss_pred             cceeeEEeecCCCccEEEEecCCC---CcccccccceEEEecC----CCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYP---THEAEEYKGRISRVDK----ESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~---~~~~~~~~~R~~~~~~----~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.|.+.|.|.|.+.|+|++.   ..+...-..+...+..    ........|.|.+++.+|+|.|.|.|.+.
T Consensus         2 ~~v~l~C~v~g~P~P~i~W~k~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~A~N~   77 (90)
T cd04974           2 SDVEFHCKVYSDAQPHIQWLKHVEVNGSKYGPDGLPYVTVLKVAGINTTDNESEVLYLRNVSFDDAGEYTCLAGNS   77 (90)
T ss_pred             CcEEEEEEEeCCCCCeEEEEEecccCCceeCCCCCceEEEEEecCCcccccccceEEEeccccccCcEEEEEeecc
Confidence            456788999999999999999641   1111110111111110    01123468999999999999999999864


No 51 
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=99.05  E-value=8e-10  Score=68.15  Aligned_cols=69  Identities=16%  Similarity=0.056  Sum_probs=50.7

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +...+..+.+.|-+.|.|.|.+.|+|++.. +.  ...++.+...  .....+|.|.+++.+|+|.|.|.+.+.
T Consensus        12 ~v~~G~~v~L~C~v~G~P~p~v~W~k~g~~-l~--~~~~~~~~~~--~~~~~~L~I~~v~~~D~G~Y~C~a~N~   80 (92)
T cd05737          12 TIMEGKTLNLTCTVFGDPDPEVSWLKNDQA-LA--LSDHYNVKVE--QGKYASLTIKGVSSEDSGKYGIVVKNK   80 (92)
T ss_pred             EEeCCCcEEEEEEEEecCCCeEEEEECCEE-Cc--cCCCEEEEEc--CCCEEEEEEccCChhhCEEEEEEEEEC
Confidence            345677889999999999999999999754 22  2233333211  012468999999999999999999863


No 52 
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=99.05  E-value=6.2e-10  Score=70.94  Aligned_cols=66  Identities=24%  Similarity=0.249  Sum_probs=52.4

Q ss_pred             eeeEEeecCC-----CccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           14 LSVGDFADDE-----DIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        14 ~~~~~w~~g~-----p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ...+.|.+..     ....+.++.++.....++|++|+++..++...++.+|+|++++.+|+|.|+|.+..
T Consensus        23 ~~~I~W~k~~~~~~~~~~~v~v~~~~~~~~~~~y~gRvsl~~~~~~~~~asL~i~nv~~~D~G~Y~C~v~~   93 (110)
T cd05902          23 GPRIKWTKLRPASGQKQRPVLVARDNVVRVAKAFQGRVSLPGYPKNRYNASLVLSRLRYSDSGTYRCEVVL   93 (110)
T ss_pred             CCEEEEEEeCCCCCceEEEEEECCCCcEEEchhcccEEEeecCCCCCceEEEEECCCCHHHCEEEEEEEEE
Confidence            3677898843     23445677776555678999999998766677899999999999999999999974


No 53 
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=99.04  E-value=5.7e-10  Score=69.08  Aligned_cols=63  Identities=24%  Similarity=0.247  Sum_probs=47.1

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccC-CCCCEEEEEEEEEe
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIR-ESDQGWYECKVVFL   80 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~-~~D~G~Y~C~~~~~   80 (145)
                      ....++.+-|.+.|.|.|.++|+|++... .. ...|..+       .+++|.|.++. .+|+|.|.|.|.|.
T Consensus        17 ~~~~~v~l~C~a~G~P~P~i~W~k~~~~i-~~-~~~~~~~-------~~g~L~I~~~~~~~D~G~Y~C~A~N~   80 (93)
T cd05849          17 STEGKVSVNCRARANPFPIYKWRKNNLDI-DL-TNDRYSM-------VGGNLVINNPDKYKDAGRYVCIVSNI   80 (93)
T ss_pred             ccCCeEEEeCcCccCCCCEEEEEECCEEc-cC-CCCeEEE-------ECCEEEECcCCcCCCCEEEEEEEEeC
Confidence            33456888899999999999999997542 11 1234433       26789999985 69999999999864


No 54 
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=99.04  E-value=1.1e-09  Score=65.02  Aligned_cols=60  Identities=17%  Similarity=0.299  Sum_probs=45.7

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.|-+.|.|.|.+.|+|++.. +......++....     ....|.|.+++.+|+|.|.|.+.+.
T Consensus         2 ~L~C~v~g~P~p~v~W~k~~~~-l~~~~~~~~~~~~-----~~~~l~I~~~~~~D~G~Y~C~a~N~   61 (76)
T cd05736           2 SLRCHAEGIPLPRLTWLKNGMD-ITPKLSKQLTLIA-----NGSELHISNVRYEDTGAYTCIAKNE   61 (76)
T ss_pred             EeEeEeeecCCCEEEEEECCEE-CCCCCCccEEEeC-----CCCEEEECcCCcccCEEEEEEEEcC
Confidence            4678888999999999999754 3334445555432     2457999999999999999999853


No 55 
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=99.03  E-value=9.6e-10  Score=68.14  Aligned_cols=62  Identities=16%  Similarity=0.185  Sum_probs=46.1

Q ss_pred             ccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccC-CCCCEEEEEEEEEe
Q psy534           11 FQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIR-ESDQGWYECKVVFL   80 (145)
Q Consensus        11 ~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~-~~D~G~Y~C~~~~~   80 (145)
                      +..+.+.|.+.|+|.|.++|++++... ......+..+       .+++|.|.++. .+|+|.|+|.|.|.
T Consensus        19 g~~v~l~C~a~g~P~p~i~W~~~g~~l-~~~~~~~~~~-------~~g~L~I~~~~~~~D~G~Y~C~A~N~   81 (94)
T cd05850          19 EEKVTLGCRARASPPATYRWKMNGTEI-KFAPESRYTL-------VAGNLVINNPQKARDAGSYQCLAINR   81 (94)
T ss_pred             CCeEEEEeEceeCCCCEEEEEECCEEC-ccCCCceEEE-------ECCeEEEccCCccCcCEEEEEEEEcC
Confidence            457889999999999999999987542 2112233333       15789998865 69999999999864


No 56 
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=99.03  E-value=5.1e-10  Score=67.09  Aligned_cols=65  Identities=17%  Similarity=0.220  Sum_probs=48.8

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+.++.+.|.+.|.|.|.+.|++++.......   ....     .....+|.|.+++.+|+|.|.|.+.+.
T Consensus         6 ~~~G~~v~L~C~~~g~p~p~i~W~k~~~~~~~~~---~~~~-----~~~~~~L~i~~v~~~D~G~Y~C~a~N~   70 (82)
T cd05856           6 RPVGSSVRLKCVASGNPRPDITWLKDNKPLTPTE---IGES-----RKKKWTLSLKNLKPEDSGKYTCHVSNR   70 (82)
T ss_pred             ccCCCeEEEEEEeeEeCCCcEEEEECCcCCcCCc---ccee-----cCceEEEEEccCChhhCEEEEEEEEcC
Confidence            4567789999999999999999999875422111   1111     123678999999999999999999753


No 57 
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=99.03  E-value=1e-09  Score=67.81  Aligned_cols=67  Identities=16%  Similarity=0.115  Sum_probs=49.5

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+..+.+-|.+.|.|. .+.||+.++..+..  ..|+.+..+   ....+|.|.+++.+|+|.|+|.|.+.
T Consensus        12 v~~G~~v~l~C~~~G~P~-~v~W~k~~g~~~~~--~~r~~~~~~---g~~~~L~I~~v~~~D~G~Y~C~A~N~   78 (92)
T cd05866          12 LSVGESKFFTCTAIGEPE-SIDWYNPQGEKIVS--SQRVVVQKE---GVRSRLTIYNANIEDAGIYRCQATDA   78 (92)
T ss_pred             EcCCCeEEEEEEEEEeCC-eEEEEeCCCeEecC--CCCEEEEeC---CCeeEEEEecCChHHCEEEEEEEEcC
Confidence            456788999999999998 89999864432322  245554321   12458999999999999999999864


No 58 
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=99.03  E-value=2.3e-09  Score=66.76  Aligned_cols=69  Identities=19%  Similarity=0.129  Sum_probs=48.9

Q ss_pred             hhhccceeeEEeecCCCc-cEEEEec-CCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDI-PVYIWYD-SYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~-p~~~w~k-~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+.++.+.|-+.|.|. |.+.|++ ++.. +... ..|+....+  ....++|.|.+++.+|+|.|+|.|.|.
T Consensus        12 v~~G~~v~l~C~v~G~P~~p~i~W~~~~g~~-l~~~-~~r~~v~~~--~~~~~~L~I~~v~~~D~G~YtC~A~N~   82 (96)
T cd05865          12 ISVGESKFFLCQVAGEAKDKDISWFSPNGEK-LTPN-QQRISVVRN--DDYSSTLTIYNANIDDAGIYKCVVSNE   82 (96)
T ss_pred             ECCCCeEEEEEEEeCCCCCCEEEEECCCCcC-cccc-CCeEEEEeC--CCCceEEEEeccChhhCEEEEEEEEcC
Confidence            456778899999999985 7999998 4532 2211 224443221  112478999999999999999999864


No 59 
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=99.03  E-value=6.3e-10  Score=68.88  Aligned_cols=67  Identities=13%  Similarity=0.148  Sum_probs=50.5

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +...+..+.+.|.+.|.|.|.+.|++++.. +... ..+..+..     ....|.|.+++.+|+|.|.|.+.+.
T Consensus        14 ~~~~G~~v~L~C~~~g~P~p~v~W~k~g~~-~~~~-~~~~~~~~-----~~~~L~I~~v~~~D~G~Y~C~a~N~   80 (95)
T cd05730          14 TANLGQSVTLACDADGFPEPTMTWTKDGEP-IESG-EEKYSFNE-----DGSEMTILDVDKLDEAEYTCIAENK   80 (95)
T ss_pred             EEeCCCCEEEEEeccEeCCCEEEEEECCEE-CcCC-CCEEEEeC-----CCCEEEECCCChhhCEEEEEEEEcC
Confidence            345678899999999999999999998754 2211 23443321     2457999999999999999999853


No 60 
>KOG4194|consensus
Probab=99.02  E-value=3.7e-09  Score=83.50  Aligned_cols=128  Identities=20%  Similarity=0.242  Sum_probs=82.7

Q ss_pred             hccceeeEEeecC--CCccEEEEecCCCCcccccccceEEEecC-------CCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           10 IFQMLSVGDFADD--EDIPVYIWYDSYPTHEAEEYKGRISRVDK-------ESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        10 ~~~~~~~~~w~~g--~p~p~~~w~k~~~~~~~~~~~~R~~~~~~-------~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ++..+...|-+-+  ..+-++.|-+++....+....+-+++...       +.....+.|.+.||+..|.|.|+|.+.+-
T Consensus       517 ~g~nirftC~a~sssasplsi~WR~dnevq~rv~ved~a~~~~q~r~~~~~e~~~~~~~L~L~nVt~td~grYQCVvtN~  596 (873)
T KOG4194|consen  517 IGENIRFTCNAYSSSASPLSIEWRKDNEVQPRVDVEDFATFLSQNRNGTFGEREEYTAILHLDNVTFTDEGRYQCVVTNH  596 (873)
T ss_pred             hccceEEEEEeccCCCCCceeEeeeccccCcccchhcchhhhhhhccCccchhhhhhheeeeeeeecccCceEEEEEecc
Confidence            3455666777765  34557889888753222222222222111       11122567999999999999999999653


Q ss_pred             cC--------------------CCC-CCCCCcEEEEEEeE---------------------------EecCCcEEEEccc
Q psy534           81 NR--------------------SPN-SHKNGTWFHLDVHG---------------------------VFNDGTELRISNI  112 (145)
Q Consensus        81 ~~--------------------~~~-~~~~g~~~~l~c~~---------------------------~~~~~~~L~i~~v  112 (145)
                      -.                    |.+ +...|+...|.|..                           ...++..+.|.+|
T Consensus       597 FGStysqk~KltV~~~PsFtktP~dltl~tg~mArl~CaAtG~P~PeIawqkdggtdFPAA~eRRl~Vmpedd~f~Itnv  676 (873)
T KOG4194|consen  597 FGSTYSQKAKLTVNQAPSFTKTPEDLTLRTGQMARLECAATGHPRPEIAWQKDGGTDFPAARERRLHVMPEDDVFFITNV  676 (873)
T ss_pred             cCcchhheeEEEeeccCccccCcccceeecccceeeeeeccCCCCcceeehhcCCCCCchhhhheeeecCCCCEEEEecc
Confidence            10                    111 12358888889971                           1234457899999


Q ss_pred             CCCCCeeeEEEEecCCC-----CcEEEEeC
Q psy534          113 RSQDIGDYTCLATHVLY-----PDLLVVLG  137 (145)
Q Consensus       113 ~~~d~G~Y~C~a~n~~g-----~~~~v~~~  137 (145)
                      +.+|+|.|+|.|+|.+|     ..++|..-
T Consensus       677 k~eD~GiYtC~A~n~AG~isanAtL~V~e~  706 (873)
T KOG4194|consen  677 KIEDQGIYTCTAQNVAGQISANATLTVLET  706 (873)
T ss_pred             cccccceeEEeeeccccceeeceEEEEecC
Confidence            99999999999999998     55555544


No 61 
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=99.02  E-value=1.8e-09  Score=64.45  Aligned_cols=60  Identities=12%  Similarity=0.170  Sum_probs=42.6

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCC----CCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRE----SDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~----~D~G~Y~C~~~~~   80 (145)
                      .+.|-+.|.|.|.+.|+|++.. +......+..+.     ..+++|.|..++.    .|.|.|+|.|.+.
T Consensus         2 ~l~C~a~G~P~P~i~W~k~g~~-l~~~~~~~~~~~-----~~~g~l~i~~~~~~~~~~d~G~Y~C~A~N~   65 (77)
T cd05874           2 VIQCEAKGKPPPSFSWTRNGTH-FDIDKDPKVTMK-----PNTGTLVINIMNGEKAEAYEGVYQCTARNE   65 (77)
T ss_pred             EEEeeCcccCCCeEEEEECCeE-CCCcCCCCEEEe-----CCCceEEEeccccCCCCCCCEEEEEEEEcC
Confidence            4678888999999999998753 222222333332     2368899988764    4889999999863


No 62 
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=99.02  E-value=1.4e-09  Score=64.26  Aligned_cols=61  Identities=15%  Similarity=0.194  Sum_probs=45.2

Q ss_pred             cceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.|.+.|.|.|.+.|++.+...+...  .|...      ..+++|.|.+++.+|+|.|.|.+.+.
T Consensus         2 ~~~~l~C~~~g~P~p~v~W~~~~~~~~~~~--~~~~~------~~~~~L~i~~~~~~D~G~Y~C~a~N~   62 (74)
T cd05764           2 QRATLRCKARGDPEPAIHWISPDGKLISNS--SRTLV------YDNGTLDILITTVKDTGSFTCIASNA   62 (74)
T ss_pred             CeEEEEEEccCcCCCEEEEEeCCCEEecCC--CeEEE------ecCCEEEEEECChhhCEEEEEEEECC
Confidence            457788999999999999997543322211  23333      23678999999999999999999853


No 63 
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=99.02  E-value=7.9e-10  Score=64.58  Aligned_cols=57  Identities=18%  Similarity=0.184  Sum_probs=43.2

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.|-+.|.|.|.+.|++++....    .++....     .....|.|.+++.+|+|.|.|.+.+.
T Consensus         2 ~l~C~~~g~P~p~v~W~k~~~~~~----~~~~~~~-----~~~~~L~i~~v~~~D~G~Y~C~a~N~   58 (71)
T cd05731           2 LLECIAEGLPTPEISWIKIGGELP----ADRTKFE-----NFNKTLKIDNVSEEDDGEYRCTASNS   58 (71)
T ss_pred             EEEEEeeEecCCeEEEEECCeECC----CCceeEe-----cCCCEEEECCCCHHHCEEEEEEEEeC
Confidence            567888899999999999875321    1222221     23678999999999999999999864


No 64 
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=99.02  E-value=1.4e-09  Score=67.98  Aligned_cols=66  Identities=12%  Similarity=0.023  Sum_probs=50.4

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.++.+.|-+.|.|.|.+.|+|++... ..  ..|+++...   .....|.|.++.++|+|.|.|.+.|.
T Consensus        13 ~~G~~v~l~C~~~G~p~p~v~W~kdg~~l-~~--~~~~~~~~~---~~~s~L~I~~~~~~D~G~Ytc~a~N~   78 (98)
T cd05762          13 RAGESVELFCKVTGTQPITCTWMKFRKQI-QE--GEGIKIENT---ENSSKLTITEGQQEHCGCYTLEVENK   78 (98)
T ss_pred             ECCCEEEEEEEEcccCCCceEEEECCEEe-cC--CCcEEEEec---CCeeEEEECCCChhhCEEEEEEEEcC
Confidence            45678889999999999999999998543 21  124443321   23678999999999999999999753


No 65 
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=99.01  E-value=3.5e-10  Score=71.09  Aligned_cols=71  Identities=14%  Similarity=0.151  Sum_probs=48.7

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCC--CCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKES--PFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~--~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ......+.+.|-+.|.|.|.+.|+|++.+.....  .+......+.  .....+|.|.+++.+|+|.|+|.|.|.
T Consensus        15 ~~~~~~~~l~~~v~g~P~P~v~W~kdg~~l~~~~--~~~~~~~~~~~~~~~~s~L~I~~v~~~D~G~Ytc~A~N~   87 (101)
T cd05859          15 ANLHEVKEFVVEVEAYPPPQIRWLKDNRTLIENL--TEITTSEHNVQETRYVSKLKLIRAKEEDSGLYTALAQNE   87 (101)
T ss_pred             EecCCcEEEEEEEEEeCCCceEEEECCEECcCCc--ceEEeccccccceeeccEEEEeeCCHHHCEEEEEEEEcC
Confidence            4455667888889999999999999986532211  1111101100  122478999999999999999999864


No 66 
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=99.00  E-value=7.4e-10  Score=67.33  Aligned_cols=63  Identities=27%  Similarity=0.322  Sum_probs=49.9

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ....+.++.+.|-+.|.|.|.+.|++++.. +.  ...|+..       .+..|.|.+++.+|+|.|.|.+.+
T Consensus        10 ~~~~G~~~~l~C~~~g~p~p~v~W~k~g~~-~~--~~~~~~~-------~~~~L~i~~~~~~D~G~Y~C~a~N   72 (85)
T cd05728          10 EADIGSSLRWECKASGNPRPAYRWLKNGQP-LA--SENRIEV-------EAGDLRITKLSLSDSGMYQCVAEN   72 (85)
T ss_pred             EEcCCCcEEEEEEeeEeCCCEEEEEECCEE-CC--CCCeEEE-------eCCEEEEeeCCHHHCEEEEEEEEC
Confidence            356678889999999999999999999854 22  1234443       256899999999999999999975


No 67 
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=99.00  E-value=2.3e-09  Score=65.22  Aligned_cols=66  Identities=15%  Similarity=0.247  Sum_probs=44.6

Q ss_pred             ceeeEEeecCCCcc--EEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           13 MLSVGDFADDEDIP--VYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        13 ~~~~~~w~~g~p~p--~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.+.|-+.|.|.|  .+.|++++..........+......  ....++|.|.+++.+|+|.|+|.|.+.
T Consensus         2 ~~~L~C~a~g~P~p~~~v~W~~~g~~i~~~~~~~~~~~~~~--~~~~~~L~I~~v~~~D~G~YtC~A~n~   69 (85)
T cd05854           2 NLTLQCHASHDPTMDLTFTWSLDDFPIDLDKPNGHYRRMEV--KETIGDLVIVNAQLSHAGTYTCTAQTV   69 (85)
T ss_pred             cEEEEEEEecCCCCCeEEEEEECCeEccccCCCCcEEEEEe--cceEeEEEEccCChhhCeEEEEEEecC
Confidence            46788988899877  5899998754211111222221110  123579999999999999999999753


No 68 
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=99.00  E-value=2e-09  Score=69.04  Aligned_cols=66  Identities=26%  Similarity=0.347  Sum_probs=52.9

Q ss_pred             eeeEEeecC------C--CccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           14 LSVGDFADD------E--DIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        14 ~~~~~w~~g------~--p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      -..|.|.+-      .  ....+.++.++.....++|++|+++..++...++.+|+|.+++.+|+|.|+|++..
T Consensus        27 ~~rIkW~~~~~~~~g~~~~e~~Vlv~~~g~~~~~~~y~gRv~l~~~~~~~g~asL~i~~v~~sD~G~Y~C~V~~  100 (117)
T cd05901          27 FLRIKWTKIEVDKNGKDHKETTVLVAQNGIIKIGQEYMGRVSVPSHPEDQGDASLTIVKLRASDAGVYRCEVMH  100 (117)
T ss_pred             CcEEEEEEecccccccCCCccEEEEEECCEEEECCcccCcEEeeccCCcCCceEEEEcccccccCEEEEEEEEE
Confidence            456778762      1  23566677777555678899999998777778899999999999999999999975


No 69 
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=99.00  E-value=1.6e-09  Score=66.70  Aligned_cols=68  Identities=18%  Similarity=0.110  Sum_probs=50.5

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ....+..+.+.|-+.|.|.|.+.|++++.. +.  ...|+.+...   ...++|.|.+++.+|+|.|.|.+.+.
T Consensus        14 ~~~~G~~~~L~C~~~g~P~p~v~W~k~g~~-l~--~~~~~~~~~~---~~~~~L~i~~~~~~D~G~Y~C~a~N~   81 (92)
T cd05747          14 TVSEGESARFSCDVDGEPAPTVTWMREGQI-IV--SSQRHQITST---EYKSTFEISKVQMSDEGNYTVVVENS   81 (92)
T ss_pred             EEeCCCcEEEEEEEeecCCCEEEEEECCEE-CC--CCCcEEEEEc---CCeeEEEECCCCcccCEeEEEEEEcC
Confidence            345567788899999999999999998743 22  1234444221   23679999999999999999999763


No 70 
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=99.00  E-value=2.8e-09  Score=63.63  Aligned_cols=60  Identities=15%  Similarity=0.108  Sum_probs=42.6

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCC----CCCEEEEEEEEEe
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRE----SDQGWYECKVVFL   80 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~----~D~G~Y~C~~~~~   80 (145)
                      .+.|-+.|.|.|.++|+|++.. +......|+.+.     ..+++|.|.++..    +|+|.|.|.|.|.
T Consensus         2 ~l~C~~~G~P~P~v~W~k~g~~-~~~~~~~~~~~~-----~~~~~L~i~~~~~~~~~~d~G~Y~C~A~N~   65 (77)
T cd05875           2 IIECEAKGNPVPTFQWTRNGKF-FNVAKDPRVSMR-----RRSGTLVIDFSGGGRPEDYEGEYQCFARNN   65 (77)
T ss_pred             EEEEeccccCCCEEEEEECCEE-ccCcCCCcEEEe-----CCCceEEEeccCCCCCCCCCEEEEEEEEec
Confidence            4678888999999999998753 211223344432     2378899998752    4799999999864


No 71 
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=98.99  E-value=2.1e-09  Score=68.53  Aligned_cols=66  Identities=24%  Similarity=0.355  Sum_probs=47.3

Q ss_pred             eeeEEeecC--CCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           14 LSVGDFADD--EDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        14 ~~~~~w~~g--~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ...+.|.+.  ...+.+.++.++.....++|++|+++..+....++.+|+|++++.+|+|.|+|.+..
T Consensus        26 ~~~i~W~k~~~~~~~~v~~~~~~~~~~~~~f~gR~~~~~~~~~~~~asL~I~~l~~sD~G~Y~C~v~~   93 (110)
T cd05878          26 SPRIKWTKLSGQKEVTVLVAQDGVVKVGQEYQGRVSLPNYPENRGDASLEISRLRSSDSGVYRCEVMH   93 (110)
T ss_pred             CCEEEEEEecCCCcEEEEEEECCEEEecccccCeEEeccCCCCCCcEEEEECCCChhhCEEEEEEEEe
Confidence            355678772  222344444444334567899999986554556789999999999999999999975


No 72 
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.99  E-value=2.2e-09  Score=65.54  Aligned_cols=63  Identities=24%  Similarity=0.325  Sum_probs=48.5

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+..+.+.|-+.|.|.|.+.|++++..... .  .+..       ..+++|.|.+++.+|+|.|.|.+.+.
T Consensus        13 ~~~g~~v~l~C~~~g~P~p~v~W~k~~~~~~~-~--~~~~-------~~~~~L~i~~v~~~D~G~Y~C~a~N~   75 (88)
T cd04968          13 ALKGQNVTLECFALGNPVPQIKWRKVDGSMPS-S--AEIS-------MSGAVLKIPNIQFEDEGTYECEAENI   75 (88)
T ss_pred             EeCCCcEEEEEEeeEeCCCEEEEEECCCcCCC-c--cEEE-------EeCCEEEECCCCcccCEEEEEEEEEC
Confidence            34677889999999999999999998754221 1  1111       23689999999999999999999763


No 73 
>KOG4222|consensus
Probab=98.99  E-value=1.2e-09  Score=90.64  Aligned_cols=110  Identities=22%  Similarity=0.350  Sum_probs=76.1

Q ss_pred             CCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEecC-------------CC----
Q psy534           22 DEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLNR-------------SP----   84 (145)
Q Consensus        22 g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~~-------------~~----   84 (145)
                      |.|.|.++|.|++.+.... -..+.+++      ..+.|.|.|+.++|+|.|.|++.+...             .|    
T Consensus       158 ghpeptvSw~Kdg~pl~~~-~~~~~~li------sgG~LlIsnvrksD~GtY~CVatNmvG~ReS~~A~lsv~e~P~f~~  230 (1281)
T KOG4222|consen  158 GHPEPTVSWVKDGKPLDHY-DVPIIALI------SGGNLLISNVRKSDEGTYACVATNMVGERESIPARLSVQEKPWFWK  230 (1281)
T ss_pred             CCCCCcceeecCCCccccc-cceeEEEe------cCCcEEEeccccCCCceeeeeecccccccccccceeeeccCCcccc
Confidence            7889999999998653311 12234443      389999999999999999999977542             00    


Q ss_pred             ---CC-CCCCcEEEEEEe-----------------------EEecCCcEEEEcccCCCCCeeeEEEEecCCC-----CcE
Q psy534           85 ---NS-HKNGTWFHLDVH-----------------------GVFNDGTELRISNIRSQDIGDYTCLATHVLY-----PDL  132 (145)
Q Consensus        85 ---~~-~~~g~~~~l~c~-----------------------~~~~~~~~L~i~~v~~~d~G~Y~C~a~n~~g-----~~~  132 (145)
                         +. ...|..+.+.|.                       ....+..+|+|.+++..|+|.|.|.|.|.+|     ..+
T Consensus       231 rp~~~~v~~g~~~~f~c~v~GdP~P~Vrwkk~~~~~P~~ry~i~~d~qtl~i~r~tp~deg~y~C~a~n~vG~l~asa~l  310 (1281)
T KOG4222|consen  231 RPKDLAVLVGAAAEFDCRVGGDPQPTVRWKKDDPSLPRSRYSILDDTQTLRIDRVTPTDEGTYVCPAENLVGGLEASATL  310 (1281)
T ss_pred             ccccceeecccccccccccCCCCCCceeeeccCCCCCccceeeeeccccccccccCCCcccceeeeccccccccccccce
Confidence               11 112444555555                       1112325899999999999999999999998     566


Q ss_pred             EEEeCe
Q psy534          133 LVVLGS  138 (145)
Q Consensus       133 ~v~~~~  138 (145)
                      +|-...
T Consensus       311 tV~apP  316 (1281)
T KOG4222|consen  311 TVQAPP  316 (1281)
T ss_pred             EEecCc
Confidence            665443


No 74 
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=98.99  E-value=2.7e-09  Score=64.59  Aligned_cols=65  Identities=18%  Similarity=0.273  Sum_probs=49.7

Q ss_pred             hhhccceeeEEee-cCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFA-DDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~-~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+.++.+.|-+ .|.|.|.+.|+|++... ... ..|..+.      .+++|.|.+++.+|+|.|+|.+.+.
T Consensus         8 ~~~G~~v~l~C~~~~g~p~p~i~W~k~g~~~-~~~-~~~~~~~------~~~~L~I~~~~~~D~G~Y~C~a~N~   73 (86)
T cd05724           8 VAVGEMAVLECSPPRGHPEPTVSWRKDGQPL-NLD-NERVRIV------DDGNLLIAEARKSDEGTYKCVATNM   73 (86)
T ss_pred             EeCCCCEEEEEECCCCCCCCEEEEEECCEEC-CCC-CCCEEEc------cCCEEEEeECCcccCEEEEEEEEec
Confidence            4467788899987 69999999999987532 211 2344442      2678999999999999999999864


No 75 
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=98.98  E-value=3.1e-09  Score=65.24  Aligned_cols=69  Identities=13%  Similarity=0.121  Sum_probs=44.2

Q ss_pred             cceeeEEeecCCCccEEEEecCC---CCcccccccceEEEecCC----CCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSY---PTHEAEEYKGRISRVDKE----SPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~---~~~~~~~~~~R~~~~~~~----~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.|.+.|.|.|.+.|++..   +..+..+-..+..+....    ......+|.|.+++.+|+|.|+|.|.+.
T Consensus         2 ~~v~L~C~~~g~P~P~i~W~k~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~I~~v~~~D~G~Y~C~A~N~   77 (90)
T cd05858           2 STVEFVCKVYSDAQPHIQWLKHVEKNGSKYGPDGLPYVTVLKTAGVNTTDKEMEVLYLRNVTFEDAGEYTCLAGNS   77 (90)
T ss_pred             CeEEEEEEEecCCCCEEEEEEecccCCcEeCCCCCeeEEEeccCCceecCCceeEEEEccCCHHHCEEEEEEEEeC
Confidence            45778899999999999999853   111111111111111100    0112368999999999999999999864


No 76 
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.97  E-value=6.2e-09  Score=63.70  Aligned_cols=67  Identities=16%  Similarity=0.183  Sum_probs=47.8

Q ss_pred             cceeeEEeecCCCccEEEEecCCCCcccccccceEEEecC-CCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDK-ESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~-~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.|-+.|.|.+.+.|++++.. +... ..|..+... .......+|.|.++..+|+|.|.|.|.|.
T Consensus         2 ~~~~l~C~~~g~p~~~i~W~k~~~~-i~~~-~~r~~~~~~~~~~~~~s~L~I~~~~~~D~G~YtC~A~N~   69 (88)
T cd05735           2 QKKEMSCTAHGEKPIIVRWEKEDRI-INPE-MSRYLVSTKEVGDEVISTLQILPTVREDSGFFSCHAINS   69 (88)
T ss_pred             CeEEEEEEEECCCCCEEEEeeCCEE-CCCC-CCcEEEEEecCCCcEEEEEEECCCCcccCEEEEEEEEcC
Confidence            4577889999999999999998853 3222 234443221 01122478999999999999999999763


No 77 
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=98.97  E-value=3.6e-09  Score=66.23  Aligned_cols=66  Identities=17%  Similarity=0.319  Sum_probs=47.3

Q ss_pred             cceeeEEeec---CCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           12 QMLSVGDFAD---DEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        12 ~~~~~~~w~~---g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..+..+.|.+   +.....+.+...........|++|+++..  ...++++|.|++++.+|.|.|.|++.+
T Consensus        16 ~~~~~V~W~k~~~~~~~~va~y~~~~g~~~~~~f~~Rv~f~~--~~~~daSi~i~nl~~~D~G~Y~C~v~t   84 (99)
T cd05886          16 VKITQVTWQKLTNGSKQNVAIYNPSMGVSVLPPYRERVTFKN--PSFEDGTISLSRLELEDEGVYICEFAT   84 (99)
T ss_pred             CCeEEEEEEECCCCCceEEEEECCcCCcccCccccCcEEEcC--CCCCcceEEEcCCccccCEEEEEEEEe
Confidence            3456788877   23334444443333445567999999864  235799999999999999999999975


No 78 
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=98.96  E-value=2.2e-09  Score=66.53  Aligned_cols=73  Identities=14%  Similarity=0.102  Sum_probs=51.0

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcc-----------cccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEE
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHE-----------AEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECK   76 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~-----------~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~   76 (145)
                      +..+..+.+-|.+.+.+.+.+.||++++..+           ...+..|+.........++.+|.|.+++.+|+|.|+|.
T Consensus         4 ~~~G~~VtL~C~~s~~~~~~i~W~~~~~k~~~g~~~~l~~~~~~~~~~r~~~~~~~~~~g~~~L~I~~l~~sDsgtY~C~   83 (94)
T cd07690           4 GKKGDTAELPCTASQKKSIQFHWKNSNQIKILGNQGSFLTKGPSKLNDRADSRRNLWDQGSFPLIIKNLKIEDSDTYICE   83 (94)
T ss_pred             eeCCCCEEEEEEeCCCCCcEEEEEECCcEEccCcCCEEEEecccccCCCCceecccCCCCeEEEEECCCCHHHCEEEEEE
Confidence            4567788899999999999999996653210           11233444433221234577899999999999999999


Q ss_pred             EEEe
Q psy534           77 VVFL   80 (145)
Q Consensus        77 ~~~~   80 (145)
                      +.+.
T Consensus        84 v~~~   87 (94)
T cd07690          84 VEDK   87 (94)
T ss_pred             ECCc
Confidence            8643


No 79 
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=98.96  E-value=7e-09  Score=61.54  Aligned_cols=64  Identities=17%  Similarity=0.197  Sum_probs=43.8

Q ss_pred             eeeEEeec-CCCccEEEEecCCCCccc-ccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           14 LSVGDFAD-DEDIPVYIWYDSYPTHEA-EEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        14 ~~~~~w~~-g~p~p~~~w~k~~~~~~~-~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +.+.|.+. +.|.+.+.||+++..... .....|.....   .....+|.|.+++.+|+|.|.|.+.+.
T Consensus         1 ~~L~C~a~~~~p~~~~~W~~~g~~i~~~~~~~~~~~~~~---~~~~~~L~I~~~~~~DsG~Y~C~a~N~   66 (76)
T cd05895           1 LVLRCETVSEYPSLRFKWFKNGKEIGAKNKPDNKIKIRK---KKKSSELQISKASLADNGEYKCMVSSK   66 (76)
T ss_pred             CEEEEecccCCCCCceEEEECCcccccCCCCCceEEEEe---CCcEEEEEECcCCcccCEEEEEEEEeC
Confidence            35778876 468889999998754221 11223333211   123678999999999999999999763


No 80 
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=98.95  E-value=4.2e-09  Score=65.22  Aligned_cols=65  Identities=18%  Similarity=0.170  Sum_probs=48.5

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEccc-----CCCCCEEEEEEEEEe
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKI-----RESDQGWYECKVVFL   80 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v-----~~~D~G~Y~C~~~~~   80 (145)
                      ..+.++.+.|.+.|.|.|.+.|+|++.. +......+..+      ..+++|.|.++     +++|+|.|+|.+.+.
T Consensus        12 ~~g~~v~l~C~v~g~P~p~i~W~k~g~~-l~~~~~~~~~~------~~~~~l~i~~v~~~~~~~~D~G~Y~C~a~N~   81 (95)
T cd05722          12 VRGGPVVLNCSAEGEPPPKIEWKKDGVL-LNLVSDERRQQ------LPNGSLLITSVVHSKHNKPDEGFYQCVAQND   81 (95)
T ss_pred             cCCCCEEEeeecccCCCCEEEEEECCeE-CccccCcceEE------ccCCeEEEeeeeccCCCCCcCEEEEEEEECC
Confidence            4567899999999999999999998754 33222233333      23567888877     689999999999864


No 81 
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=98.93  E-value=1.9e-09  Score=66.82  Aligned_cols=65  Identities=15%  Similarity=0.055  Sum_probs=48.4

Q ss_pred             hhhccceeeEEeecC-----CCccEEEEecCCCCccccc-ccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            8 KSIFQMLSVGDFADD-----EDIPVYIWYDSYPTHEAEE-YKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g-----~p~p~~~w~k~~~~~~~~~-~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ...+.++.+.|-+.|     .|.|.+.|||++.....+. ...|+..       .++.|.|.+++.+|+|.|.|.+.+
T Consensus        11 v~~G~~~~L~C~~~g~~~~~~p~~~v~Wyk~~~~~~~~~~~~~r~~~-------~~~~L~I~~~~~~DsG~Y~C~~~N   81 (94)
T cd05756          11 VLEGEPVVIKCPLFYSYIAQSPGLNLTWYKSDGKTPIPTEERSRMHQ-------QKDLLWFLPAALEDSGLYTCVVRN   81 (94)
T ss_pred             EecCCCeEEECCCCCcccccCCCceEEEEEcCCCCcccccccceeee-------cCCeEEEccCCcccCeEEEEEEcC
Confidence            346778899998888     6899999999985421111 1234332       257899999999999999999975


No 82 
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=98.92  E-value=4.5e-09  Score=65.27  Aligned_cols=67  Identities=18%  Similarity=0.033  Sum_probs=49.4

Q ss_pred             hhccceeeEEeec-CCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEec
Q psy534            9 SIFQMLSVGDFAD-DEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLN   81 (145)
Q Consensus         9 ~~~~~~~~~~w~~-g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~   81 (145)
                      ..+.++.+-|--. |.|.|.+.|++++....-. -..|..+.     ..++.|.|++|+++|+|.|.|.|.+..
T Consensus        16 ~eG~~~~L~C~pP~g~P~p~~~W~k~~~~~~~~-~d~r~~~~-----~~~G~L~fs~v~~~D~g~Y~C~A~n~~   83 (96)
T cd05727          16 KEGWGVVLFCDPPPHYPDLSYRWLLNEFPNFIP-EDGRRFVS-----QTNGNLYIAKVEASDRGNYSCFVSSPS   83 (96)
T ss_pred             eeCCcEEEeeCCCCCCCCCEEEEEECCcccccc-cCCCeEEe-----CCCCcEEEeecCHhhCceeEEEEEecc
Confidence            3467777888665 8899999999997532111 13344332     348999999999999999999998754


No 83 
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=98.92  E-value=8.5e-09  Score=65.62  Aligned_cols=70  Identities=9%  Similarity=0.008  Sum_probs=49.3

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEec-CCCCCCeeeEEEcccC-CCCCEEEEEEEEEe
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVD-KESPFGMASLNLTKIR-ESDQGWYECKVVFL   80 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~-~~~~~~~~sL~I~~v~-~~D~G~Y~C~~~~~   80 (145)
                      .++..+.+.|-+.|.|.|.++|++++.. +.. ...|..... .......++|.|.+++ .+|.|.|.|.|.|.
T Consensus        21 ~~g~~v~L~C~a~G~P~p~i~W~k~g~~-l~~-~~~r~~~~~~~~~~~~~s~L~I~~v~~~~D~G~Y~C~A~N~   92 (109)
T cd05773          21 DGSSDANLVCQAQGVPRVQFRWAKNGVP-LDL-GNPRYEETTEHTGTVHTSILTIINVSAALDYALFTCTAHNS   92 (109)
T ss_pred             CCCCEEEEEEECcccCCCEEEEEECCEE-CCC-CCCeEEEEeeccCccceeEEEECcCCccCCCEEEEEEEEeC
Confidence            4567889999999999999999998754 221 122332211 1112235789999997 69999999999864


No 84 
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.92  E-value=5.3e-09  Score=63.44  Aligned_cols=65  Identities=14%  Similarity=0.205  Sum_probs=43.9

Q ss_pred             ceeeEEeecCCCcc--EEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           13 MLSVGDFADDEDIP--VYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        13 ~~~~~~w~~g~p~p--~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      .+.+.|-+.|.|.|  .+.|++++..........+.....  .....++|.|.+++.+|+|.|.|.+.+
T Consensus         2 ~~~L~C~~~g~P~p~i~~~W~~~g~~i~~~~~~~~~~~~~--~~~~~~~L~I~~v~~~D~G~Y~C~a~n   68 (85)
T cd04970           2 SITLQCHASHDPTLDLTFTWSFNGVPIDFDKDGGHYRRVG--GKDSNGDLMIRNAQLKHAGKYTCTAQT   68 (85)
T ss_pred             cEEEEEEEecCCCCCeEEEEEECCeEeeccCCCccEEEEe--cccccceEEEccCCHHhCeeeEEEEec
Confidence            46788999999877  679999875421111111111110  012478899999999999999999975


No 85 
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=98.91  E-value=5.3e-09  Score=66.88  Aligned_cols=41  Identities=32%  Similarity=0.510  Sum_probs=34.8

Q ss_pred             ccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEE
Q psy534           38 EAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVV   78 (145)
Q Consensus        38 ~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~   78 (145)
                      ...+|++|+++...+...++.+|.|++++.+|+|.|+|.+.
T Consensus        54 ~~~~f~~R~sl~~~~~~~~~asL~I~nl~~sDsG~Y~C~V~   94 (112)
T cd05900          54 VNTEYLDRVSLPNYPAIPSDATLEITELRSNDSGTYRCEVM   94 (112)
T ss_pred             ECccccCeEEecccCCCCCCcEEEEeecccccCEEEEEEEe
Confidence            45678899998654445679999999999999999999997


No 86 
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=98.91  E-value=5.2e-09  Score=64.31  Aligned_cols=63  Identities=21%  Similarity=0.225  Sum_probs=45.8

Q ss_pred             hccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCC-CCCEEEEEEEEEe
Q psy534           10 IFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRE-SDQGWYECKVVFL   80 (145)
Q Consensus        10 ~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~-~D~G~Y~C~~~~~   80 (145)
                      ....+.+.|-+.|.|.|.+.|++++.. +...-..+...       .+++|.|.++.. +|+|.|+|.+.+.
T Consensus        18 ~~~~~~l~C~~~g~p~p~i~W~k~~~~-l~~~~~~~~~~-------~~~~L~i~~~~~~~d~G~Y~C~a~N~   81 (91)
T cd04967          18 DEGKVSLNCRARGSPPPTYRWLMNGTE-IDDEPDSRYSL-------VGGNLVISNPSKAKDAGRYQCLASNI   81 (91)
T ss_pred             CCCEEEEEEeeeEcCCCEEEEEECCEE-CCCCCCCCEEE-------ECCEEEEecCCccCCCEEEEEEEEcC
Confidence            335688889999999999999998753 21111223332       257899998874 9999999999753


No 87 
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=98.90  E-value=4.6e-09  Score=64.79  Aligned_cols=70  Identities=17%  Similarity=0.111  Sum_probs=50.6

Q ss_pred             HHHhhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            5 FAVKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         5 ~~~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +.+...+..+.+.|-+.|.|.|.+.||+++... .  ...++.....  .....+|.|.+++.+|+|.|.|.+.+
T Consensus        10 ~v~v~eG~~v~L~C~v~g~P~p~i~W~k~~~~~-~--~~~~~~~~~~--~~~~~~L~I~~~~~~D~G~Y~C~a~N   79 (92)
T cd05891          10 VVTIMEGKTLNLTCTVFGNPDPEVIWFKNDQDI-E--LSEHYSVKLE--QGKYASLTIKGVTSEDSGKYSINVKN   79 (92)
T ss_pred             cEEEcCCCEEEEEEEEEEeCCCeEEEEECCEEC-C--CCCCEEEEEc--CCCEEEEEECCCChhhCEEEEEEEEe
Confidence            345567888899999889999999999987532 2  2233332111  01235799999999999999999975


No 88 
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=98.90  E-value=7.8e-09  Score=64.23  Aligned_cols=71  Identities=15%  Similarity=0.233  Sum_probs=51.0

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCccc--cc---ccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEA--EE---YKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~--~~---~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +...+..+.+-|-+.|.|.|.+.|++.+...+.  ..   ...|+.+...  .....+|.|.+|+.+|+|.|.|.+..
T Consensus         8 tv~~G~tv~L~C~v~g~~~~~v~W~k~~~~~~~~~~~~~~~~~r~~~~~~--~~~~~~L~I~nV~~~D~G~YtC~~~t   83 (95)
T cd05882           8 TVAVGGTVTLKCGVKEHDNSSLQWSNTAQQTLYFGEKRALRDNRIQLVKS--TPTELIISISNVQLSDEGEYTCSIFT   83 (95)
T ss_pred             EEecCCcEEEEEEEeCCCCCeEEEeccCccEEEeCCeEEEeCCeEEEEeC--CCceEEEEECCCCcccCEEEEEEEEe
Confidence            345677788899999999999999998753211  00   1245544321  12468999999999999999999974


No 89 
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=98.90  E-value=6.6e-09  Score=62.48  Aligned_cols=70  Identities=20%  Similarity=0.167  Sum_probs=50.1

Q ss_pred             HHhhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            6 AVKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         6 ~~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .....+..+.+.|++.+.|.+.+.|++++......   .+.....  .......|.|.+++.+|+|.|.|.+.+.
T Consensus         4 ~~~~~G~~~~l~C~~~~~p~~~v~W~k~~~~~~~~---~~~~~~~--~~~~~~~l~i~~~~~~d~g~Y~C~~~n~   73 (85)
T cd05729           4 HAVPAGSTVRLKCPASGNPRPTITWLKDGKPFKKE---HRIGGYK--VRKKKWTLILESVVPSDSGKYTCIVENK   73 (85)
T ss_pred             eEecCCCcEEEEEEcCCCCCCeEEEEECCEECccc---CceeEEE--ccCcEEEEEEeECCcccCEEEEEEEEEC
Confidence            44567888999999999999999999987432211   1111110  1123568999999999999999999753


No 90 
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=98.89  E-value=8e-09  Score=60.38  Aligned_cols=57  Identities=18%  Similarity=0.295  Sum_probs=42.2

Q ss_pred             cceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.|.+.|.|.|.+.|+|++.. +..  ..+..       .+...|.|.++  .|+|.|.|.|.+.
T Consensus         2 ~~v~L~C~a~G~P~P~v~W~k~g~~-l~~--~~~~~-------~~~~~L~i~~~--~d~G~Y~C~A~N~   58 (69)
T cd05739           2 GSVNLTCVAVGAPMPYVKWMKGGEE-LTK--EDEMP-------VGRNVLELTNI--YESANYTCVAISS   58 (69)
T ss_pred             CeEEEEEEeeecCCCEEEEEECCEE-CCC--cccee-------cCccEEEEecc--ccCeeEEEEEEeC
Confidence            4578899999999999999999754 221  11222       23557999997  4899999999864


No 91 
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=98.88  E-value=1.1e-08  Score=62.25  Aligned_cols=67  Identities=16%  Similarity=0.215  Sum_probs=51.1

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+.++.+.|-+.|.|.|.+.|++++.. +..  ..|..+...   ....+|.|.+++.+|+|.|.|.+.+.
T Consensus        12 v~~G~~~~l~c~~~~~p~~~v~W~~~~~~-l~~--~~~~~~~~~---~~~~~L~I~~v~~~D~G~Y~C~~~n~   78 (90)
T PF07679_consen   12 VKEGESVTLECEVSGNPPPTVTWYKNGRP-LTS--SQRYQIESD---GGSSSLTIKNVTREDAGTYTCVASNS   78 (90)
T ss_dssp             EETTSEEEEEEEEEESSSSEEEEEETTEE-EES--SSSEEEEEE---TTEEEEEESSESGGGSEEEEEEEEET
T ss_pred             EeCCCEEEEEEEEEeCCCCcccccccccc-eee--eeeeeeecc---cceeEEccCCCChhhCEEEEEEEEEC
Confidence            34577888999999999999999999743 332  233333221   25899999999999999999999753


No 92 
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=98.87  E-value=7.6e-09  Score=64.48  Aligned_cols=63  Identities=13%  Similarity=0.151  Sum_probs=45.7

Q ss_pred             cceeeEEeecCCCccEEEEec---CCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           12 QMLSVGDFADDEDIPVYIWYD---SYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k---~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      .....+.|.++.+...+.+.+   ......++.|++|+.+.     ..+++|.|++++.+|+|.|.|++..
T Consensus        17 ~~~~~v~W~~~~~~~i~~~~~~~~~~~~~~~~~f~~R~~~~-----~~~~sL~I~~~~~~DsG~Y~c~v~~   82 (97)
T cd05775          17 TEIESITWSFNTSLAIITPGEETAPEIIVTDPSYKERVNFS-----QNDYSLQISNLKMEDAGSYRAEINT   82 (97)
T ss_pred             cEEEEEEEecCCEeEEEecCCCCCCccEEeCCCceeeEEec-----CCceeEEECCCchHHCEEEEEEEEc
Confidence            456678888876555555543   22223456788899873     3379999999999999999999974


No 93 
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=98.86  E-value=2.4e-08  Score=62.54  Aligned_cols=64  Identities=19%  Similarity=0.340  Sum_probs=44.4

Q ss_pred             eeeEEeec---C-CCccEEEE-ecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           14 LSVGDFAD---D-EDIPVYIW-YDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        14 ~~~~~w~~---g-~p~p~~~w-~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ...+.|.+   | .+..+... ++.+. ...++|++|+++..+ ....+.+|.|++++.+|+|.|.|.+..
T Consensus        17 ~~~v~W~k~~~~~~~~~i~~~~~~~~~-~~~~~~~~Rv~f~~~-~~~~~~sL~I~nv~~sD~GtY~C~v~~   85 (100)
T cd05888          17 VVQVLWIRENAGGVEEEIALLHFKYGQ-TEFHAYEGRVRFETP-NPIADGALILRNAVQADEGKYKCRVIT   85 (100)
T ss_pred             EEEEEEEEccCCCCcEEEEEEeccCCc-ccCCCccCcEEEeCC-CCCCceEEEEecCccccceEEEEEEEe
Confidence            55788888   2 23344433 33333 234578899998543 234688999999999999999999974


No 94 
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=98.85  E-value=1.9e-08  Score=60.22  Aligned_cols=61  Identities=15%  Similarity=0.184  Sum_probs=46.6

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ...+..+.+.|.+.|. .+.+.|+|++.. +..  ..|+.+.       ..+|.|.+++.+|+|.|.|.+.+
T Consensus         6 ~~~G~~v~l~C~~~~~-~~~v~W~k~g~~-l~~--~~~~~~~-------~~~L~I~~~~~~DsG~Y~C~a~n   66 (79)
T cd04973           6 AHPGDLLQLRCRLRDD-VQSINWTKDGVQ-LGE--NNRTRIT-------GEEVQIKDAVPRDSGLYACVTSS   66 (79)
T ss_pred             ecCCCCEEEEEEecCC-CceEEEeeCCcC-CCC--CceEEEe-------CCEEEECCCChhhCEEEEEEEeC
Confidence            4567788999999886 568999999854 322  2344431       45899999999999999999974


No 95 
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=98.84  E-value=2.6e-08  Score=61.41  Aligned_cols=68  Identities=16%  Similarity=0.097  Sum_probs=47.5

Q ss_pred             hhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+..+.+.|-+.|.|. .+.|++.+...+..  .+|.....+  .....+|.|.+++.+|+|.|.|.+.+.
T Consensus        12 v~~G~~~~l~C~~~G~p~-~i~W~~~~~~~~~~--~~~~~~~~~--~~~~~~L~I~~v~~~D~G~Y~C~A~N~   79 (92)
T cd04977          12 ISVGESKFFLCQVIGEPK-DISWFSPNGEKLVT--QQQISVVQN--DDVRSTLTIYNANIEDAGIYKCVATDA   79 (92)
T ss_pred             ECCCCeEEEEEEeEeeCC-eEEEECCCCCEecc--CCCEEEEeC--CCCEEEEEEecCCcccCEEEEEEEEcC
Confidence            456778899999999874 89999854332222  123332211  123578999999999999999999864


No 96 
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=98.84  E-value=2.7e-08  Score=64.00  Aligned_cols=40  Identities=23%  Similarity=0.363  Sum_probs=34.5

Q ss_pred             cccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           39 AEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        39 ~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..+|++|+.+..+ ...++.+|.|++++.+|+|.|.|.+.+
T Consensus        62 ~~~f~~Rv~f~g~-~~~~daSI~I~nv~~sD~G~Y~C~v~n  101 (116)
T cd05879          62 VGPFKERIEWVGN-PSRKDGSIVIHNLDYTDNGTFTCDVKN  101 (116)
T ss_pred             ccCccCceEEeCC-CCcCeeEEEEccCCcccCEEEEEEEEc
Confidence            3678999998765 356799999999999999999999975


No 97 
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=98.84  E-value=1.9e-08  Score=62.50  Aligned_cols=71  Identities=17%  Similarity=0.200  Sum_probs=49.9

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCccc-----ccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEA-----EEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~-----~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +...+..+.+.|-+.+.|.|.+.|++.+...+.     ....+|+.....  .....+|.|.+++.+|+|.|.|.+..
T Consensus         8 ~v~eG~~v~L~C~~~~~p~~~v~W~~~~~~~l~~~~~~~~~~~r~~~~~~--~~~~~sL~I~~v~~~DsG~Y~C~~~t   83 (95)
T cd07701           8 TVVEGGTANLTCRVDQNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRA--SWHELSISISDVSLSDEGQYTCSLFT   83 (95)
T ss_pred             EEecCCcEEEEEEEecCCceEEEEeCCCCeEEEEcCcccccCCCEEEEEC--CCCcEEEEECcCCcccCEEEEEEeEe
Confidence            345678888999999999999999864321110     012345544221  13468999999999999999999974


No 98 
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=98.83  E-value=1.3e-08  Score=61.88  Aligned_cols=65  Identities=15%  Similarity=0.092  Sum_probs=44.3

Q ss_pred             ceeeEEeecC--CCccEEEEecCCCCccccc-ccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           13 MLSVGDFADD--EDIPVYIWYDSYPTHEAEE-YKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        13 ~~~~~~w~~g--~p~p~~~w~k~~~~~~~~~-~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ++.+.|-+.+  .+.+.+.|++++.. +... -..|+....  .....++|.|.+++.+|+|.|+|.|.+.
T Consensus         2 ~~~l~C~v~~d~~l~~~~~W~~dg~~-i~~~~~~~~~~~~~--~~~~~~~L~I~nv~~~dsG~YtC~a~n~   69 (85)
T cd05853           2 SIVLPCQVSHDHSLDIVFTWSFNGHL-IDFQKDGDHFERVG--GQDSAGDLMIRSIQLKHAGKYVCMVQTS   69 (85)
T ss_pred             cEEEEEEeccCCCCCcEEEEEECCEE-CcccCCCccEEEec--cCCCCCcEEEecCCHHHCEEEEEEEEcc
Confidence            3566787764  56888999999864 3221 112433321  1123678999999999999999999754


No 99 
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=98.82  E-value=3.5e-08  Score=61.36  Aligned_cols=64  Identities=22%  Similarity=0.409  Sum_probs=47.5

Q ss_pred             ceeeEEeecC---CCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEE
Q psy534           13 MLSVGDFADD---EDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVV   78 (145)
Q Consensus        13 ~~~~~~w~~g---~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~   78 (145)
                      .+.++.|.+-   ....+..+....+..+...|++|+.+...  ...+.+|.|.||+.+|+|.|+|.+.
T Consensus        14 ~~~qV~W~k~~~~~~~~iavy~~~~g~~~~~~y~~Rv~f~~~--~~~d~sI~i~nvt~~D~G~Y~C~~~   80 (96)
T cd05889          14 VLIQVSWTKHNGSHKENIAVYHPIYGMHIEDKYRGRVYFLNS--TREDMSLSFNNATEEDVGLYCCSLV   80 (96)
T ss_pred             cEEEEEEEEcCCCCCceEEEEECCCCCEECccccCeEEEecC--CCCccEEEEcCCCcccCEEEEEEEE
Confidence            4677788872   23445555554445567789999998653  2368999999999999999999995


No 100
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=98.82  E-value=2.2e-08  Score=61.36  Aligned_cols=35  Identities=23%  Similarity=0.393  Sum_probs=29.9

Q ss_pred             cccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           39 AEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        39 ~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      .+.+++|+.+.      .+++|.|.+++.+|+|.|+|++..
T Consensus        44 ~~~~~~R~~~~------~~~sL~I~~l~~~DsG~Y~c~v~~   78 (92)
T cd05741          44 GPAYSGRETIY------PNGSLLIQNLTKEDSGTYTLQIIS   78 (92)
T ss_pred             CCCcCCeEEEc------CCceEEEccCCchhcEEEEEEEEc
Confidence            45688999873      369999999999999999999964


No 101
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.81  E-value=1.6e-08  Score=62.69  Aligned_cols=66  Identities=17%  Similarity=0.114  Sum_probs=51.8

Q ss_pred             hhhccceeeEEe-ecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCE-EEEEEEEEec
Q psy534            8 KSIFQMLSVGDF-ADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQG-WYECKVVFLN   81 (145)
Q Consensus         8 ~~~~~~~~~~~w-~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G-~Y~C~~~~~~   81 (145)
                      ...+.++.+-|- .+|.|.|.+.|+++....+.  ..+|+..      ..++.|.|++|+.+|+| .|.|.|.+..
T Consensus        15 V~eG~~~~L~C~pP~g~P~P~i~W~~~~~~~i~--~~~Ri~~------~~~GnL~fs~v~~~D~g~~Y~C~a~~~~   82 (95)
T cd05845          15 VEEGDSVVLPCNPPKSAVPLRIYWMNSDLLHIT--QDERVSM------GQNGNLYFANVEEQDSHPDYICHAHFPG   82 (95)
T ss_pred             EecCCCEEEEecCCCCCCCCEEEEECCCCcccc--ccccEEE------CCCceEEEEEEehhhCCCCeEEEEEccc
Confidence            346788888997 57999999999977643332  2567765      34799999999999999 8999998653


No 102
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=98.80  E-value=3.2e-08  Score=61.51  Aligned_cols=65  Identities=22%  Similarity=0.341  Sum_probs=46.1

Q ss_pred             ceeeEEeec--C-CCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           13 MLSVGDFAD--D-EDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        13 ~~~~~~w~~--g-~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      .+.++.|.+  + ....+..+.+..+..+.+.|++|+.+..  ....+.+|.|++++.+|+|.|+|++..
T Consensus        14 ~~~qV~W~k~~~~~~~~ia~y~~~~g~~~~~~y~~Rv~~~~--~~~~d~sl~i~nv~~~D~G~Y~C~v~t   81 (96)
T cd05887          14 TITQSSWEKIHGKGSVTLAVHHPMYGISIQPDYQGRVSFKN--YSLLDATIMLENVGFSDIGVYICKAVT   81 (96)
T ss_pred             cEEEEEEEEcCCCCcEEEEEEcccCCcccChhhCCcEEEcC--CCCCccEEEEeCCCccccEEEEEEEEe
Confidence            556788876  2 1233334433334455678999999853  345699999999999999999999853


No 103
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=98.80  E-value=2e-08  Score=57.38  Aligned_cols=62  Identities=13%  Similarity=0.223  Sum_probs=41.2

Q ss_pred             cceeeEEee-cCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEE
Q psy534           12 QMLSVGDFA-DDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKV   77 (145)
Q Consensus        12 ~~~~~~~w~-~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~   77 (145)
                      ..+.+.|.. .+.+.+.+.|++++..........+... .   ......|.|.+++.+|+|.|.|.|
T Consensus         2 ~~v~L~C~~~~~~~~~~~~W~~~~~~~~~~~~~~~~~~-~---~~~~~~L~i~~v~~~d~G~Y~C~v   64 (64)
T PF00047_consen    2 SSVTLTCSVSSGPPPTTVTWSKNGQSLPEGSTTNRSTN-S---VSSTSRLTISNVTPEDSGTYTCVV   64 (64)
T ss_dssp             SEEEEEEEEEESSSTSEEEEEETTTTTSEEEEEEEEET-T---TEEEEEEEESSCTGGGTEEEEEEE
T ss_pred             CeEEEEeecCCCCCCcEEEEEECCccccCcceeEeecc-c---ceeeeEEEEccCCHHHCEEEEEEC
Confidence            356788999 6888999999999865322221111110 0   000113999999999999999986


No 104
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=98.79  E-value=2e-08  Score=61.34  Aligned_cols=61  Identities=15%  Similarity=0.163  Sum_probs=45.4

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..+.++.+.|-..+ +.+.+.|++++.. +... ..|+.+.       ++.|.|.+++.+|+|.|+|.+..
T Consensus         9 ~~G~~v~L~C~~~~-~~~~i~W~~ng~~-i~~~-~~r~~~~-------~~~L~I~nv~~~DsG~Y~C~a~e   69 (87)
T cd05873           9 KLGNNAELKCSPKS-NLARVVWKFDGKV-LTPE-SAKYLLY-------RDGLLIFNASEADAGRYQCLSVE   69 (87)
T ss_pred             ECCCCEEEEEECCC-CCCeEEEEECCEE-CCCC-CceEEEE-------CCcEEEeCCCHHHCEEEEEEEEe
Confidence            45677888898764 6788999999854 2222 1344432       56799999999999999999964


No 105
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=98.78  E-value=5.9e-08  Score=60.43  Aligned_cols=72  Identities=19%  Similarity=0.152  Sum_probs=50.5

Q ss_pred             hhhccceeeEEeecCCCcc-EEEEecCCCCcccccccceEEEecCCC-CCCeeeEEEcccCCCC-CEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDIP-VYIWYDSYPTHEAEEYKGRISRVDKES-PFGMASLNLTKIRESD-QGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p-~~~w~k~~~~~~~~~~~~R~~~~~~~~-~~~~~sL~I~~v~~~D-~G~Y~C~~~~~   80 (145)
                      +..+..+.+.|-+.|.|.| .+.|++++.. +...-.+|..+..... .....+|.|.+++.+| .|.|.|.|.|.
T Consensus        13 ~~~G~~v~L~C~~~g~P~P~~v~W~~~~~~-i~~~~~~r~~i~~~~~~~~~~s~L~I~~v~~~d~~G~Y~C~A~N~   87 (98)
T cd05758          13 AILGDKGRVECFIFSTPPPDRIVWTWKENE-LESGSSGRYTVETDPSPGGVLSTLTISNTQESDFQTSYNCTAWNS   87 (98)
T ss_pred             EeCCCcEEEEEEEcccCCCCEeEEEECCEE-ccCCCCCCEEEEEecCCCceEEEEEECCccccccceeEEEEEEcC
Confidence            4567889999999999999 6999998753 2222224555433211 1123689999999955 99999999864


No 106
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=98.75  E-value=3.5e-08  Score=61.05  Aligned_cols=68  Identities=18%  Similarity=0.202  Sum_probs=44.3

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCccccc--ccceEEEecCCCCCCeeeE---EE--cccCCCCCEEEEEEEEE
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEE--YKGRISRVDKESPFGMASL---NL--TKIRESDQGWYECKVVF   79 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~--~~~R~~~~~~~~~~~~~sL---~I--~~v~~~D~G~Y~C~~~~   79 (145)
                      ....+.++.+.|.+.|.|.|.+.|+|++.......  ...+.....      ++++   .|  ..++.+|+|.|+|.+.+
T Consensus        12 ~v~~G~~~~l~C~~~g~P~p~i~W~k~g~~l~~~~~~~~~~~~~~~------~~~~~~~~i~~~~~~~~D~G~Y~C~a~N   85 (100)
T cd07693          12 IVSKGDPATLNCKAEGRPTPTIQWLKNGQPLETDKDDPRSHRIVLP------SGSLFFLRVVHGRKGRSDEGVYVCVAHN   85 (100)
T ss_pred             EEcCCCeEEEEeeCCcCCCCEEEEEECCEECccccCCCCcceEEec------CCcEEEEEeeccCCCcCcCEEEEEEEEc
Confidence            34567889999999999999999999875422111  111222211      2222   22  23479999999999986


Q ss_pred             e
Q psy534           80 L   80 (145)
Q Consensus        80 ~   80 (145)
                      .
T Consensus        86 ~   86 (100)
T cd07693          86 S   86 (100)
T ss_pred             c
Confidence            4


No 107
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=98.75  E-value=8.8e-08  Score=59.38  Aligned_cols=65  Identities=17%  Similarity=0.366  Sum_probs=41.8

Q ss_pred             ceeeEEeecCC---CccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           13 MLSVGDFADDE---DIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        13 ~~~~~~w~~g~---p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +...+.|.+..   +..+..+.........+.+++|+.+...  ...+.+|.|.+++.+|+|.|.|.+..
T Consensus        16 ~~~~v~W~k~~~~~~~~i~~~~~~~~~~~~~~~~~R~~~~~~--~~~~~sL~I~~v~~~D~G~Y~C~v~~   83 (98)
T cd05718          16 QITQVTWMKITGGSKQNIAVFHPQYGISIPPSYEGRVSFLNS--SLEDATISISNLRLEDEGNYICEFAT   83 (98)
T ss_pred             eEEEEEEeeECCCCCEEEEEEecCCCcccCcCcCceEEEeCC--CCCceEEEEccCCcccCEEEEEEEEe
Confidence            34456777722   2222233222222334567889887543  12688999999999999999999863


No 108
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=98.73  E-value=4.9e-08  Score=62.71  Aligned_cols=42  Identities=24%  Similarity=0.332  Sum_probs=33.7

Q ss_pred             ccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           38 EAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        38 ~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ....|++|+.+.. +...++.+|.|++++.+|+|.|+|.+.+.
T Consensus        60 ~~~~f~~R~~~~~-~~~~~~~sL~I~~v~~~D~G~Y~C~v~~~  101 (115)
T cd05880          60 PDGRFKGRVVWDG-NIMRRDASILIWQLQPTDNGTYTCQVKNP  101 (115)
T ss_pred             CcccccCeEEEec-CCcCCceEEEEeeCChhhCEEEEEEEEeC
Confidence            3456888987654 34566899999999999999999999753


No 109
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=98.72  E-value=5.8e-08  Score=58.68  Aligned_cols=67  Identities=15%  Similarity=0.089  Sum_probs=43.9

Q ss_pred             cceeeEEeecCC--CccEEEEecCCCCcccccccc-eEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDE--DIPVYIWYDSYPTHEAEEYKG-RISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~--p~p~~~w~k~~~~~~~~~~~~-R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.|-+.|.  |.|.+.|++.+.......... +... .. .....++|.|.+++.+|+|.|.|.+.+.
T Consensus         2 e~~~L~C~~~g~~~~~~~i~W~~~~~~~~~~~~~~~~~~~-~~-~~~~~s~L~I~~v~~~DsG~Y~C~a~n~   71 (84)
T cd05742           2 ETLVLNCTVLTELNEGVDFQWTYPGKKRGRGKSMVTRQSL-SE-ATELSSTLTIPNATLKDSGTYTCAASSG   71 (84)
T ss_pred             CeEEEEEEEEeCCCccEEEEEecCCcccCCceEeeccccc-cc-ceEEEEEEEECCCChhhCEEEEEEEccC
Confidence            467888999988  889999987654311110000 1110 00 1123678999999999999999999753


No 110
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=98.72  E-value=7e-08  Score=53.96  Aligned_cols=59  Identities=15%  Similarity=0.195  Sum_probs=44.2

Q ss_pred             ccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           11 FQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        11 ~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +..+.+.|...+.|.+.+.|++++... .    .+....     .....|.|.+++.+|+|.|+|.+.+
T Consensus         2 g~~~~l~C~~~~~~~~~v~W~~~~~~~-~----~~~~~~-----~~~~~L~i~~~~~~d~G~Y~C~~~n   60 (63)
T smart00408        2 GQSVTLTCPAEGDPVPNITWLKDGKPL-P----ESNRLS-----ASGSTLTIKSVSLEDSGEYTCVAEN   60 (63)
T ss_pred             CceEEEEeeCccCCCCeEEEEECCEEC-C----CCCEEe-----cCCcEEEEeeCCcccCEEEEEEEec
Confidence            456778898888888999999987432 2    122221     2367899999999999999999864


No 111
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=98.71  E-value=8.7e-08  Score=59.60  Aligned_cols=64  Identities=14%  Similarity=0.211  Sum_probs=44.5

Q ss_pred             eeeEEeec---CCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           14 LSVGDFAD---DEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        14 ~~~~~w~~---g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +..+.|.+   +.|..++..+.........+|++|+.+..  ....+.+|.|++++.+|+|.|+|.+..
T Consensus        16 ~~~v~W~k~~~~~~~~i~~~~~~~~~~~~~~~~~r~~~~~--~~~~~~sL~I~nv~~~D~G~Y~C~~~~   82 (97)
T cd05846          16 VLQVTWQKIQGSSPENIATYSEKYGVKIQPSYFRRRSITS--LGLNSTSITIWNVTLEDEGCYKCIFNT   82 (97)
T ss_pred             eEEEEEEEcCCCCceEEEEEcccCCcccCCCccCeEEEcC--CCCCccEEEEeCCceeeeEEEEEEEEe
Confidence            45677876   22334444444333445567888887753  345689999999999999999999863


No 112
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=98.70  E-value=1.5e-07  Score=57.02  Aligned_cols=65  Identities=12%  Similarity=0.188  Sum_probs=44.4

Q ss_pred             cceeeEEeecCCCccEEEEecCCCCccccccc--ceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDEDIPVYIWYDSYPTHEAEEYK--GRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~--~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .++.+.|-+.|.|.+.+.|++.+... .....  .+..+..   .....+|.|.+++.+|+|.|.|.+.+.
T Consensus         2 e~~~l~C~~~~~~~~~~~W~~~~~~~-~~~~~~~~~~~~~~---~~~~s~L~I~~~~~~DsG~Y~C~a~n~   68 (84)
T cd05861           2 ETITVNCIVQGNEVVDFSWTYPGKDI-GKGIPEVEEVKVPA---TTLRSTLTFPHATVEDSGTYECAAHES   68 (84)
T ss_pred             CcEEEEEEEECCCccEEEEEECCccC-CCCceEEEEEecCC---cEEEEEEEECCCCcCCCEEEEEEEEEC
Confidence            46788999999999999998765321 11111  1222110   112678999999999999999999753


No 113
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=98.69  E-value=1.2e-07  Score=59.95  Aligned_cols=36  Identities=22%  Similarity=0.417  Sum_probs=30.8

Q ss_pred             cccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           39 AEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        39 ~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.+++|..+.      .+++|.|.+++++|+|.|.|++.+.
T Consensus        57 gp~~~gR~~~~------~ngSL~I~~v~~~D~G~Y~~~v~~~   92 (105)
T cd05774          57 GPAYSGRETIY------PNGSLLIQNVTQKDTGFYTLQTITT   92 (105)
T ss_pred             CcccCCcEEEe------CCCcEEEecCCcccCEEEEEEEEeC
Confidence            35688999884      4889999999999999999999753


No 114
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=98.69  E-value=2e-08  Score=61.97  Aligned_cols=62  Identities=21%  Similarity=0.289  Sum_probs=44.6

Q ss_pred             hhhccceeeEEeecC-----CCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            8 KSIFQMLSVGDFADD-----EDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g-----~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..++.+..+.|+..+     +|.|.+.|||++.+. ...  .+ ...      .++.|.|.+++.+|+|.|.|.+.+
T Consensus         7 ~~~g~~~~l~Cp~~~~~~~~~~~p~i~Wyk~~~~i-~~~--~~-~~~------~~~~L~I~~v~~~DsG~YtC~~~n   73 (92)
T cd05757           7 LFSTKGGKIVCPDLDDFKNENTLPPVQWYKDCKLL-EGD--RK-RFV------KGSKLLIQNVTEEDAGNYTCKLTF   73 (92)
T ss_pred             EeeccCCEEECCChHHccCCCCCCcEEEeECCEEC-CCC--cc-EEe------cCCEEEEeeCChhhCEEEEEEEEe
Confidence            345667778887652     367899999998542 211  11 111      378999999999999999999975


No 115
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=98.66  E-value=1.2e-07  Score=57.96  Aligned_cols=63  Identities=14%  Similarity=0.177  Sum_probs=45.3

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCCCccccc-ccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEE-YKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~-~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..+.++.+-|-..+ |.+.+.|++++....... ...|+..       ....|.|.+++.+|+|.|+|.+.+
T Consensus         9 ~~g~~v~L~C~~~~-p~~~i~W~k~~~~~~~~~~~~~~~~~-------~~~~L~I~~~~~~D~G~Y~C~a~~   72 (89)
T cd04979           9 VEGNSVFLECSPKS-NLASVVWLFQGGPLQRKEEPEERLLV-------TEDGLLIRSVSPADAGVYTCQSVE   72 (89)
T ss_pred             ECCCcEEEEEeCCC-CCceEEEEECCcccccccCcCceEEE-------cCCCEEEccCCHHHCEEEEEEEec
Confidence            45678888898877 788999999975421111 1234433       145699999999999999999964


No 116
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=98.64  E-value=1.8e-07  Score=60.04  Aligned_cols=41  Identities=24%  Similarity=0.382  Sum_probs=32.9

Q ss_pred             cccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           39 AEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        39 ~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...|++|+.+..+ ...++.+|.|++++.+|+|.|.|.+.+.
T Consensus        62 ~~~~~~R~~~~~~-~~~~~~sL~I~~v~~~D~G~Y~C~v~~~  102 (116)
T cd05715          62 DGRFKDRVEWVGN-PSRKDASIVIHNLQFTDNGTYTCDVKNP  102 (116)
T ss_pred             CccccCcEEEecC-CcCCeeEEEEeeCCcccCEEEEEEEEeC
Confidence            4567888887532 3455799999999999999999999854


No 117
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=98.63  E-value=2.5e-07  Score=57.16  Aligned_cols=71  Identities=15%  Similarity=0.174  Sum_probs=49.3

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCccc-----ccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEA-----EEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~-----~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +...+..+.+-|.+.+.+.+.+.|++.....+.     ....+|+.....  .....+|.|.+++.+|+|.|+|.+..
T Consensus         8 ~v~~G~~v~L~C~~~~~~~~~v~W~~p~~~~~~~~~~~~~~~~r~~~~~~--~~~~~~L~I~~v~~~DsG~Y~C~~~~   83 (95)
T cd05717           8 TVVEGGTATLKCRVKNNDNSSLQWSNPNQQTLYFNDKRALRDNRIQLVNF--SANELSISISNVSLSDEGRYTCSLYT   83 (95)
T ss_pred             EEcCCCCEEEEEEECCCCCceEEEeCCCCcEEEeccccccccCcEEEEcC--CCCeeEEEEccCCcccCEEEEEEEec
Confidence            356788899999998888899999864321110     011245554321  13467899999999999999999863


No 118
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=98.63  E-value=2e-07  Score=60.19  Aligned_cols=39  Identities=23%  Similarity=0.282  Sum_probs=31.7

Q ss_pred             ccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           40 EEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        40 ~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +++++|+.+..+ ...++++|.|++++.+|+|.|.|++..
T Consensus        63 ~~f~gR~~~~~~-~~~~~~sL~I~~l~~~Dsg~Y~C~~~~  101 (119)
T cd05712          63 ESTRGRFRLLGD-LGKKNCSLLISDAQPEDSGKYFFRVEL  101 (119)
T ss_pred             ccccccEEEecC-CCCCEEEEEEccCChhhCeEEEEEEEc
Confidence            467889887533 456689999999999999999998853


No 119
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=98.63  E-value=1.6e-07  Score=59.40  Aligned_cols=73  Identities=21%  Similarity=0.265  Sum_probs=53.1

Q ss_pred             HHhhhccceeeEEeecCCCccEEEEecCCCC---c--------ccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEE
Q psy534            6 AVKSIFQMLSVGDFADDEDIPVYIWYDSYPT---H--------EAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYE   74 (145)
Q Consensus         6 ~~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~---~--------~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~   74 (145)
                      ..+..+.++.+-|-+.+.+.+.+.||+....   .        ....+.+|+.+... ......+|.|++++.+|+|.|+
T Consensus         8 v~~~~G~~v~L~C~~~~~~~~~v~W~k~~~~~~~~~l~~~~~~~~~~~~~r~~~~~~-~~~~~~~L~I~~~~~~DsG~Y~   86 (109)
T cd04983           8 LSVQEGENVTLNCNYSTSTFYYLFWYRQYPGQGPQFLIYISSNGEEKEKGRFSATLD-KSRKSSSLHISAAQLSDSAVYF   86 (109)
T ss_pred             eEEcCCCCEEEEEEECCCCccEEEEEEECCCCCeEEEEEEecCCCcccCCcEEEEEc-ccCCEEEEEECCCCHHHCEEEE
Confidence            3566788888999888777788899876421   0        01135677776432 2346889999999999999999


Q ss_pred             EEEEE
Q psy534           75 CKVVF   79 (145)
Q Consensus        75 C~~~~   79 (145)
                      |.+.+
T Consensus        87 C~~~~   91 (109)
T cd04983          87 CALSE   91 (109)
T ss_pred             EEEec
Confidence            99874


No 120
>PHA02826 IL-1 receptor-like protein; Provisional
Probab=98.61  E-value=1.3e-07  Score=67.67  Aligned_cols=63  Identities=17%  Similarity=0.278  Sum_probs=46.7

Q ss_pred             hhccceeeEEeec-----CCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            9 SIFQMLSVGDFAD-----DEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         9 ~~~~~~~~~~w~~-----g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..+..+.+.|-+.     |.|.|.+.|||++....   ...|+.+..     .+.+|.|.+++++|+|.|+|.+..
T Consensus       142 ~~G~~v~L~C~~~~~~~~~~p~p~I~WyKng~~l~---~~~r~~~~~-----~~~~L~I~~V~~~DsG~YtC~a~~  209 (227)
T PHA02826        142 NSGKDSKLHCYGTDGISSTFKDYTLTWYKNGNIVL---YTDRIQLRN-----NNSTLVIKSATHDDSGIYTCNLRF  209 (227)
T ss_pred             ecCCCEEEEeeCCCCccccCCCceEEEEECCEECC---CCCCEEEeC-----CCCEEEECcCCHHhCEEEEEEEEE
Confidence            3466778889876     34679999999986432   223555432     356899999999999999999974


No 121
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin. Ig3_Peroxidasin: the third immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.61  E-value=1.2e-07  Score=56.01  Aligned_cols=26  Identities=35%  Similarity=0.621  Sum_probs=24.3

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ...|.|.+++.+|+|.|+|.|.|.+|
T Consensus        39 ~~~L~I~~v~~~D~G~Y~C~A~N~~G   64 (74)
T cd05745          39 SGTLRISRVALHDQGQYECQAVNIVG   64 (74)
T ss_pred             CCeEEEeeCCHHhCEEEEEEEEeCCC
Confidence            34899999999999999999999999


No 122
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=98.60  E-value=2.1e-07  Score=56.06  Aligned_cols=59  Identities=10%  Similarity=0.150  Sum_probs=44.4

Q ss_pred             hhhccceeeEEeecCCCcc-EEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDEDIP-VYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p-~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+.++.+-|-+.|.|.| .+.|+|++.. +..    +.       ....+.|.|.++  .|+|.|.|.|.|.
T Consensus        10 v~~G~~v~l~C~a~G~P~P~~I~W~k~g~~-l~~----~~-------~~~~s~L~i~~~--~d~g~Y~C~A~N~   69 (81)
T cd05749          10 VTANTPFNLTCQAVGPPEPVEILWWQGGSP-LGD----PP-------APSPSVLNVPGL--NETSKFSCEAHNA   69 (81)
T ss_pred             EcCCCCEEEEEEeeeecCCeEEEEEECCEE-CCC----CC-------CCCCCEEEEccc--cCCeEEEEEEEec
Confidence            3457788899999999999 6999999854 221    11       122568999987  5889999999864


No 123
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig5_Contactin-1: fifth Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.59  E-value=1.6e-07  Score=55.45  Aligned_cols=25  Identities=40%  Similarity=0.527  Sum_probs=24.0

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+|.|.+++.+|+|.|+|.|+|.+|
T Consensus        39 g~L~I~~v~~~D~G~Y~C~A~N~~G   63 (73)
T cd05852          39 GSLEILNITKLDEGSYTCFAENNRG   63 (73)
T ss_pred             CEEEECcCChhHCEEEEEEEECCCC
Confidence            4899999999999999999999999


No 124
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=98.59  E-value=2.4e-07  Score=58.40  Aligned_cols=38  Identities=32%  Similarity=0.432  Sum_probs=30.2

Q ss_pred             ccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           40 EEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        40 ~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..+++|+.+..  ...++.+|.|++++.+|+|.|+|.+.+
T Consensus        52 ~~~~~r~~~~~--~~~~~~sL~I~~v~~sD~G~Y~C~v~~   89 (106)
T cd05714          52 GSGRVRVPLYP--ADPGDASLVITDLRLEDSGRYRCEVID   89 (106)
T ss_pred             CCCceEEEeeC--CCCCcceEEECCCCHHHCEEEEEEEEc
Confidence            45667776532  345799999999999999999999974


No 125
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.56  E-value=2.8e-07  Score=57.69  Aligned_cols=70  Identities=21%  Similarity=0.309  Sum_probs=46.6

Q ss_pred             hhccceeeEEeecCC-CccEEEEecCCC---C-----------cccccccceEEEecCCCCCCeeeEEEcccCCCCCEEE
Q psy534            9 SIFQMLSVGDFADDE-DIPVYIWYDSYP---T-----------HEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWY   73 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~-p~p~~~w~k~~~---~-----------~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y   73 (145)
                      ..+..+.+-|.+.+. +...+.||+...   .           ...+.+.+|+.+..+ ......+|.|.+++.+|+|.|
T Consensus         4 ~~G~~v~L~C~~~~~~~~~~v~W~k~~~~~~~~~i~~~~~~~~~~~~~~~~r~~~~~~-~~~~~~sL~I~~v~~~D~G~Y   82 (105)
T cd00099           4 SEGESVTLSCTYSGSFSSYYIFWYRQKPGKGPELLIYISSNGSQYAGGVKGRFSGTRD-SSKSSFTLTISSLQPEDSAVY   82 (105)
T ss_pred             cCCCCEEEEEEEeCCcCcceEEEEEECCCCCCEEEEEEeCCCCccCccCCCcEEEEEe-ccCCEEEEEECCCCHHHCEEE
Confidence            455566666666654 555666666432   0           012456778876543 123578999999999999999


Q ss_pred             EEEEEE
Q psy534           74 ECKVVF   79 (145)
Q Consensus        74 ~C~~~~   79 (145)
                      .|.+..
T Consensus        83 ~C~v~~   88 (105)
T cd00099          83 YCAVSL   88 (105)
T ss_pred             EEEEec
Confidence            999974


No 126
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=98.56  E-value=3.8e-07  Score=54.77  Aligned_cols=60  Identities=12%  Similarity=0.218  Sum_probs=43.1

Q ss_pred             eeeEEeec-CCCccEEEEecCCCCccccc---ccc-eEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEec
Q psy534           14 LSVGDFAD-DEDIPVYIWYDSYPTHEAEE---YKG-RISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLN   81 (145)
Q Consensus        14 ~~~~~w~~-g~p~p~~~w~k~~~~~~~~~---~~~-R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~   81 (145)
                      +.+.|... |+|++.|.||+++.+.....   ..+ ++.        ..++|.|......|.+.|.|+|.+..
T Consensus         2 ~~L~C~s~~skP~a~i~W~k~~~~l~~~~~~~~~~~~~t--------~~s~L~~~~~~~Ddg~~~~C~A~n~a   66 (80)
T cd05885           2 VELTCLSPRSKPAATLRWYRDRKELKGVISQQENGKTVS--------VSNTIRFPVDRKDDGAILSCEASHPA   66 (80)
T ss_pred             EEEEEeCCCccCCCeEEEEECCEECCCCcccccCCceEE--------EEEEEEEEeeeccCCcEEEEEEEChh
Confidence            35779888 78999999999986432111   111 111        15679999999999999999998654


No 127
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=98.54  E-value=3.8e-07  Score=56.13  Aligned_cols=63  Identities=16%  Similarity=0.166  Sum_probs=43.4

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCC--Cccc-ccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYP--THEA-EEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~--~~~~-~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      -.+..+.+-|-. +.|.|.+.||+...  .... ....+|...       ..++|.|.+++++|+|.|.|.+.+
T Consensus         9 ~eG~~v~L~C~~-~~p~p~v~Wykq~~g~~~~~~~~~~~r~~~-------~~~~L~I~~~~~~DsG~Y~C~a~~   74 (91)
T cd05871           9 VENNSTFLECLP-KSPQASVKWLFQRGGDQRKEEVKTEERLIH-------TERGLLLRSLQRSDAGVYTCTAVE   74 (91)
T ss_pred             ecCCcEEEEEEC-CCCCceEEEEEECCCCCccccccccccEEE-------ecCeEEEeeCChhHCEEEEEEEEc
Confidence            346677888875 57889999998532  1100 011234433       256799999999999999999973


No 128
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig3_Contactin-1: Third Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=98.52  E-value=3.6e-07  Score=55.83  Aligned_cols=26  Identities=38%  Similarity=0.643  Sum_probs=24.5

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        52 ~~~L~I~~v~~~D~G~Y~C~A~N~~G   77 (88)
T cd05851          52 GAVLKIFNIQPEDEGTYECEAENIKG   77 (88)
T ss_pred             CCEEEECcCChhhCEEEEEEEEcCCC
Confidence            45899999999999999999999999


No 129
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin. Ig5_Contactin_like: Fifth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.51  E-value=3e-07  Score=54.04  Aligned_cols=25  Identities=36%  Similarity=0.626  Sum_probs=23.9

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        39 ~~L~i~~v~~~D~G~Y~C~a~N~~G   63 (73)
T cd04969          39 GSLEILNVTKSDEGKYTCFAENFFG   63 (73)
T ss_pred             CeEEEccCChhHCEEEEEEEECCCC
Confidence            4899999999999999999999999


No 130
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=98.51  E-value=4.2e-07  Score=54.96  Aligned_cols=61  Identities=16%  Similarity=0.037  Sum_probs=45.9

Q ss_pred             hhhccceeeEEeecC-CCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADD-EDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g-~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+..+.+.|-+.+ .|.+.+.|++++...     ..+..       ..++.|.|.+++.+|+|.|.|.+.+.
T Consensus        13 v~~G~~v~L~C~~~~~~~~~~i~W~~~~~~~-----~~~~~-------~~~~~L~I~~v~~~DsG~Y~C~a~n~   74 (85)
T cd05754          13 VRPGADVSFICRAKSKSPAYTLVWTRVGGGL-----PSRAM-------DFNGILTIRNVQLSDAGTYVCTGSNM   74 (85)
T ss_pred             EcCCCCEEEEEEcCCCCCCcEEEEEECCCcC-----CCccc-------ccCCEEEECCCCHHHCEEEEEEEecc
Confidence            356778888998874 788999999987431     11111       22678999999999999999999753


No 131
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig4_Robo: domain similar to the fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.50  E-value=4.2e-07  Score=55.62  Aligned_cols=36  Identities=28%  Similarity=0.351  Sum_probs=29.5

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC-----CcEEEEeCeeE
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY-----PDLLVVLGSFH  140 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g-----~~~~v~~~~~~  140 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|     ..|.|....++
T Consensus        47 ~~L~I~~v~~~D~G~Y~C~a~N~~G~~~~~~~l~V~~~~~~   87 (90)
T cd05726          47 GDLTITNVQRSDVGYYICQTLNVAGSILTKAYLEVTDVIAD   87 (90)
T ss_pred             CeEEEeeCChhhCEEEEEEEEcCCCceEEEEEEEEeecccC
Confidence            3899999999999999999999999     55555554443


No 132
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig4_L1-CAM_like:  fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=98.50  E-value=4.2e-07  Score=53.86  Aligned_cols=25  Identities=20%  Similarity=0.347  Sum_probs=23.9

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|..|
T Consensus        41 ~~L~I~~~~~~D~G~Y~C~a~N~~G   65 (76)
T cd05867          41 GALILTDVQPSDTAVYQCEARNRHG   65 (76)
T ss_pred             CEEEECCCChhhCEEEEEEEECCCC
Confidence            4899999999999999999999999


No 133
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=98.50  E-value=9e-07  Score=54.92  Aligned_cols=70  Identities=14%  Similarity=0.121  Sum_probs=48.3

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCcc-----cccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEE
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHE-----AEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVV   78 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~-----~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~   78 (145)
                      ++.++..+.+-|-..+.....+.|++-+...+     .+....|+.....  .....+|.|++++.+|+|.|+|.+.
T Consensus         8 tv~~G~ta~L~C~v~~~~~~~v~w~~~~~~~i~~~~~~~~~d~Rf~~~~~--~~~~~tL~I~~vq~~D~G~Y~Cqv~   82 (95)
T cd05881           8 TVVEGEVAIISCRVKNNDDSVIQLLNPNRQTIYFRDVRPLKDSRFQLVNF--SSNELRVSLSNVSLSDEGRYFCQLY   82 (95)
T ss_pred             EEcCCCcEEEEEEEccCCccEEEEEecCCcEEEecCccccCCcCEEEEeC--CCCEEEEEECcCCcccCEEEEEEEE
Confidence            45678888888888876556677775553211     1113456665431  2347789999999999999999986


No 134
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.49  E-value=4.9e-07  Score=54.65  Aligned_cols=60  Identities=17%  Similarity=0.200  Sum_probs=46.2

Q ss_pred             HhhhccceeeEEeec-CCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            7 VKSIFQMLSVGDFAD-DEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~-g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +...+.++.+.|... +.+.+.+.|||++...   .+           ......|.|.+++.+|+|.|+|.+.+.
T Consensus        10 ~V~~G~~vtL~C~~~~~~~~~~~~w~k~g~~~---~~-----------~~~~~~l~I~~~~~~dsG~Y~C~~~~~   70 (83)
T cd05753          10 VVFEGEPLVLRCHGWKNKPVYKVTYYRDGKAK---KY-----------SHSNSNLSIPQATLSDSGSYHCSGIIG   70 (83)
T ss_pred             eecCCCCEEEEeeCCCCCcceEEEEEECCeEc---cc-----------cCCCceEEECccCHHHCEEEEEEEEeC
Confidence            345688999999986 5677889999987421   11           122678999999999999999999764


No 135
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.47  E-value=3.4e-07  Score=54.74  Aligned_cols=55  Identities=13%  Similarity=0.087  Sum_probs=43.2

Q ss_pred             hhhccceeeEEeecCCCc-cEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            8 KSIFQMLSVGDFADDEDI-PVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~-p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ...+.++.+.|-..+.|. +.+.|||++... .               ....+|.|.++ .+|+|.|+|++.+
T Consensus        12 v~~G~~V~L~C~~~~~p~~~~~~W~kng~~l-~---------------~~~~~l~i~~~-~~dsG~Y~C~a~~   67 (78)
T cd05752          12 IFQGEKVTLTCNGFNSPEQNSTQWYHNGKLL-E---------------TTTNSYRIRAA-NNDSGEYRCQTQG   67 (78)
T ss_pred             eeCCCCEEEEEeCCCCCCCccEEEEECCEEe-e---------------ccCCeEEEeec-ccCCEEeEEECCC
Confidence            456778899999888775 469999998431 0               12678999999 9999999999964


No 136
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig3_NCAM-1_like: domain similar to the third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1,and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the
Probab=98.46  E-value=7.5e-07  Score=54.95  Aligned_cols=27  Identities=33%  Similarity=0.628  Sum_probs=24.9

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        56 ~~~~L~I~~v~~~D~G~Y~C~a~N~~G   82 (95)
T cd05730          56 DGSEMTILDVDKLDEAEYTCIAENKAG   82 (95)
T ss_pred             CCCEEEECCCChhhCEEEEEEEEcCCC
Confidence            445799999999999999999999999


No 137
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). Ig4_L1-NrCAM_like: fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related). These proteins belong to the L1 subfamily of cell adhesion molecules (CAMs) and are comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. These molecules are primarily expressed in the nervous system. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=98.45  E-value=6.4e-07  Score=52.78  Aligned_cols=26  Identities=35%  Similarity=0.540  Sum_probs=24.4

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|.+++.+|+|.|+|.|.|..|
T Consensus        40 ~~~L~i~~v~~~D~G~Y~C~A~N~~G   65 (76)
T cd04978          40 GGTLILSNVQPNDTAVYQCNASNVHG   65 (76)
T ss_pred             CCEEEECCCChhhCEEEEEEEEccCC
Confidence            45899999999999999999999999


No 138
>cd04968 Ig3_Contactin_like Third Ig domain of contactin. Ig3_Contactin_like: Third Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.42  E-value=9.3e-07  Score=53.77  Aligned_cols=26  Identities=38%  Similarity=0.643  Sum_probs=24.5

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|.+++.+|+|.|+|.|.|..|
T Consensus        52 ~~~L~i~~v~~~D~G~Y~C~a~N~~G   77 (88)
T cd04968          52 GAVLKIPNIQFEDEGTYECEAENIKG   77 (88)
T ss_pred             CCEEEECCCCcccCEEEEEEEEECCC
Confidence            34899999999999999999999999


No 139
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). Ig8_MLCK: the eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK). MLCK is a key regulator of different forms of cell motility involving actin and myosin II.  Agonist stimulation of smooth muscle cells increases cytosolic Ca2+, which binds calmodulin.  This Ca2+-calmodulin complex in turn binds to and activates MLCK. Activated MLCK leads to the phosphorylation of the 20 kDa myosin regulatory light chain (RLC) of myosin II and the stimulation of actin-activated myosin MgATPase activity. MLCK is widely present in vertebrate tissues; it phosphorylates the 20 kDa RLC of both smooth and nonmuscle myosin II. Phosphorylation leads to the activation of the myosin motor domain and altered structural properties of myosin II. In smooth muscle MLCK it is involved in initiating contraction. In nonmuscle cells, MLCK may participate in cell division and cell motility; it has
Probab=98.41  E-value=9.6e-07  Score=55.06  Aligned_cols=26  Identities=23%  Similarity=0.263  Sum_probs=24.4

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ...|.|.++.++|+|.|+|.|+|.+|
T Consensus        55 ~s~L~I~~~~~~D~G~Ytc~a~N~~G   80 (98)
T cd05762          55 SSKLTITEGQQEHCGCYTLEVENKLG   80 (98)
T ss_pred             eeEEEECCCChhhCEEEEEEEEcCCC
Confidence            35799999999999999999999999


No 140
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=98.41  E-value=1.1e-06  Score=52.73  Aligned_cols=67  Identities=9%  Similarity=0.079  Sum_probs=42.8

Q ss_pred             ceeeEEeecC-CCccEEEEecCCCCcccccccceEEEecCCC-CCCeeeEEEcccCCCCCEEEEEEEEEec
Q psy534           13 MLSVGDFADD-EDIPVYIWYDSYPTHEAEEYKGRISRVDKES-PFGMASLNLTKIRESDQGWYECKVVFLN   81 (145)
Q Consensus        13 ~~~~~~w~~g-~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~-~~~~~sL~I~~v~~~D~G~Y~C~~~~~~   81 (145)
                      |+.+.|++.| .|.+.++|++++... ...... .....+.. ......|.|......|.|.|+|++.+..
T Consensus         1 ~~~L~C~v~g~~P~~~v~W~~~g~~l-~~~~~~-~~~~~~~~~~~~~s~L~i~~~~~~~~~~y~C~a~n~~   69 (82)
T cd05759           1 PYNLTCRARGAKPAAEIIWFRDGEVL-DGATYS-KELLKDGKRETTVSTLPITPSDHDTGRTFTCRARNEA   69 (82)
T ss_pred             CEEEEEEEeCccCCCEEEEEECCEEc-cCceee-eeEecCCCeEEEEEEEEEeCceecCCCEEEEEEcCcc
Confidence            5678999986 698999999987542 211111 11111100 0113568888888889999999997643


No 141
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=98.40  E-value=6.3e-07  Score=55.60  Aligned_cols=64  Identities=16%  Similarity=0.239  Sum_probs=42.4

Q ss_pred             hccceeeEEee----c-CCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           10 IFQMLSVGDFA----D-DEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        10 ~~~~~~~~~w~----~-g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+....++|--    . ..+.|.+.|||+..+ +.. ...+...+     .+...|.|.+|..+|+|.|+|++.+.
T Consensus         9 ~~~~~~l~Cp~~~~f~~~~~~~~v~WYKd~~~-l~~-~~~~~~~~-----~~~~~L~I~~v~~~D~G~YtC~~~~~   77 (95)
T cd05897           9 TSTSGKLVCPDLSDFTINRTDVELQWYKDSVL-LDK-DNEKFYSL-----KGSTYLHIIDVSLNDSGYYTCKLQFT   77 (95)
T ss_pred             cccCcEEECCCHHHcccCCCCCcEEEccCCEE-CcC-CCcceEec-----CCCCEEEEEEcChhhCEEEEEEEEEe
Confidence            44556667742    1 346789999999854 221 11222221     12567999999999999999999763


No 142
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). Ig_CEACAM_D4:  immunoglobulin (Ig)-like domain 4 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the
Probab=98.39  E-value=1.1e-06  Score=54.09  Aligned_cols=27  Identities=30%  Similarity=0.592  Sum_probs=25.0

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+..|.|.+++++|+|.|+|.|.|.+|
T Consensus        53 ~~~~L~I~~v~~~D~G~Y~C~a~N~~G   79 (91)
T cd05740          53 DNRTLTFNNVTRSDTGHYQCEASNEVS   79 (91)
T ss_pred             CCCEEEECcCChhhCEEEEEEEEcCCC
Confidence            445899999999999999999999999


No 143
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily. Ig_2: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.37  E-value=1.2e-06  Score=51.44  Aligned_cols=25  Identities=28%  Similarity=0.460  Sum_probs=23.8

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|..|
T Consensus        40 ~~L~i~~~~~~D~G~Y~C~a~N~~G   64 (74)
T cd05764          40 GTLDILITTVKDTGSFTCIASNAAG   64 (74)
T ss_pred             CEEEEEECChhhCEEEEEEEECCCC
Confidence            4899999999999999999999998


No 144
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). Ig_C5_MyBP_C : the C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C). MyBP_C consists of repeated domains, Ig and fibronectin type 3, and various linkers. Three isoforms of MYBP_C exist and are included in this group: cardiac(c), and fast and slow skeletal muscle (s) MyBP_C. cMYBP_C has insertions between and inside domains and an additional cardiac-specific Ig domain at the N-terminus. For cMYBP_C  an interaction has been demonstrated between this C5 domain and the Ig C8 domain.
Probab=98.37  E-value=1.1e-06  Score=53.42  Aligned_cols=25  Identities=24%  Similarity=0.279  Sum_probs=24.0

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.++.++|+|.|+|.|.|.+|
T Consensus        52 ~~L~I~~~~~~D~G~Y~c~a~N~~G   76 (86)
T cd05894          52 SSFVIEGAEREDEGVYTITVTNPVG   76 (86)
T ss_pred             EEEEECCCccCcCEEEEEEEEeCCC
Confidence            4799999999999999999999999


No 145
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=98.36  E-value=2.1e-06  Score=54.01  Aligned_cols=38  Identities=34%  Similarity=0.443  Sum_probs=30.4

Q ss_pred             ccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           40 EEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        40 ~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..|.+|+.+...  ..++.+|.|.+++.+|+|.|+|.+.+
T Consensus        52 ~~~~~R~~~~~~--~~~~~sL~I~~v~~~DsG~Y~C~v~~   89 (106)
T cd05877          52 GSYQGRVFLRRA--HDLDASLVITDLRLEDYGRYRCEVID   89 (106)
T ss_pred             cCccCcEEecCC--CCCcEEEEEccCChHHCEEEEEEEEe
Confidence            457788887431  24578999999999999999999964


No 146
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=98.35  E-value=1.4e-06  Score=59.87  Aligned_cols=70  Identities=13%  Similarity=0.243  Sum_probs=51.0

Q ss_pred             hhhccceeeEEeec-CCCccEEEEecCCC---------CcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEE
Q psy534            8 KSIFQMLSVGDFAD-DEDIPVYIWYDSYP---------THEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKV   77 (145)
Q Consensus         8 ~~~~~~~~~~~w~~-g~p~p~~~w~k~~~---------~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~   77 (145)
                      .+++.++.+.|-.. +...+.+.|+|...         ..+.++|++|+.+..  ....+.+|.|.+|+++|+|.|.|.+
T Consensus        27 V~ege~VtLsCs~t~s~~~~qVtWkK~~~~IatY~~~g~~i~~~Fk~Rve~mS--~s~~~StItIknVt~sDeGcY~C~F  104 (189)
T PHA02987         27 VSEHVNVKISCNKTSSFNSILITWKKNNKTIAGYGPCGPVIVDKFKNKIEYLS--KSFNESTILIKNVSLKDNGCYTCIF  104 (189)
T ss_pred             EcCCCCEEEEEecCCCCccceEEEEEcCCCEEEEecCCcEEChhhcCeEEEec--cCCCcceEEEEeCChhhCeEEEEEE
Confidence            45667777778775 55667788877632         234566778888533  1245789999999999999999999


Q ss_pred             EE
Q psy534           78 VF   79 (145)
Q Consensus        78 ~~   79 (145)
                      ..
T Consensus       105 ~t  106 (189)
T PHA02987        105 NT  106 (189)
T ss_pred             Ee
Confidence            64


No 147
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM:  third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM.
Probab=98.35  E-value=1.1e-06  Score=51.31  Aligned_cols=27  Identities=26%  Similarity=0.500  Sum_probs=25.0

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        34 ~~~~L~I~~v~~~D~G~Y~C~a~N~~G   60 (71)
T cd05876          34 NNKTLQLDNVLESDDGEYVCTAENSEG   60 (71)
T ss_pred             CCCEEEEcccCHHhCEEEEEEEEcCCC
Confidence            345899999999999999999999999


No 148
>smart00406 IGv Immunoglobulin V-Type.
Probab=98.35  E-value=2.1e-06  Score=50.87  Aligned_cols=36  Identities=33%  Similarity=0.610  Sum_probs=28.7

Q ss_pred             cccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEE
Q psy534           41 EYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKV   77 (145)
Q Consensus        41 ~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~   77 (145)
                      .+.+|+.+... ...+..+|.|.+++.+|+|.|.|.+
T Consensus        46 ~~~~R~~~~~~-~~~~~~~L~i~~~~~~D~G~Y~C~v   81 (81)
T smart00406       46 SYKGRVTISKD-TSKNDVSLTISNLRVEDTGTYYCAV   81 (81)
T ss_pred             ccCCcEEEEec-CcCCEEEEEEcCCCHHHCEEEEEcC
Confidence            56788876543 2356899999999999999999964


No 149
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=98.34  E-value=1.3e-06  Score=55.83  Aligned_cols=73  Identities=11%  Similarity=0.170  Sum_probs=48.8

Q ss_pred             HHhhhccceeeEEeecC--CCccEEEEecCCC---Cc--c-----------cccccceEEEecCCCCCCeeeEEEcccCC
Q psy534            6 AVKSIFQMLSVGDFADD--EDIPVYIWYDSYP---TH--E-----------AEEYKGRISRVDKESPFGMASLNLTKIRE   67 (145)
Q Consensus         6 ~~~~~~~~~~~~~w~~g--~p~p~~~w~k~~~---~~--~-----------~~~~~~R~~~~~~~~~~~~~sL~I~~v~~   67 (145)
                      ..+..+..+.+-|-..+  .+.+.+.||+...   +.  +           ...+.+|+.+..+ ......+|.|.+++.
T Consensus         8 ~~~~~G~~v~l~C~~~~~~~~~~~v~Wyrq~~g~~~~~l~~~~~~~~~~~~~~~~~~r~~~~~~-~~~~~~~L~I~~~~~   86 (116)
T cd04982           8 ITREESKSVTISCKVSGIDFSTTYIHWYRQKPGQALERLLYVSSTSTQRKLSGGTKNKFEARKD-VGKSTSTLTIQNLEK   86 (116)
T ss_pred             EEeCCCCCEEEEEEEeCCCccccEEEEEEECCCCCCEEEEEEecCCCcEEeCcccCCCEEEEEE-CCCCEEEEEEEECCH
Confidence            44566777888887766  5677788887531   10  0           1224567665322 112468899999999


Q ss_pred             CCCEEEEEEEEE
Q psy534           68 SDQGWYECKVVF   79 (145)
Q Consensus        68 ~D~G~Y~C~~~~   79 (145)
                      +|+|.|+|.+..
T Consensus        87 ~Dsg~Y~C~~~~   98 (116)
T cd04982          87 EDSATYYCAYWE   98 (116)
T ss_pred             HHCEEEEEEEec
Confidence            999999999863


No 150
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Ig_Perlecan_D2_like: the immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2. Perlecan consists of five domains. Domain I has three putative heparan sulfate attachment sites; domain II has four LDL receptor-like repeats, and one Ig-like repeat; domain III resembles the short arm of laminin chains; domain IV has multiple Ig-like repeats (21 repeats in human perlecan); and domain V resembles the globular G domain of the laminin A chain and internal repeats of EGF. Perlecan may participate in a variety of biological functions including cell binding, LDL-metabolism, basement membrane assembly and selective permeability, calcium binding, and growth- and neurite-promoting activities.
Probab=98.34  E-value=1.1e-06  Score=52.39  Aligned_cols=25  Identities=32%  Similarity=0.530  Sum_probs=23.8

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|..|
T Consensus        42 ~~L~I~~v~~~D~G~Y~C~a~N~~G   66 (78)
T cd05743          42 GTLTIRDVKESDQGAYTCEAINTRG   66 (78)
T ss_pred             EEEEECCCChHHCEEEEEEEEecCC
Confidence            4799999999999999999999999


No 151
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig6_Contactin-4: sixth Ig domain of the neural cell adhesion molecule contactin-4. Contactins are neural cell adhesion molecules, and are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. Highest expresson of contactin-4 is in testes, thyroid, small intestine, uterus and brain. Contactin-4 plays a role in the response of neuroblastoma cells to differentiating agents, such as retinoids. The contactin 4 gene is associated with cerebellar degeneration in spinocerebellar ataxia type 16.
Probab=98.33  E-value=4.2e-07  Score=55.25  Aligned_cols=33  Identities=27%  Similarity=0.500  Sum_probs=28.2

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC-----CcEEEEe
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY-----PDLLVVL  136 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g-----~~~~v~~  136 (145)
                      .+.|.|.+++.+|+|+|+|.|+|.++     .++.|..
T Consensus        46 ~~~L~I~nv~~~dsG~YtC~a~n~~~~~~a~a~L~V~~   83 (85)
T cd05853          46 AGDLMIRSIQLKHAGKYVCMVQTSVDKLSAAADLIVRG   83 (85)
T ss_pred             CCcEEEecCCHHHCEEEEEEEEcccCceEEEEEEEEec
Confidence            34899999999999999999999998     6666553


No 152
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=98.33  E-value=3.7e-06  Score=52.19  Aligned_cols=68  Identities=19%  Similarity=0.236  Sum_probs=42.1

Q ss_pred             hhhccceeeEEeecCC--CccEEEEecCCC---Cc--------ccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEE
Q psy534            8 KSIFQMLSVGDFADDE--DIPVYIWYDSYP---TH--------EAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYE   74 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~--p~p~~~w~k~~~---~~--------~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~   74 (145)
                      ...+.++.+-|-..+.  ....+.||+...   +.        ....+..|+....   .....+|.|.+++.+|+|.|.
T Consensus         3 v~~G~~v~l~C~~~~~~~~~~~i~Wy~q~~g~~~~~l~~~~~~~~~~~~~rf~~~~---~~~~~~L~I~~~~~~Dsg~Y~   79 (98)
T cd04984           3 VSPGETVTITCTGSSGNISGNYVNWYQQKPGSAPRYLIYEDSDRPSGIPDRFSGSK---SGNTASLTISGAQTEDEADYY   79 (98)
T ss_pred             cCCCCCEEEEEEEcCCCcCCCCEEEEEECCCCCccEEEEeccccCCCCCCCEEEEc---cCCEEEEEECCCChhhCEEEE
Confidence            3456666777766543  344566766542   10        0012334555422   135778999999999999999


Q ss_pred             EEEE
Q psy534           75 CKVV   78 (145)
Q Consensus        75 C~~~   78 (145)
                      |.+.
T Consensus        80 C~~~   83 (98)
T cd04984          80 CQVW   83 (98)
T ss_pred             EEEc
Confidence            9885


No 153
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=98.32  E-value=1.6e-06  Score=53.77  Aligned_cols=70  Identities=21%  Similarity=0.364  Sum_probs=45.2

Q ss_pred             hhhccceeeEEeecC-CCccEEEEecCCCC----------cccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEE
Q psy534            8 KSIFQMLSVGDFADD-EDIPVYIWYDSYPT----------HEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECK   76 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g-~p~p~~~w~k~~~~----------~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~   76 (145)
                      +..+.++.+-|-+.. .....+.||+....          .....+.+|+.+..+ ...+..+|.|.+++.+|+|.|+|.
T Consensus         4 ~~~G~~vtl~C~~~~~~~~~~~~W~r~~~~~~~~~l~~~~~~~~~~~~r~~~~~~-~~~~~~~L~I~~v~~~DsG~Y~C~   82 (98)
T cd05716           4 GELGGSVTIPCPYPPKNRSYEKYWCKWGSAGCCLIIVSEGSVQSQYEGRVSLTDD-PDNGVFTVTLNQLRKEDAGWYWCG   82 (98)
T ss_pred             EEeCCeEEEEeeCCCCCCCcEeEeECCCCCCCCeEEECCCccccccCCCEEEEec-CCCCEEEEEEcCCCHHHCEEEEEE
Confidence            344556666665543 23445566665421          112356788876432 345678999999999999999998


Q ss_pred             EE
Q psy534           77 VV   78 (145)
Q Consensus        77 ~~   78 (145)
                      +.
T Consensus        83 ~~   84 (98)
T cd05716          83 VG   84 (98)
T ss_pred             cc
Confidence            85


No 154
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). Ig4_ NrCAM: fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six IG-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=98.32  E-value=1.7e-06  Score=51.34  Aligned_cols=27  Identities=22%  Similarity=0.417  Sum_probs=24.7

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ++..|.|.+++.+|+|.|+|.|.|..|
T Consensus        39 ~~~~l~i~~v~~~D~G~Y~C~A~N~~G   65 (76)
T cd05868          39 DGDTIIFSKVQERSSAVYQCNASNEYG   65 (76)
T ss_pred             cCCEEEECCCCHhhCEEEEEEEEcCCC
Confidence            345899999999999999999999999


No 155
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=98.31  E-value=2.2e-06  Score=54.37  Aligned_cols=71  Identities=18%  Similarity=0.244  Sum_probs=46.9

Q ss_pred             HHhhhccceeeEEeecCCCccEEEEecCCC---Cc-c----------c-ccccceEEEecCCCCCCeeeEEEcccCCCCC
Q psy534            6 AVKSIFQMLSVGDFADDEDIPVYIWYDSYP---TH-E----------A-EEYKGRISRVDKESPFGMASLNLTKIRESDQ   70 (145)
Q Consensus         6 ~~~~~~~~~~~~~w~~g~p~p~~~w~k~~~---~~-~----------~-~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~   70 (145)
                      ..+..+.++.+-|-..+ +.+.+.|||...   +. +          . ....+|+.....  .....+|.|.+++.+|+
T Consensus         8 ~~v~~G~~v~l~C~~~~-~~~~v~Wykq~~g~~~~~l~~~~~~~~~~~~~~~~~r~~~~~~--~~~~~~L~I~~~~~~Ds   84 (110)
T cd05899           8 LIKGRGQSVTLRCSQTS-GHDNMYWYRQDPGKGLQLLFYSNGGSLNEEEGDPKDRFSASRP--SLTRSSLTIKSAEPEDS   84 (110)
T ss_pred             eEEcCCCcEEEEEEECC-CCCEEEEEEECCCCCcEEEEEEcCCCceEecCccCCceEEECc--CCCccEEEECCCChhhC
Confidence            34567778888887777 667888988642   10 0          0 011345443221  12467899999999999


Q ss_pred             EEEEEEEEE
Q psy534           71 GWYECKVVF   79 (145)
Q Consensus        71 G~Y~C~~~~   79 (145)
                      |.|+|.+..
T Consensus        85 g~Y~Ca~~~   93 (110)
T cd05899          85 AVYLCASSL   93 (110)
T ss_pred             EEEEEEeeC
Confidence            999999863


No 156
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig4_Neogenin: fourth immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=98.30  E-value=1.5e-06  Score=50.84  Aligned_cols=24  Identities=25%  Similarity=0.466  Sum_probs=23.0

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.|.+++.+|+|.|+|.|.|.+|
T Consensus        38 ~l~i~~v~~~D~G~Y~C~A~N~~G   61 (71)
T cd05723          38 NLQVLGLVKSDEGFYQCIAENDVG   61 (71)
T ss_pred             CEEEEcCCcccCEEEEEEEEcCCC
Confidence            688999999999999999999999


No 157
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=98.29  E-value=2e-06  Score=54.02  Aligned_cols=70  Identities=20%  Similarity=0.325  Sum_probs=45.8

Q ss_pred             hhccceeeEEeec-CCCccEEEEecCCC----------------CcccccccceEEEecCCCCCCeeeEEEcccCCCCCE
Q psy534            9 SIFQMLSVGDFAD-DEDIPVYIWYDSYP----------------THEAEEYKGRISRVDKESPFGMASLNLTKIRESDQG   71 (145)
Q Consensus         9 ~~~~~~~~~~w~~-g~p~p~~~w~k~~~----------------~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G   71 (145)
                      ..+.++.+-|... ......+.|++...                ......+.+|+.+..+ ....+.+|.|.+++.+|+|
T Consensus        14 ~~G~~v~L~C~~~~~~~~~~v~W~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~r~~~~~~-~~~~~~sL~i~~l~~~DsG   92 (114)
T PF07686_consen   14 QEGESVTLPCSYSSSSNQSSVYWYRQSPGQGPQLIIRYSLSSTNETPTPSYSGRFTFSGN-GSQNNFSLTIKNLQPSDSG   92 (114)
T ss_dssp             ETTSEEEEEEEEESSSSGSEEEEEEEETTSEEEEEEEEETTEEEEEEETTETTTEEEEEE-TTTTEEEEEESSESGGGEE
T ss_pred             ecCCCEEEEEEEeCCCCcceEEEEEECccccceeeeeeccceeeeccccceeeeeeeeec-ccCCeEEEEECCCCcCcCE
Confidence            3455566666666 44555666665322                1123446677776443 2355789999999999999


Q ss_pred             EEEEEEEE
Q psy534           72 WYECKVVF   79 (145)
Q Consensus        72 ~Y~C~~~~   79 (145)
                      .|.|.+..
T Consensus        93 ~Y~C~v~~  100 (114)
T PF07686_consen   93 TYFCQVST  100 (114)
T ss_dssp             EEEEEEEE
T ss_pred             EEEEEEEE
Confidence            99999964


No 158
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4. Ig2_PTK7: domain similar to the second immunoglobulin (Ig)-like domain in protein tyrosine kinase (PTK) 7, also known as CCK4. PTK7 is a subfamily of the receptor protein tyrosine kinase family, and is referred to as an RPTK-like molecule. RPTKs transduce extracellular signals across the cell membrane, and play important roles in regulating cell proliferation, migration, and differentiation. PTK7 is organized as an extracellular portion having seven Ig-like domains, a single transmembrane region, and a cytoplasmic tyrosine kinase-like domain. PTK7 is considered a pseudokinase as it has several unusual residues in some of the highly conserved tyrosine kinase (TK) motifs; it is predicted to lack TK activity. PTK7 may function as a cell-adhesion molecule. PTK7 mRNA is expressed at high levels in placenta, melanocytes, liver, lung, pancreas, and kidney. PTK7 is overexpressed in s
Probab=98.29  E-value=3.1e-06  Score=50.25  Aligned_cols=26  Identities=23%  Similarity=0.367  Sum_probs=24.2

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|.+++.+|+|.|.|.|.|.+|
T Consensus        37 ~~~L~I~~~~~~D~G~Y~C~a~N~~G   62 (77)
T cd05760          37 ERTLTLRSAGPDDSGLYYCCAHNAFG   62 (77)
T ss_pred             CCEEEEeeCCcccCEEEEEEEEeCCC
Confidence            34899999999999999999999998


No 159
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin. Ig4_Peroxidasin: the fourth immunoglobulin (Ig)-like domain in peroxidasin. Peroxidasin has a peroxidase domain and interacting extracellular motifs containing four Ig-like domains. It has been suggested that peroxidasin is secreted, and has functions related to the stabilization of the extracellular matrix. It may play a part in various other important processes such as removal and destruction of cells, which have undergone programmed cell death, and protection of the organism against non-self.
Probab=98.29  E-value=1.6e-06  Score=50.37  Aligned_cols=26  Identities=27%  Similarity=0.488  Sum_probs=24.5

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ...|.|.+++.+|+|.|+|.|.|.+|
T Consensus        35 ~~~L~I~~~~~~D~G~Y~C~a~N~~G   60 (69)
T cd05746          35 EGYLAIRDVGVADQGRYECVARNTIG   60 (69)
T ss_pred             CCEEEECcCChhhCEEEEEEEECCCC
Confidence            44899999999999999999999999


No 160
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily. Ig_3: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.28  E-value=2.4e-06  Score=50.86  Aligned_cols=25  Identities=40%  Similarity=0.445  Sum_probs=23.9

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        47 ~~L~I~~~~~~D~G~Y~C~a~N~~G   71 (81)
T cd05765          47 GQLVIYNAQPQDAGLYTCTARNSGG   71 (81)
T ss_pred             cEEEEccCCcccCEEEEEEEecCCc
Confidence            4899999999999999999999999


No 161
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig4_Contactin-2-like: fourth Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=98.28  E-value=1.6e-06  Score=52.55  Aligned_cols=25  Identities=32%  Similarity=0.545  Sum_probs=23.9

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|..|
T Consensus        51 ~~L~i~~~~~~D~G~Y~C~a~N~~G   75 (85)
T cd05728          51 GDLRITKLSLSDSGMYQCVAENKHG   75 (85)
T ss_pred             CEEEEeeCCHHHCEEEEEEEECCCC
Confidence            4899999999999999999999999


No 162
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=98.28  E-value=2.3e-06  Score=54.79  Aligned_cols=72  Identities=17%  Similarity=0.213  Sum_probs=47.5

Q ss_pred             HhhhccceeeEEeecCC-CccEEEEecCCCC-----------cccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEE
Q psy534            7 VKSIFQMLSVGDFADDE-DIPVYIWYDSYPT-----------HEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYE   74 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~-p~p~~~w~k~~~~-----------~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~   74 (145)
                      .+..+..+.+-|...+. ....+.||+...-           .....+++|+.+..+ ....+.+|.|.+++.+|+|.|+
T Consensus        10 ~~~~G~~v~L~C~~~~~~~~~~v~Wyrq~~~~~~~~l~~~~~~~~~~~~~R~~~~~~-~~~~~~sL~I~~~~~~Dsg~Y~   88 (116)
T cd07706          10 SVQVGEEVTLNCRYETSWTNYYIFWYKQLPSGEMTFLIRQKSIYGNATKGRYSVNFQ-KAQKSISLTISALQLEDSAKYF   88 (116)
T ss_pred             EEcCCCCEEEEEEEeCCCCceEEEEEEECCCCceEEEEEecCccCCccCCeEEEEEe-ccCCEEEEEECCCCHHHCEEEE
Confidence            35566777777776643 3455777765310           012245678876421 2345789999999999999999


Q ss_pred             EEEEE
Q psy534           75 CKVVF   79 (145)
Q Consensus        75 C~~~~   79 (145)
                      |.+..
T Consensus        89 C~~~~   93 (116)
T cd07706          89 CALST   93 (116)
T ss_pred             EEEEC
Confidence            99874


No 163
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig2_Robo: domain similar to the second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antago
Probab=98.28  E-value=2.7e-06  Score=51.21  Aligned_cols=26  Identities=35%  Similarity=0.598  Sum_probs=24.3

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLYP  130 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g~  130 (145)
                      ..|.|.+++.+|+|.|+|.|.|..|.
T Consensus        51 ~~L~I~~~~~~D~G~Y~C~a~N~~G~   76 (86)
T cd05724          51 GNLLIAEARKSDEGTYKCVATNMVGE   76 (86)
T ss_pred             CEEEEeECCcccCEEEEEEEEeccCc
Confidence            48999999999999999999999983


No 164
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=98.27  E-value=6e-06  Score=50.20  Aligned_cols=66  Identities=18%  Similarity=0.150  Sum_probs=40.4

Q ss_pred             cceeeEEeecCCC--ccEEEEecCCCCcccccccc--eEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           12 QMLSVGDFADDED--IPVYIWYDSYPTHEAEEYKG--RISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        12 ~~~~~~~w~~g~p--~p~~~w~k~~~~~~~~~~~~--R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      .++.+.|-+.+.+  ...+.|...+..........  |.....  .....+.|.|.+++.+|+|.|.|.+.+
T Consensus         2 e~~~L~C~~~~~~~~~~~~~W~~p~~~~~~~~~~~~~~~~~~~--~~~~~s~L~I~~~~~~DsG~Y~C~a~n   71 (86)
T cd05862           2 EKLVLNCTARTELNVGIDFQWDYPGKKEQRAKSVSENRRSLQE--HTELSSTLTIENVTLSDLGRYTCTASS   71 (86)
T ss_pred             CcEEEEEEEEeCCCCcEEEEEEcCCcccccceecccccccccc--cceeeeEEEEecCCcccCEEEEEEEee
Confidence            4677889887654  55778966543211100001  111100  112367899999999999999999975


No 165
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=98.26  E-value=2.8e-06  Score=49.27  Aligned_cols=57  Identities=21%  Similarity=0.344  Sum_probs=39.6

Q ss_pred             eeeEEeecCCC-ccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           14 LSVGDFADDED-IPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        14 ~~~~~w~~g~p-~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +.+.|.+.+.+ .+.+.|+... ..   ....+...     .....+|.|.++..+|.|.|.|.|.+
T Consensus        18 ~~l~C~~~~~~~~~~~~W~~~~-~~---~~~~~~~~-----~~~~~~L~i~~v~~~~~g~y~C~a~N   75 (75)
T PF13927_consen   18 VTLTCSAEGGPPPPSISWYDSN-PS---FNSNSRGS-----SSSNSTLTISNVTRSDNGTYTCIASN   75 (75)
T ss_dssp             EEEEEEESSEESSEEEEEETEE-EE---EEEEEEEE-----EEEEEEEEESSCCGGGTEEEEEEEEE
T ss_pred             EEEEEEEccccCCeEEEEEecC-Cc---eeeeeeec-----cceeeEEEEccCCHHhCcEEEEEEEC
Confidence            78889999776 8899999111 10   01111111     12388899999999999999999864


No 166
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). Ig2_VEGFR-3: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-3 (Flt-4) binds two members of the VEGF family (VEGF-C and -D) and is involved in tumor angiogenesis and growth.
Probab=98.25  E-value=1.3e-06  Score=50.75  Aligned_cols=27  Identities=19%  Similarity=0.287  Sum_probs=24.9

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+..|.|.++..+|+|.|+|.|+|..|
T Consensus        29 ~~~~L~i~~v~~~D~G~YtC~a~N~~g   55 (67)
T cd05863          29 SQHSLQIKDVTEASAGTYTLVLWNSAA   55 (67)
T ss_pred             CcCEEEECCCCHHHCEEEEEEEEECCc
Confidence            345899999999999999999999998


No 167
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=98.23  E-value=3.6e-06  Score=53.01  Aligned_cols=71  Identities=17%  Similarity=0.167  Sum_probs=45.7

Q ss_pred             HHHhhhccceeeEEeecCCC-ccEEEEecCCC---C--cc------cccccceEEEecCCCCCCeeeEEEcccCCCCCEE
Q psy534            5 FAVKSIFQMLSVGDFADDED-IPVYIWYDSYP---T--HE------AEEYKGRISRVDKESPFGMASLNLTKIRESDQGW   72 (145)
Q Consensus         5 ~~~~~~~~~~~~~~w~~g~p-~p~~~w~k~~~---~--~~------~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~   72 (145)
                      +.+++.+..+.+-|-+.+.. ...+.||+...   .  .+      ......|+....   .....+|.|.+++.+|+|.
T Consensus         9 ~~~v~~G~~v~L~C~~~~~~~~~~~~Wyrq~~g~~~~~l~~~~~~~~~~~~~r~~~~~---~~~~~~L~I~~~~~~Dsg~   85 (106)
T cd04980           9 TLSVSPGESATISCKASQSVSSNYLAWYQQKPGQAPKLLIYGASTLASGTPSRFSGSG---SGTDFTLTISRVEPEDAAV   85 (106)
T ss_pred             cEEECCCCCEEEEEEECCCCCCCcEEEEEECCCCCcEEEEECccccCCCCCCCEEEec---cCCEEEEEECCCChHHCEE
Confidence            34556778888888776554 56688887541   0  00      011123444321   2346789999999999999


Q ss_pred             EEEEEE
Q psy534           73 YECKVV   78 (145)
Q Consensus        73 Y~C~~~   78 (145)
                      |+|.+.
T Consensus        86 Y~Ca~~   91 (106)
T cd04980          86 YYCQQY   91 (106)
T ss_pred             EEEEEe
Confidence            999885


No 168
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig8_DSCAM:  the eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=98.23  E-value=1.6e-06  Score=52.93  Aligned_cols=25  Identities=24%  Similarity=0.348  Sum_probs=23.7

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.++..+|+|.|+|.|.|.+|
T Consensus        47 s~L~I~~~~~~D~G~YtC~A~N~~G   71 (88)
T cd05735          47 STLQILPTVREDSGFFSCHAINSYG   71 (88)
T ss_pred             EEEEECCCCcccCEEEEEEEEcCCC
Confidence            3799999999999999999999999


No 169
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). Ig3_L1-CAM_like: domain similar to the third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains the chicken neuron-glia cell adhesion molecule, Ng-CAM and human neurofascin.
Probab=98.22  E-value=2.2e-06  Score=49.74  Aligned_cols=26  Identities=35%  Similarity=0.671  Sum_probs=24.4

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|.+++.+|+|.|+|.|.|..|
T Consensus        35 ~~~L~i~~v~~~D~G~Y~C~a~N~~G   60 (71)
T cd05731          35 NKTLKIDNVSEEDDGEYRCTASNSLG   60 (71)
T ss_pred             CCEEEECCCCHHHCEEEEEEEEeCCc
Confidence            34899999999999999999999999


No 170
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Ig_Myomesin_like_C: domain similar to the C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein. Myomesin and M-protein are both structural proteins localized to the M-band, a transverse structure in the center of the sarcomere, and are candidates for M-band bridges. Both proteins are modular, consisting mainly of repetitive Ig-like and fibronectin type III (FnIII) domains. Myomesin is expressed in all types of vertebrate striated muscle; M-protein has a muscle-type specific expression pattern. Myomesin is present in both slow and fast fibers; M-protein is present only in fast fibers. It has been suggested that myomesin acts as a molecular spring with alternative splicing as a means of modifying its elasticity.
Probab=98.22  E-value=3.5e-06  Score=51.73  Aligned_cols=25  Identities=24%  Similarity=0.388  Sum_probs=23.7

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        58 ~~L~I~~v~~~D~G~Y~C~a~N~~G   82 (92)
T cd05737          58 ASLTIKGVSSEDSGKYGIVVKNKYG   82 (92)
T ss_pred             EEEEEccCChhhCEEEEEEEEECCC
Confidence            3799999999999999999999999


No 171
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). Ig2_FGFRL1-like: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1). FGFRL1 is comprised of a signal peptide, three extracellular Ig-like modules, a transmembrane segment, and a short intracellular domain. FGFRL1 is expressed preferentially in skeletal tissues. Similar to FGF receptors, the expressed protein interacts specifically with heparin and with FGF2.  FGFRL1 does not have a protein tyrosine kinase domain at its C terminus; neither does its cytoplasmic domain appear to interact with a signaling partner. It has been suggested that FGFRL1 may not have any direct signaling function, but instead acts as a decoy receptor trapping FGFs and preventing them from binding other receptors.
Probab=98.22  E-value=2.8e-06  Score=50.59  Aligned_cols=25  Identities=28%  Similarity=0.534  Sum_probs=23.7

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|..|
T Consensus        48 ~~L~i~~v~~~D~G~Y~C~a~N~~G   72 (82)
T cd05856          48 WTLSLKNLKPEDSGKYTCHVSNRAG   72 (82)
T ss_pred             EEEEEccCChhhCEEEEEEEEcCCc
Confidence            4799999999999999999999999


No 172
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=98.21  E-value=5.9e-06  Score=51.84  Aligned_cols=47  Identities=23%  Similarity=0.393  Sum_probs=33.6

Q ss_pred             cEEEEecCCCCccccc---cc-ceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           26 PVYIWYDSYPTHEAEE---YK-GRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        26 p~~~w~k~~~~~~~~~---~~-~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..+.|||++.....+.   +. .|++.       ....|.|.++..+|+|.|.|++.+
T Consensus        41 ~~v~WyK~~~~~~~~~~~~~~~~Ri~~-------~~~~Lwf~Pa~~eDSG~Y~C~~rN   91 (104)
T cd05896          41 LSLMWYKSSGDGEEPIEIIFDGVRMSK-------EEDSIWFRPAELQDSGLYTCVLRN   91 (104)
T ss_pred             ceEEEEECCCCCCCCCcccccceeEEE-------eCCEEEEEeCChhhCeEEEEEECC
Confidence            4789999963211111   21 35553       378899999999999999999975


No 173
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin. Ig_Myotilin_C: C-terminal immunoglobulin (Ig)-like domain of myotilin. Mytolin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to the latter family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Myotilin is most abundant in skeletal and cardiac muscle, and is involved in maintaining sarcomere integrity. It binds to alpha-actinin, filamin and actin. Mutations in myotilin lead to muscle disorders.
Probab=98.21  E-value=1.2e-06  Score=52.04  Aligned_cols=24  Identities=33%  Similarity=0.343  Sum_probs=23.4

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +|.|.+++.+|+|.|+|.|.|.+|
T Consensus        42 ~L~I~~~~~~D~G~Y~C~A~N~~G   65 (75)
T cd05892          42 TLLIKNVNKKDAGWYTVSAVNEAG   65 (75)
T ss_pred             EEEECCCChhhCEEEEEEEEcCcC
Confidence            799999999999999999999999


No 174
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig1_FGFR: The first immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for all FGFs.
Probab=98.20  E-value=3.5e-06  Score=50.27  Aligned_cols=26  Identities=27%  Similarity=0.514  Sum_probs=24.0

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|.+++.+|+|.|+|.|.|..|
T Consensus        44 ~~~L~I~~~~~~DsG~Y~C~a~n~~g   69 (79)
T cd04973          44 GEEVQIKDAVPRDSGLYACVTSSPSG   69 (79)
T ss_pred             CCEEEECCCChhhCEEEEEEEeCCCC
Confidence            34899999999999999999999988


No 175
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily. Ig_1: subgroup of the immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of the Ig superfamily are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.20  E-value=2.3e-06  Score=50.47  Aligned_cols=27  Identities=22%  Similarity=0.449  Sum_probs=24.7

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+..|.|.+++.+|+|.|+|.|.|..|
T Consensus        38 ~~~~L~I~~~~~~D~G~Y~C~A~N~~G   64 (75)
T cd05763          38 EDDVFFIVDVKIEDTGVYSCTAQNTAG   64 (75)
T ss_pred             CCCEEEEeeCCcccCEEEEEEEEcCCC
Confidence            344899999999999999999999998


No 176
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Ig3_Robo: domain similar to the third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit responsiveness, antagoni
Probab=98.20  E-value=1.4e-06  Score=50.50  Aligned_cols=26  Identities=35%  Similarity=0.625  Sum_probs=24.3

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        34 ~~~L~I~~v~~~D~G~Y~C~a~N~~G   59 (69)
T cd05725          34 DKSLKIRNVTAGDEGSYTCEAENMVG   59 (69)
T ss_pred             CCEEEECcCChhHCEEEEEEEEcCCC
Confidence            34899999999999999999999999


No 177
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig6_Contactin-2: Sixth Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=98.20  E-value=1.9e-06  Score=52.29  Aligned_cols=25  Identities=36%  Similarity=0.539  Sum_probs=23.9

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +.|.|.+++.+|+|.|+|.|.|.+|
T Consensus        47 ~~L~I~~v~~~D~G~YtC~A~n~~g   71 (85)
T cd05854          47 GDLVIVNAQLSHAGTYTCTAQTVVD   71 (85)
T ss_pred             eEEEEccCChhhCeEEEEEEecCCC
Confidence            4899999999999999999999999


No 178
>PHA03376 BARF1; Provisional
Probab=98.20  E-value=6.8e-06  Score=56.60  Aligned_cols=64  Identities=11%  Similarity=-0.028  Sum_probs=43.7

Q ss_pred             ceeeEEeecCCC-cc--EEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           13 MLSVGDFADDED-IP--VYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        13 ~~~~~~w~~g~p-~p--~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +-+.+.|+|..| .+  .+.+...+.....-++++|..++.+   .++.+|.|.+++.+|.|.|+|.+..
T Consensus        42 ~~MrIrWqKs~p~~~~VvL~~~ggdVv~~QmEyRGrtD~~~~---~gnvsLvI~~l~lSDdGtY~C~fQk  108 (221)
T PHA03376         42 PEIEVSWFKLGPGEEQVLIGRMHHDVIFIEWPFRGFFDIHRS---ANTFFLVVTAANISHDGNYLCRMKL  108 (221)
T ss_pred             CceEEEEEecCCCCCCEEEEEcCCeeeeeeeccccEEEEEec---CCeEEEEEEeeeecCCceEEEEEEc
Confidence            456677888444 22  2333333222233468889888764   3799999999999999999999954


No 179
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. Ig2_FGFR: second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three IG-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin sulfate proteoglycans.
Probab=98.19  E-value=7e-06  Score=49.37  Aligned_cols=25  Identities=24%  Similarity=0.453  Sum_probs=23.5

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        51 ~~l~i~~~~~~D~G~Y~C~a~N~~G   75 (85)
T cd05857          51 WSLIMESVVPSDKGNYTCVVENEYG   75 (85)
T ss_pred             eEEEEccCCcccCEEEEEEEEeCCC
Confidence            3799999999999999999999999


No 180
>smart00409 IG Immunoglobulin.
Probab=98.18  E-value=1.1e-05  Score=47.31  Aligned_cols=65  Identities=18%  Similarity=0.261  Sum_probs=48.2

Q ss_pred             hhhccceeeEEeecCCCccEEEEecC-CCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEE
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDS-YPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVV   78 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~-~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~   78 (145)
                      ...+.++.+.|-+.+.+.+.+.|+++ ... +.  ...+..+...   ....+|.|.+++.+|+|.|.|.+.
T Consensus         6 ~~~g~~~~l~C~~~~~~~~~~~W~~~~~~~-v~--~~~~~~~~~~---~~~~~l~i~~~~~~d~G~Y~C~v~   71 (86)
T smart00409        6 VKEGESVTLSCEVSGSPPPEVTWYKQGGKL-LA--ESGRFSVSRS---GSNSTLTISNVTPEDSGTYTCAAT   71 (86)
T ss_pred             EeCCCeEEEEEEEccCCCCeEEEEECCCEE-cC--CCCcEEEEEc---CCeeEEEEEeeccccCeEEEEEEE
Confidence            34577888999998888889999988 432 21  3345554332   125789999999999999999997


No 181
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=98.18  E-value=1.1e-05  Score=47.31  Aligned_cols=65  Identities=18%  Similarity=0.261  Sum_probs=48.2

Q ss_pred             hhhccceeeEEeecCCCccEEEEecC-CCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEE
Q psy534            8 KSIFQMLSVGDFADDEDIPVYIWYDS-YPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVV   78 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~p~p~~~w~k~-~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~   78 (145)
                      ...+.++.+.|-+.+.+.+.+.|+++ ... +.  ...+..+...   ....+|.|.+++.+|+|.|.|.+.
T Consensus         6 ~~~g~~~~l~C~~~~~~~~~~~W~~~~~~~-v~--~~~~~~~~~~---~~~~~l~i~~~~~~d~G~Y~C~v~   71 (86)
T smart00410        6 VKEGESVTLSCEVSGSPPPEVTWYKQGGKL-LA--ESGRFSVSRS---GSNSTLTISNVTPEDSGTYTCAAT   71 (86)
T ss_pred             EeCCCeEEEEEEEccCCCCeEEEEECCCEE-cC--CCCcEEEEEc---CCeeEEEEEeeccccCeEEEEEEE
Confidence            34577888999998888889999988 432 21  3345554332   125789999999999999999997


No 182
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2. Ig1_NCAM-2:  first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 (OCAM/mamFas II, RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=98.18  E-value=4.2e-06  Score=51.61  Aligned_cols=25  Identities=36%  Similarity=0.461  Sum_probs=23.8

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.++..+|+|.|+|.|.|..|
T Consensus        56 ~~L~I~~v~~~D~G~Y~C~A~N~~G   80 (92)
T cd05866          56 SRLTIYNANIEDAGIYRCQATDAKG   80 (92)
T ss_pred             eEEEEecCChHHCEEEEEEEEcCCC
Confidence            3799999999999999999999998


No 183
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d5: the fifth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrkB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor foun
Probab=98.17  E-value=2.8e-06  Score=51.11  Aligned_cols=24  Identities=25%  Similarity=0.297  Sum_probs=23.4

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.|.+++.+|+|.|+|.|+|.+|
T Consensus        47 ~L~I~~~~~~D~G~YtC~A~N~~G   70 (81)
T cd04971          47 CLQFDNPTHVNNGNYTLVASNEYG   70 (81)
T ss_pred             EEEECCCCcccCeEEEEEEEeCCC
Confidence            799999999999999999999999


No 184
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC. TrkABC_d4: the fourth domain of Trk receptors TrkA, TrkB and TrkC, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors. They are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkA, TrkB, and TrkC share significant sequence homology and domain organization. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrkA, Band C mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. TrkA is recognized by NGF. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. TrkC is recognized by NT-3. NT-3 is promiscuous as in some cell systems it activates TrkA and TrkB receptors. TrkA is a receptor fo
Probab=98.16  E-value=4.9e-06  Score=50.81  Aligned_cols=25  Identities=32%  Similarity=0.389  Sum_probs=23.8

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|.|.|+|.|.|.+|
T Consensus        56 ~~L~I~~v~~~D~g~Y~C~A~N~~G   80 (90)
T cd04972          56 YNLQLSNITSETQTTVTCTAENPVG   80 (90)
T ss_pred             EEEEEecCCcccCEEEEEEEECCCC
Confidence            4799999999999999999999999


No 185
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Ig3_FGFR: third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs.
Probab=98.15  E-value=2.4e-06  Score=52.31  Aligned_cols=25  Identities=36%  Similarity=0.626  Sum_probs=23.8

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        55 ~~L~I~~v~~~D~G~Y~C~A~N~~G   79 (90)
T cd04974          55 EVLYLRNVSFDDAGEYTCLAGNSIG   79 (90)
T ss_pred             ceEEEeccccccCcEEEEEeecccC
Confidence            4799999999999999999999999


No 186
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=98.15  E-value=9.1e-06  Score=53.67  Aligned_cols=22  Identities=41%  Similarity=0.591  Sum_probs=19.8

Q ss_pred             eeEEEcccCCCCCEEEEEEEEE
Q psy534           58 ASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        58 ~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      .+|.|.+++.+|+|.|.|.+.+
T Consensus         1 asL~i~~v~~~D~G~Y~C~~~~   22 (139)
T cd05771           1 ASLTLPGLTVHDEGTYICSVST   22 (139)
T ss_pred             CeEEECCCCHHHCEEEEEEEEc
Confidence            4799999999999999999854


No 187
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). Ig_M-protein_C: the C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2). M-protein is a structural protein localized to the M-band, a transverse structure in the center of the sarcomere, and is a candidate for M-band bridges. M-protein is modular consisting mainly of repetitive IG-like and fibronectin type III (FnIII) domains, and has a muscle-type specific expression pattern. M-protein is present in fast fibers.
Probab=98.14  E-value=1.4e-05  Score=49.12  Aligned_cols=24  Identities=25%  Similarity=0.365  Sum_probs=23.3

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.|.+++.+|+|.|+|.|.|.+|
T Consensus        59 ~L~I~~~~~~D~G~Y~C~a~N~~G   82 (92)
T cd05891          59 SLTIKGVTSEDSGKYSINVKNKYG   82 (92)
T ss_pred             EEEECCCChhhCEEEEEEEEeCCC
Confidence            799999999999999999999999


No 188
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin. Ig_Palladin_C: C-terminal immunoglobulin (Ig)-like domain of palladin. Palladin belongs to the palladin-myotilin-myopalladin family. Proteins belonging to this family contain multiple Ig-like domains and function as scaffolds, modulating actin cytoskeleton. Palladin binds to alpha-actinin ezrin, vasodilator-stimulated phosphoprotein VASP, SPIN90 (DIP, mDia interacting protein), and Src. Palladin also binds F-actin directly, via its Ig3 domain. Palladin is expressed as several alternatively spliced isoforms, having various combinations of Ig-like domains, in a cell-type-specific manner. It has been suggested that palladin's different Ig-like domains may be specialized for distinct functions.
Probab=98.13  E-value=1.8e-06  Score=51.15  Aligned_cols=24  Identities=29%  Similarity=0.201  Sum_probs=23.2

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.|.+++.+|+|.|+|.|.|.+|
T Consensus        42 ~L~I~~v~~~D~G~Y~C~A~N~~G   65 (75)
T cd05893          42 CLLIQGATKEDAGWYTVSAKNEAG   65 (75)
T ss_pred             EEEECCCCHHHCEEEEEEEEcCCC
Confidence            599999999999999999999999


No 189
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). Ig2_VEGF-2: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-2 (KDR/Flk-1) is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF-A also interacts with VEGFR-1, which it binds more strongly than VEGFR-2.  VEGFR-2 and -1 may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=98.13  E-value=1.8e-06  Score=50.57  Aligned_cols=27  Identities=30%  Similarity=0.550  Sum_probs=24.8

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+..|.|.++..+|+|.|+|.|.|.+|
T Consensus        32 ~~~~L~I~~v~~~D~G~YtC~a~N~~G   58 (70)
T cd05864          32 RGVHLTIYEVTEKDAGNYTVVLTNPIT   58 (70)
T ss_pred             cCCEEEECcCCHHHCEEEEEEEEECCC
Confidence            345899999999999999999999998


No 190
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin. Ig6_Contactin_like: Sixth Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 week
Probab=98.13  E-value=2.5e-06  Score=51.54  Aligned_cols=26  Identities=35%  Similarity=0.561  Sum_probs=24.2

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+.|.|.+++.+|+|.|+|.|.|.+|
T Consensus        46 ~~~L~I~~v~~~D~G~Y~C~a~n~~g   71 (85)
T cd04970          46 NGDLMIRNAQLKHAGKYTCTAQTVVD   71 (85)
T ss_pred             cceEEEccCCHHhCeeeEEEEecCCC
Confidence            34899999999999999999999998


No 191
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=98.13  E-value=2.2e-05  Score=48.98  Aligned_cols=73  Identities=16%  Similarity=0.092  Sum_probs=50.6

Q ss_pred             HhhhccceeeEEeecCCCcc-EEEEecCCCCcccccccceEEEecCCCC-CCeeeEEEcccCCCC-CEEEEEEEEEe
Q psy534            7 VKSIFQMLSVGDFADDEDIP-VYIWYDSYPTHEAEEYKGRISRVDKESP-FGMASLNLTKIRESD-QGWYECKVVFL   80 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p-~~~w~k~~~~~~~~~~~~R~~~~~~~~~-~~~~sL~I~~v~~~D-~G~Y~C~~~~~   80 (145)
                      .+..+..+.+.|-+.+.|.| .+.|..++. .++....+|+.+.+.... .....|.|.++..+| .|.|.|.|.|.
T Consensus        12 ~~~~G~~~~L~C~~~s~P~P~~i~W~w~~~-~i~~~~~~r~~I~~~~~~~g~~S~L~I~~~~~~d~~g~Y~C~a~N~   87 (98)
T cd05898          12 YAVRGERGKVKCFIGSTPPPDRIAWAWKEN-VLESGTSERYTVERTSTGSGVLSTLTINNIMEADFQTHYNCTAWNS   87 (98)
T ss_pred             EEeCCCcEEEEEEEccCCCCcEEEEEEccc-cccCCCCCCEEEEEEccCCCcEEEEEECCCccccCCcEEEEEEEeC
Confidence            34567788899999888776 457766553 233334467766543222 236779999998878 79999999863


No 192
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2). Ig3_FGFR-2-like; domain similar to the third immunoglobulin (Ig)-like domain of human fibroblast growth factor receptor 2 (FGFR2). Fibroblast growth factors (FGFs) participate in morphogenesis, development, angiogenesis, and wound healing. These FGF-stimulated processes are mediated by four FGFR tyrosine kinases (FGRF1-4). FGFRs are comprised of an extracellular portion consisting of three Ig-like domains, a transmembrane helix, and a cytoplasmic portion having protein tyrosine kinase activity. The highly conserved Ig-like domains 2 and 3, and the linker region between D2 and D3 define a general binding site for FGFs. FGFR2 is required for male sex determination.
Probab=98.12  E-value=1.6e-06  Score=52.98  Aligned_cols=25  Identities=36%  Similarity=0.636  Sum_probs=23.9

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        55 ~~L~I~~v~~~D~G~Y~C~A~N~~G   79 (90)
T cd05858          55 EVLYLRNVTFEDAGEYTCLAGNSIG   79 (90)
T ss_pred             eEEEEccCCHHHCEEEEEEEEeCCC
Confidence            4799999999999999999999999


No 193
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB. TrkB_d5: the fifth domain of Trk receptor TrkB, this is an immunoglobulin (Ig)-like domain which binds to neurotrophin. The Trk family of receptors are tyrosine kinase receptors, which mediate the trophic effects of the neurotrophin Nerve growth factor (NGF) family. The Trks are activated by dimerization, leading to autophosphorylation of intracellular tyrosine residues, and triggering the signal transduction pathway. TrkB shares significant sequence homology and domain organization with TrkA, and TrkC. The first three domains are leucine-rich domains. The fourth and fifth domains are Ig-like domains playing a part in ligand binding. TrKB is recognized by brain-derived neurotrophic factor (BDNF) and neurotrophin (NT)-4. In some cell systems NT-3 can activate TrkA and TrkB receptors. TrKB transcripts are found throughout multiple structures of the central and peripheral nervous systems.
Probab=98.12  E-value=4.8e-06  Score=49.89  Aligned_cols=24  Identities=25%  Similarity=0.218  Sum_probs=23.4

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.|.++..+|+|.|+|+|+|.+|
T Consensus        45 ~L~i~~~~~~D~G~YtC~A~N~~G   68 (79)
T cd05855          45 CLQLDNPTHLNNGIYTLVAKNEYG   68 (79)
T ss_pred             EEEECCCCcccCEEEEEEEEcCCc
Confidence            799999999999999999999999


No 194
>PF07679 I-set:  Immunoglobulin I-set domain;  InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents I-set domains, which are found in several cell adhesion molecules, including vascular (VCAM), intercellular (ICAM), neural (NCAM) and mucosal addressin (MADCAM) cell adhesion molecules, as well as junction adhesion molecules (JAM). I-set domains are also present in several other diverse protein families, including several tyrosine-protein kinase receptors, the hemolymph protein hemolin, the muscle proteins titin, telokin, and twitchin, the neuronal adhesion molecule axonin-1 [], and the signalling molecule semaphorin 4D that is involved in axonal guidance, immune function and angiogenesis [].; PDB: 3MTR_A 2EDK_A 3DMK_B 1KOA_A 3NCM_A 2NCM_A 2V9Q_A 2CR3_A 3QQN_A 3QR2_A ....
Probab=98.11  E-value=6.3e-06  Score=49.94  Aligned_cols=26  Identities=35%  Similarity=0.645  Sum_probs=24.1

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ...|.|.+++.+|+|.|+|.|+|..|
T Consensus        55 ~~~L~I~~v~~~D~G~Y~C~~~n~~g   80 (90)
T PF07679_consen   55 SSSLTIKNVTREDAGTYTCVASNSSG   80 (90)
T ss_dssp             EEEEEESSESGGGSEEEEEEEEETTE
T ss_pred             eeEEccCCCChhhCEEEEEEEEECCC
Confidence            35799999999999999999999987


No 195
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=98.11  E-value=1.2e-05  Score=49.38  Aligned_cols=64  Identities=14%  Similarity=0.139  Sum_probs=45.6

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +...+..+.+.|... .+...+.|+|++....   . .+..     .....+.+.|.+|+.+|+|.|+|+..+.
T Consensus        12 vV~~G~~VtL~C~~~-~~~~~f~l~k~g~~~~---~-~~~~-----~~~~~~~f~i~~v~~~~~G~Y~C~~~~~   75 (91)
T cd05751          12 VVPLGKPVTLRCQGP-YGAVEYRLYREGSTFA---V-KKPP-----EPQNKAKFFIPSMKREHAGRYRCYYRSG   75 (91)
T ss_pred             ccCCCCcEEEEEecC-CCCCEEEEEECCCCcc---c-cccC-----CCceeEEEEccCCChhHCEEEEEEEECC
Confidence            345778899999776 5677899999875311   1 1111     1133778999999999999999999753


No 196
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins. Ig_Titin_like: immunoglobulin (Ig)-like domain found in titin-like proteins. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic, depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone.  It appears to function similarly to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching. Within the sarcomere, titin is also attached to or is associated with myosin binding protein C (MyBP-C). MyBP-C appears to contribute to the generation of passive tension by titin, and similar to titin has repeated Ig-like and FN-
Probab=98.11  E-value=3.3e-06  Score=49.60  Aligned_cols=26  Identities=31%  Similarity=0.299  Sum_probs=24.3

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ...|.|.+++.+|+|.|+|.|.|.+|
T Consensus        39 ~~~L~I~~~~~~D~G~Y~C~a~N~~G   64 (74)
T cd05748          39 STSLVIKNAERSDSGKYTLTLKNPAG   64 (74)
T ss_pred             eEEEEECCCCcCcCEEEEEEEECCCc
Confidence            34799999999999999999999999


No 197
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins. Ig5_Titin_like: domain similar to the M5, fifth immunoglobulin (Ig)-like domain from the human titin C terminus. Titin (also called connectin) is a fibrous sarcomeric protein specifically found in vertebrate striated muscle. Titin is gigantic; depending on isoform composition it ranges from 2970 to 3700 kDa, and is of a length that spans half a sarcomere. Titin largely consists of multiple repeats of Ig-like and fibronectin type 3 (FN-III)-like domains. Titin connects the ends of myosin thick filaments to Z disks and extends along the thick filament to the H zone, and appears to function similar to an elastic band, keeping the myosin filaments centered in the sarcomere during muscle contraction or stretching.
Probab=98.10  E-value=9.8e-06  Score=49.68  Aligned_cols=25  Identities=24%  Similarity=0.408  Sum_probs=23.9

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        59 ~~L~i~~~~~~D~G~Y~C~a~N~~G   83 (92)
T cd05747          59 STFEISKVQMSDEGNYTVVVENSEG   83 (92)
T ss_pred             eEEEECCCCcccCEeEEEEEEcCCC
Confidence            4899999999999999999999999


No 198
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). Ig2_VEGFR: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angiogenic and microvascular permeability-enhancing effects of VEGF-A. VEGFR-1 may play an inhibitory part in these processes by binding VEGF and interfering with its interaction with VEGFR-2. VEGFR-1 has a signa
Probab=98.09  E-value=3.9e-06  Score=49.09  Aligned_cols=27  Identities=30%  Similarity=0.540  Sum_probs=24.7

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+..|.|.+++.+|+|.|+|.|.|..|
T Consensus        33 ~~~~L~I~~v~~~D~G~YtC~a~N~~g   59 (71)
T cd04976          33 SGHSLTIKDVTEEDAGNYTVVLTNKQA   59 (71)
T ss_pred             CCCEEEECcCCHHHCEEEEEEEEcCCc
Confidence            345899999999999999999999998


No 199
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig2_FcgammaR_like: domain similar to the second immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.07  E-value=7e-06  Score=49.56  Aligned_cols=26  Identities=27%  Similarity=0.460  Sum_probs=23.8

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|.+++.+|+|.|+|.|.+..|
T Consensus        47 ~~~l~I~~~~~~dsG~Y~C~~~~~~~   72 (83)
T cd05753          47 NSNLSIPQATLSDSGSYHCSGIIGSY   72 (83)
T ss_pred             CceEEECccCHHHCEEEEEEEEeCCc
Confidence            34799999999999999999999987


No 200
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5. Ig1_Contactin-5: First Ig domain of the neural cell adhesion molecule contactin-5. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains, anchored to the membrane by glycosylphosphatidylinositol. The different contactins show different expression patterns in the central nervous system. In rats, a lack of contactin-5 (NB-2) results in an impairment of the neuronal activity in the auditory system. Contactin-5 is expressed specifically in the postnatal nervous system, peaking at about 3 weeks postnatal. Contactin-5 is highly expressed in the adult human brain in the occipital lobe and in the amygdala; lower levels of expression have been detected in the corpus callosum, caudate nucleus, and spinal cord.
Probab=98.07  E-value=1.4e-05  Score=49.30  Aligned_cols=25  Identities=44%  Similarity=0.607  Sum_probs=22.4

Q ss_pred             cEEEEcccC-CCCCeeeEEEEecCCC
Q psy534          105 TELRISNIR-SQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~-~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.++. .+|+|.|+|.|.|.+|
T Consensus        58 g~L~i~~~~~~~D~G~Y~C~A~N~~G   83 (94)
T cd05848          58 GNLIISNPSEVKDSGRYQCLATNSIG   83 (94)
T ss_pred             CeEEEccCCccCcCEEEEEEEEcCCC
Confidence            389998885 6999999999999999


No 201
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin. Ig_Myotilin_like_C: immunoglobulin (Ig)-like domain in myotilin, palladin, and myopalladin.  Myotilin, palladin, and myopalladin function as scaffolds that regulate actin organization. Myotilin and myopalladin are most abundant in skeletal and cardiac muscle; palladin is ubiquitously expressed in the organs of developing vertebrates and  plays a key role in cellular morphogenesis. The three family members each interact with specific molecular partners: all three bind to alpha-actinin; in addition, palladin also binds to vasodilator-stimulated phosphoprotein (VASP) and ezrin, myotilin binds to filamin and actin, and myopalladin also binds to nebulin and cardiac ankyrin repeat protein (CARP).
Probab=98.06  E-value=4.1e-06  Score=49.55  Aligned_cols=24  Identities=33%  Similarity=0.253  Sum_probs=23.3

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +|.|.+++.+|+|.|+|.|.|.+|
T Consensus        42 ~L~I~~~~~~D~G~Y~C~a~N~~G   65 (75)
T cd05744          42 CLLIQNANKEDAGWYTVSAVNEAG   65 (75)
T ss_pred             EEEECCCCcccCEEEEEEEEcCCC
Confidence            699999999999999999999999


No 202
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins. Ig4_SCFR_like; fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). In addition to SCFR this group also includes the fourth Ig domain of platelet-derived growth factor receptors (PDGFR), alpha and beta, the fourth Ig domain of macrophage colony stimulating factor (M-CSF), and the Ig domain of the receptor tyrosine kinase KIT. SCFR and the PDGFR alpha and beta have similar organization: an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR, this fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth SCFR_Ig-like domain abolishes
Probab=98.06  E-value=3.7e-06  Score=52.72  Aligned_cols=25  Identities=28%  Similarity=0.530  Sum_probs=24.0

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|+|..|
T Consensus        65 ~~L~i~~v~~~D~G~Ytc~A~N~~G   89 (101)
T cd04975          65 SELKLVRLKESEAGTYTFLASNSDA   89 (101)
T ss_pred             EEEEEeecCHhhCeeEEEEEECCCc
Confidence            5799999999999999999999999


No 203
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs) and similar proteins. Ig1_FcgammaR_like: domain similar to the first immunoglobulin (Ig)-like domain of  Fcgamma-receptors (FcgammaRs). Interactions between IgG and FcgammaR are important to the initiation of cellular and humoral response. IgG binding to FcgammaR leads to a cascade of signals and ultimately to functions such as antibody-dependent-cellular-cytotoxicity (ADCC), endocytosis, phagocytosis, release of inflammatory mediators, etc. FcgammaR has two Ig-like domains. This group also contains FcepsilonRI, which binds IgE with high affinity.
Probab=98.05  E-value=1e-05  Score=48.34  Aligned_cols=25  Identities=24%  Similarity=0.460  Sum_probs=21.8

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVL  128 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~  128 (145)
                      .+..|.|.++ .+|+|.|+|.|.|..
T Consensus        45 ~~~~l~i~~~-~~dsG~Y~C~a~~~~   69 (78)
T cd05752          45 TTNSYRIRAA-NNDSGEYRCQTQGSS   69 (78)
T ss_pred             cCCeEEEeec-ccCCEEeEEECCCCc
Confidence            4458999999 999999999999864


No 204
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. Ig1_NCAM-1: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (trans
Probab=98.05  E-value=5.3e-06  Score=51.54  Aligned_cols=25  Identities=28%  Similarity=0.425  Sum_probs=23.3

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        60 ~~L~I~~v~~~D~G~YtC~A~N~~~   84 (96)
T cd05865          60 STLTIYNANIDDAGIYKCVVSNEDE   84 (96)
T ss_pred             eEEEEeccChhhCEEEEEEEEcCCC
Confidence            4899999999999999999999984


No 205
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of  the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig2_RPTP_IIa_LAR_like: domain similar to the second immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple Ig-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains.
Probab=98.02  E-value=8.4e-06  Score=47.97  Aligned_cols=26  Identities=35%  Similarity=0.543  Sum_probs=24.2

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLYP  130 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g~  130 (145)
                      ..|.|.+++.+|+|.|+|.|.|..|.
T Consensus        38 g~L~i~~~~~~D~G~Y~C~a~N~~G~   63 (74)
T cd05738          38 GALQIENSEESDQGKYECVATNSAGT   63 (74)
T ss_pred             cEEEECCCChhhCEEEEEEEECCCCc
Confidence            37999999999999999999999994


No 206
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins. Ig1_NCAM-1 like: first immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1. NCAM-1 plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM), and heterophilic (NCAM-nonNCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves the Ig1, Ig2, and Ig3 domains. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the s
Probab=98.01  E-value=5.8e-06  Score=50.85  Aligned_cols=25  Identities=36%  Similarity=0.504  Sum_probs=23.4

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+|.|.+++.+|+|.|+|.|.|..|
T Consensus        57 ~~L~I~~v~~~D~G~Y~C~A~N~~g   81 (92)
T cd04977          57 STLTIYNANIEDAGIYKCVATDAKG   81 (92)
T ss_pred             EEEEEecCCcccCEEEEEEEEcCCC
Confidence            4799999999999999999999976


No 207
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins. Ig2_Follistatin_like: domain similar to the second immunoglobulin (Ig)-like domain found in a follistatin-like molecule encoded by the CNS-related Mahya gene. Mahya genes have been retained in certain Bilaterian branches during evolution.  They are conserved in Hymenoptera and Deuterostomes, but are absent from other metazoan species such as fruit fly and nematode. Mahya proteins are secretory, with a follistatin-like domain (Kazal-type serine/threonine protease inhibitor domain and EF-hand calcium-binding domain), two Ig-like domains, and a novel C-terminal domain. Mahya may be involved in learning and memory and in processing of sensory information in Hymenoptera and vertebrates. Follistatin is a secreted, multidomain protein that binds activins with high affinity and antagonizes their signaling.
Probab=98.01  E-value=1.3e-05  Score=47.26  Aligned_cols=27  Identities=48%  Similarity=0.835  Sum_probs=24.7

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+..|.|.+++.+|+|.|+|.|.|..|
T Consensus        37 ~~~~l~I~~~~~~D~G~Y~C~a~N~~G   63 (76)
T cd05736          37 NGSELHISNVRYEDTGAYTCIAKNEAG   63 (76)
T ss_pred             CCCEEEECcCCcccCEEEEEEEEcCCC
Confidence            445799999999999999999999999


No 208
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=98.00  E-value=3.5e-05  Score=43.02  Aligned_cols=63  Identities=16%  Similarity=0.296  Sum_probs=41.9

Q ss_pred             eeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           15 SVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        15 ~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      .+.|.+.+.+.+.+.|++++.........  ..............|.|.+++.+|.|.|.|.+..
T Consensus         2 ~l~C~~~~~~~~~~~W~~~~~~~~~~~~~--~~~~~~~~~~~~~~l~i~~~~~~d~g~y~C~~~~   64 (74)
T cd00096           2 TLTCLASGPPPPTITWLKNGKPLPSSVLT--RVRSSRGTSSGSSTLTISNVTLEDSGTYTCVASN   64 (74)
T ss_pred             EEEEEecCCCCCcEEEEECCEECCCcccE--EeccccCcceeEEEEEECccCcccCcEEEEEEec
Confidence            46788888778889999887432111110  0111111234478899999999999999999864


No 209
>smart00408 IGc2 Immunoglobulin C-2 Type.
Probab=97.99  E-value=3.4e-05  Score=42.70  Aligned_cols=27  Identities=33%  Similarity=0.653  Sum_probs=23.8

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ....|.|.+++.+|+|.|+|.+.|..|
T Consensus        37 ~~~~L~i~~~~~~d~G~Y~C~~~n~~g   63 (63)
T smart00408       37 SGSTLTIKSVSLEDSGEYTCVAENSAG   63 (63)
T ss_pred             CCcEEEEeeCCcccCEEEEEEEecCCC
Confidence            344899999999999999999999875


No 210
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins. Ig1_VEGFR_like: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) related proteins. The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF-A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGF
Probab=97.98  E-value=7.3e-06  Score=49.35  Aligned_cols=25  Identities=36%  Similarity=0.545  Sum_probs=23.6

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|..|
T Consensus        49 s~L~I~~v~~~DsG~Y~C~a~n~~~   73 (84)
T cd05742          49 STLTIPNATLKDSGTYTCAASSGTM   73 (84)
T ss_pred             EEEEECCCChhhCEEEEEEEccCCC
Confidence            3799999999999999999999998


No 211
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). Ig5_NCAM-2: the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM). NCAM-2  is organized similarly to NCAM , including five N-terminal Ig-like domains and two fibronectin type III domains. NCAM-2 is differentially expressed in the developing and mature olfactory epithelium (OE), and may function like NCAM, as an adhesion molecule.
Probab=97.98  E-value=7.1e-06  Score=50.94  Aligned_cols=25  Identities=28%  Similarity=0.558  Sum_probs=23.9

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|
T Consensus        64 ~~L~I~~v~~~D~G~Y~C~A~N~~G   88 (98)
T cd05870          64 SSLHIKDVKLSDSGRYDCEAASRIG   88 (98)
T ss_pred             eEEEEeeCCcCCCEEEEEEEeccCC
Confidence            4799999999999999999999999


No 212
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins. Ig3_Perlecan_like: domain similar to the third immunoglobulin (Ig)-like domain found in Perlecan. Perlecan is a large multi-domain heparin sulfate proteoglycan, important in tissue development and organogenesis.  Perlecan can be represented as 5 major portions; its fourth major portion (domain IV) is a tandem repeat of immunoglobulin-like domains (Ig2-Ig15), which can vary in size due to alternative splicing. Perlecan binds many cellular and extracellular ligands. Its domain IV region has many binding sites.  Some of these have been mapped at the level of individual Ig-like domains, including a site restricted to the Ig5 domain for heparin/sulfatide, a site restricted to the Ig3 domain for nidogen-1 and nidogen-2, a site restricted to Ig4-5 for fibronectin, and sites restricted to Ig2 and to Ig13-15 for fibulin-2.
Probab=97.97  E-value=1.2e-05  Score=48.41  Aligned_cols=26  Identities=31%  Similarity=0.580  Sum_probs=24.3

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|.+++.+|+|.|+|.|.|..|
T Consensus        51 ~~~L~I~~v~~~DsG~Y~C~a~n~~g   76 (85)
T cd05754          51 NGILTIRNVQLSDAGTYVCTGSNMLD   76 (85)
T ss_pred             CCEEEECCCCHHHCEEEEEEEeccCC
Confidence            34899999999999999999999998


No 213
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2. Ig1_Contactin-2: First Ig domain of the neural cell adhesion molecule contactin-2-like. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. It may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module by contacts between IG domains 1 and 4, and domains 2 and 3. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-2 is also expressed in retinal amacrine cells in the developing c
Probab=97.97  E-value=3.1e-05  Score=47.74  Aligned_cols=26  Identities=35%  Similarity=0.538  Sum_probs=22.5

Q ss_pred             cEEEEcccC-CCCCeeeEEEEecCCCC
Q psy534          105 TELRISNIR-SQDIGDYTCLATHVLYP  130 (145)
Q Consensus       105 ~~L~i~~v~-~~d~G~Y~C~a~n~~g~  130 (145)
                      +.|.|.++. .+|+|.|+|.|.|.+|.
T Consensus        58 g~L~I~~~~~~~D~G~Y~C~A~N~~G~   84 (94)
T cd05850          58 GNLVINNPQKARDAGSYQCLAINRCGT   84 (94)
T ss_pred             CeEEEccCCccCcCEEEEEEEEcCcCc
Confidence            379998865 69999999999999993


No 214
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins. Ig5_NCAM-1 like: domain similar to the fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic  (NCAM-NCAM), and heterophilic (NCAM-non-NCAM), interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM mole
Probab=97.96  E-value=8e-06  Score=50.26  Aligned_cols=26  Identities=23%  Similarity=0.515  Sum_probs=24.2

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLYP  130 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g~  130 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|.
T Consensus        62 ~~L~I~~v~~~D~G~Y~C~a~N~~G~   87 (96)
T cd05732          62 SSLTLKDVQLTDAGRYDCEASNRIGG   87 (96)
T ss_pred             EEEEECcCCcCcCEEeEEEEEeCCCC
Confidence            37999999999999999999999993


No 215
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. Ig_Pro_neuregulin-1: immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1. There are many NRG-1 isoforms which arise from the alternative splicing of mRNA. NRG-1 belongs to the neuregulin gene family, which is comprised of four genes. This group represents NRG-1. NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, and heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. The NRG-1 protein binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates process
Probab=97.94  E-value=1.7e-05  Score=46.72  Aligned_cols=27  Identities=37%  Similarity=0.632  Sum_probs=24.5

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCCCc
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLYPD  131 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g~~  131 (145)
                      ..|.|.+++.+|+|.|+|.|.|..|..
T Consensus        44 ~~L~I~~~~~~DsG~Y~C~a~N~~g~~   70 (76)
T cd05895          44 SELQISKASLADNGEYKCMVSSKLGND   70 (76)
T ss_pred             EEEEECcCCcccCEEEEEEEEeCCCce
Confidence            479999999999999999999999843


No 216
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. IG4_PDGFR-alpha: The fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha. PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFR alpha binds to all three PDGFs, whereas the PDGFR beta (not included in this group) binds only to PDGF-B. PDGF alpha is organized as an extracellular component having five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFR alpha and PDGFR beta are essential for normal development.
Probab=97.94  E-value=7.9e-06  Score=51.22  Aligned_cols=25  Identities=28%  Similarity=0.405  Sum_probs=23.9

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|..|
T Consensus        65 s~L~I~~v~~~D~G~Ytc~A~N~~g   89 (101)
T cd05859          65 SKLKLIRAKEEDSGLYTALAQNEDA   89 (101)
T ss_pred             cEEEEeeCCHHHCEEEEEEEEcCCc
Confidence            4899999999999999999999998


No 217
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). Ig5_NCAM-1: The fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM). NCAM plays important roles in the development and regeneration of the central nervous system, in synaptogenesis and neural migration. NCAM mediates cell-cell and cell-substratum recognition and adhesion via homophilic (NCAM-NCAM) and heterophilic (NCAM-non-NCAM) interactions. NCAM is expressed as three major isoforms having different intracellular extensions. The extracellular portion of NCAM has five N-terminal Ig-like domains and two fibronectin type III domains. The double zipper adhesion complex model for NCAM homophilic binding involves Ig1, Ig2, and Ig3. By this model, Ig1 and Ig2 mediate dimerization of NCAM molecules situated on the same cell surface (cis interactions), and Ig3 domains mediate interactions between NCAM molecules expressed on the surface of opposing cells (tr
Probab=97.93  E-value=9.8e-06  Score=50.20  Aligned_cols=26  Identities=27%  Similarity=0.567  Sum_probs=24.1

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLYP  130 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g~  130 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|.
T Consensus        63 ~~L~I~~v~~~D~G~Y~C~A~N~~G~   88 (97)
T cd05869          63 SSLTLKYIQYTDAGEYLCTASNTIGQ   88 (97)
T ss_pred             EEEEEecCccCcCEEEEEEEecCCCC
Confidence            37999999999999999999999993


No 218
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). Ig7_DSCAM: the seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM). DSCAM is a cell adhesion molecule expressed largely in the developing nervous system. The gene encoding DSCAM is located at human chromosome 21q22, the locus associated with the mental retardation phenotype of Down Syndrome. DSCAM is predicted to be the largest member of the IG superfamily. It has been demonstrated that DSCAM can mediate cation-independent homophilic intercellular adhesion.
Probab=97.93  E-value=1.2e-05  Score=47.76  Aligned_cols=25  Identities=24%  Similarity=0.392  Sum_probs=23.9

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+|.|.++..+|+|.|.|.|.|.+|
T Consensus        44 ~~L~I~~v~~~D~G~Y~C~a~N~~G   68 (79)
T cd05734          44 GSLLIKHVLEEDSGYYLCKVSNDVG   68 (79)
T ss_pred             CeEEECcCCcccCEEEEEEEEeCCC
Confidence            4899999999999999999999999


No 219
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs). Ig_Pro_neuregulin: immunoglobulin (Ig)-like domain in neuregulins (NRGs). NRGs are signaling molecules, which participate in cell-cell interactions in the nervous system, breast, heart, and other organ systems, and are implicated in the pathology of diseases including schizophrenia, multiple sclerosis, and breast cancer. There are four members of the neuregulin gene family (NRG1, -2, -3, and -4). The NRG-1 protein, binds to and activates the tyrosine kinases receptors ErbB3 and ErbB4, initiating signaling cascades. The other NRGs proteins bind one or the other or both of these ErbBs. NRG-1 has multiple functions; for example, in the brain it regulates various processes such as radial glia formation and neuronal migration, dendritic development, and expression of neurotransmitters receptors; in the peripheral nervous system NRG-1 regulates processes such as target cell differentiation, and Schwann cell surv
Probab=97.90  E-value=1.3e-05  Score=46.91  Aligned_cols=26  Identities=35%  Similarity=0.707  Sum_probs=24.2

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLYP  130 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g~  130 (145)
                      ..|.|.+++.+|+|.|+|.|.|.+|.
T Consensus        43 ~~L~I~~~~~~D~G~Y~C~a~N~~G~   68 (75)
T cd05750          43 SELQINKAKLADSGEYTCVVENILGN   68 (75)
T ss_pred             EEEEEccCCcccCeEEEEEEEEcCCc
Confidence            47999999999999999999999994


No 220
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin. Ig8_hNephrin_like: domain similar to the eighth immunoglobulin-like domain in human nephrin. Nephrin is an integral component of the slit diaphragm, and is a central component of the glomerular ultrafilter. Nephrin plays a structural role, and has a role in signaling. Nephrin is a transmembrane protein having a short intracellular portion, and an extracellular portion comprised of eight Ig-like domains, and one fibronectin type III-like domain. The extracellular portions of nephrin, from neighboring foot processes of separate podocyte cells, may interact with each other, and in association with other components of the slit diaphragm, form a porous molecular sieve within the slit pore.  The intracellular portion of nephrin is associated with linker proteins, which connect nephrin to the actin cytoskeleton. The intracellular portion is tyrosine phosphorylated, and mediates signaling from the slit diaphragm into the p
Probab=97.90  E-value=3.4e-05  Score=48.94  Aligned_cols=25  Identities=32%  Similarity=0.422  Sum_probs=23.1

Q ss_pred             cEEEEcccC-CCCCeeeEEEEecCCC
Q psy534          105 TELRISNIR-SQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~-~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++ .+|.|.|+|.|.|.+|
T Consensus        69 s~L~I~~v~~~~D~G~Y~C~A~N~~G   94 (109)
T cd05773          69 SILTIINVSAALDYALFTCTAHNSLG   94 (109)
T ss_pred             eEEEECcCCccCCCEEEEEEEEeCCc
Confidence            479999997 5999999999999999


No 221
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig2_IL1R_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R).  IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three IG-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta. This group also contains ILIR-like 1 (IL1
Probab=97.90  E-value=3.5e-05  Score=47.45  Aligned_cols=28  Identities=36%  Similarity=0.633  Sum_probs=25.1

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLYP  130 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g~  130 (145)
                      .+..|.|.+++.+|+|.|+|.|.|..+.
T Consensus        50 ~~~~L~I~~v~~~DsG~YtC~~~n~~~~   77 (92)
T cd05757          50 KGSKLLIQNVTEEDAGNYTCKLTFTHNG   77 (92)
T ss_pred             cCCEEEEeeCChhhCEEEEEEEEecCCC
Confidence            4458999999999999999999999873


No 222
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=97.90  E-value=4.6e-05  Score=48.10  Aligned_cols=70  Identities=17%  Similarity=0.193  Sum_probs=42.4

Q ss_pred             hhhccceeeEEeecCC-CccEEEEecCCCC--ccc----------------ccc-cceEEEecCCCCCCeeeEEEcccCC
Q psy534            8 KSIFQMLSVGDFADDE-DIPVYIWYDSYPT--HEA----------------EEY-KGRISRVDKESPFGMASLNLTKIRE   67 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~-p~p~~~w~k~~~~--~~~----------------~~~-~~R~~~~~~~~~~~~~sL~I~~v~~   67 (145)
                      ++++.++.+.|-..+. ....+.||+...-  ...                .++ ..|++... ........|.|.+++.
T Consensus         3 v~~G~~vtL~C~~~~~~~~~~~~Wyrq~~g~~~~~~~~l~~~~~~~~~~~~~~~~~~rf~~~~-~~~~~~~~L~I~~~~~   81 (107)
T cd07700           3 VQTNNTVKLSCEAKGISENTRIYWLRWRQAPKDSHFEFLALWSPLGGATYGEEVSQEKFSIRV-TSDSSRYRLHINRVKP   81 (107)
T ss_pred             EcCCCCEEEEEEEecCCCCCeEEEEEECCCCCCCccEEEEEEcCCCCeEEccccccCcEEEEE-ECCCCEEEEEECCCCH
Confidence            4567778888877653 3456788876421  000                011 23443311 1122356799999999


Q ss_pred             CCCEEEEEEEE
Q psy534           68 SDQGWYECKVV   78 (145)
Q Consensus        68 ~D~G~Y~C~~~   78 (145)
                      +|+|.|+|...
T Consensus        82 ~Dsg~YyCa~~   92 (107)
T cd07700          82 EDSGTYFCMTV   92 (107)
T ss_pred             HHCEEEEEeEc
Confidence            99999999874


No 223
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. Ig3_RPTP_IIa_LAR_like: domain similar to the third immunoglobulin (Ig)-like domain found in the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR. LAR belongs to the RPTP type IIa subfamily. Members of this subfamily are cell adhesion molecule-like proteins involved in central nervous system (CNS) development. They have large extracellular portions, comprised of multiple IG-like domains and two to nine fibronectin type III (FNIII) domains, and a cytoplasmic portion having two tandem phosphatase domains. Included in this group is Drosophila LAR (DLAR).
Probab=97.90  E-value=4.6e-05  Score=44.28  Aligned_cols=22  Identities=36%  Similarity=0.616  Sum_probs=19.7

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.|.++.  |+|.|+|.|.|.+|
T Consensus        39 ~L~i~~~~--d~G~Y~C~A~N~~G   60 (69)
T cd05739          39 VLELTNIY--ESANYTCVAISSLG   60 (69)
T ss_pred             EEEEeccc--cCeeEEEEEEeCCC
Confidence            68888874  79999999999999


No 224
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins. Ig2_Contactin-2-like: second Ig domain of the neural cell adhesion molecule contactin-2. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-2 (aliases TAG-1, axonin-1) facilitates cell adhesion by homophilic binding between molecules in apposed membranes. The first four Ig domains form the intermolecular binding fragment which arranges as a compact U-shaped module by contacts between Ig domains 1 and 4, and domains 2 and 3. It has been proposed that a linear zipper-like array forms, from contactin-2 molecules alternatively provided by the two apposed membranes.
Probab=97.90  E-value=1.9e-05  Score=49.00  Aligned_cols=25  Identities=24%  Similarity=0.563  Sum_probs=23.4

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +.|.+.+|+.+|+|.|+|.|+|.+.
T Consensus        60 G~L~fs~v~~~D~g~Y~C~A~n~~~   84 (96)
T cd05727          60 GNLYIAKVEASDRGNYSCFVSSPSS   84 (96)
T ss_pred             CcEEEeecCHhhCceeEEEEEeccc
Confidence            4899999999999999999999876


No 225
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). IG1_VEGFR: first immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R). The VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. The VEGFR family consists of three members, VEGFR-1 (Flt-1), VEGFR-2 (KDR/Flk-1) and VEGFR-3 (Flt-4). VEGF_A interacts with both VEGFR-1 and VEGFR-2. VEGFR-1 binds strongest to VEGF, VEGF-2 binds more weakly. VEGFR-3 appears not to bind VEGF, but binds other members of the VEGF family (VEGF-C and -D). VEGFRs bind VEGFs with high affinity with the IG-like domains. VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-2 is a major mediator of the mitogenic, angioge
Probab=97.89  E-value=1.6e-05  Score=48.36  Aligned_cols=25  Identities=36%  Similarity=0.628  Sum_probs=23.4

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|+|..|
T Consensus        50 s~L~I~~~~~~DsG~Y~C~a~n~~~   74 (86)
T cd05862          50 STLTIENVTLSDLGRYTCTASSGQM   74 (86)
T ss_pred             eEEEEecCCcccCEEEEEEEeecce
Confidence            3799999999999999999999887


No 226
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=97.89  E-value=7.3e-05  Score=47.00  Aligned_cols=23  Identities=26%  Similarity=0.618  Sum_probs=20.9

Q ss_pred             CeeeEEEcccCCCCCEEEEEEEE
Q psy534           56 GMASLNLTKIRESDQGWYECKVV   78 (145)
Q Consensus        56 ~~~sL~I~~v~~~D~G~Y~C~~~   78 (145)
                      ...+|.|.+++.+|+|.|.|.+.
T Consensus        67 ~~~~L~I~~~~~sDsgtY~Ca~~   89 (104)
T cd05720          67 NSFVLTLKNFQKENEGYYFCSVA   89 (104)
T ss_pred             CEEEEEECCCCHHHCEEEEEEEc
Confidence            46789999999999999999875


No 227
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=97.89  E-value=2.1e-05  Score=46.18  Aligned_cols=55  Identities=15%  Similarity=0.247  Sum_probs=42.3

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..+.++.+.|...+.|.+.+.|++++.. +.        -       ....|.|.++..+|+|.|.|.+.+
T Consensus        12 ~~g~~~~l~C~~~~~p~~~~~w~~~~~~-~~--------~-------~~~~~~~~~~~~~~~g~y~C~~~~   66 (80)
T PF13895_consen   12 EEGDSVTLTCSVSGNPPPQVQWYKNGSP-IN--------S-------SQNGLFIPNVSPEDSGNYTCRASN   66 (80)
T ss_dssp             ETTSEEEEEEEEESSSSSEEEEEETTEE-EE--------E-------ESSEEEESSEEGGGTEEEEEEEEE
T ss_pred             eCCCcEEEEEEEEcccceeeeeeeeeee-ee--------e-------eeeeeeeeeeccccCEEEEEEEEe
Confidence            4577889999999998899999997632 11        0       011277889999999999999975


No 228
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1. Ig1_Contactin-1: First Ig domain of the neural cell adhesion molecule contactin-1. Contactins are comprised of six Ig domains followed by four fibronectin type III (FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. Contactin-1 is differentially expressed in tumor tissues and may, through a RhoA mechanism, facilitate invasion and metastasis of human lung adenocarcinoma.
Probab=97.88  E-value=3.4e-05  Score=47.54  Aligned_cols=25  Identities=28%  Similarity=0.553  Sum_probs=22.7

Q ss_pred             cEEEEcccC-CCCCeeeEEEEecCCC
Q psy534          105 TELRISNIR-SQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~-~~d~G~Y~C~a~n~~g  129 (145)
                      +.|.|.++. .+|+|.|+|.|+|.+|
T Consensus        57 g~L~I~~~~~~~D~G~Y~C~A~N~~G   82 (93)
T cd05849          57 GNLVINNPDKYKDAGRYVCIVSNIYG   82 (93)
T ss_pred             CEEEECcCCcCCCCEEEEEEEEeCcc
Confidence            489999885 6899999999999999


No 229
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=97.87  E-value=3.8e-05  Score=46.61  Aligned_cols=59  Identities=8%  Similarity=-0.018  Sum_probs=42.3

Q ss_pred             hhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEE
Q psy534            9 SIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVV   78 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~   78 (145)
                      ..+..+.+-|-.++. ...+.|++++.. +.  ...|+...       ...|.|.+++.+|+|.|.|.+.
T Consensus         9 ~~g~~v~L~C~~~s~-~A~v~W~~ng~~-l~--~~~r~~~~-------~~GLlI~~~~~~dsG~Y~C~s~   67 (85)
T cd05872           9 APGADVVLPCQLRSN-LASPVWLFNGTP-LN--AQFSYRVG-------TDGLLILVTSPEHSGTYRCYSE   67 (85)
T ss_pred             ecCCCEEEECCCCCC-CccEEEEECCcc-cC--CCcceEEe-------CCCCEEEECCHhhCEEEEEEEe
Confidence            456677777777766 458999999864 22  22455432       4457899999999999999985


No 230
>cd04967 Ig1_Contactin First Ig domain of contactin. Ig1_Contactin: First Ig domain of contactins. Contactins are neural cell adhesion molecules and are comprised of six Ig domains followed by four fibronectin type III(FnIII) domains anchored to the membrane by glycosylphosphatidylinositol. The first four Ig domains form the intermolecular binding fragment, which arranges as a compact U-shaped module via contacts between Ig domains 1 and 4, and between Ig domains 2 and 3. Contactin-2 (TAG-1, axonin-1) may play a part in the neuronal processes of neurite outgrowth, axon guidance and fasciculation, and neuronal migration. This group also includes contactin-1 and contactin-5. The different contactins show different expression patterns in the central nervous system. During development and in adulthood, contactin-2 is transiently expressed in subsets of central and peripheral neurons. Contactin-5 is expressed specifically in the rat postnatal nervous system, peaking at about 3 weeks postnata
Probab=97.86  E-value=6.7e-05  Score=45.82  Aligned_cols=26  Identities=38%  Similarity=0.657  Sum_probs=22.7

Q ss_pred             cEEEEcccC-CCCCeeeEEEEecCCCC
Q psy534          105 TELRISNIR-SQDIGDYTCLATHVLYP  130 (145)
Q Consensus       105 ~~L~i~~v~-~~d~G~Y~C~a~n~~g~  130 (145)
                      ..|.|.++. .+|+|.|+|.|+|.+|.
T Consensus        58 ~~L~i~~~~~~~d~G~Y~C~a~N~~G~   84 (91)
T cd04967          58 GNLVISNPSKAKDAGRYQCLASNIVGT   84 (91)
T ss_pred             CEEEEecCCccCCCEEEEEEEEcCCCE
Confidence            378998887 48999999999999993


No 231
>PF00047 ig:  Immunoglobulin domain The Prosite family only concerns antibodies and MHCs.;  InterPro: IPR013151 Members of the immunoglobulin superfamily are found in hundreds of proteins of different functions. Examples include antibodies, the giant muscle kinase titin and receptor tyrosine kinases. Immunoglobulin-like domains may be involved in protein-protein and protein-ligand interactions. The Pfam alignments do not include the first and last strand of the immunoglobulin-like domain.; PDB: 1B6U_A 3O4O_C 3VH8_H 1BIH_A 2C9A_A 2V5Y_A 1BQH_K 2ATP_A 3B9K_A 1NEZ_H ....
Probab=97.85  E-value=4.5e-05  Score=43.19  Aligned_cols=18  Identities=50%  Similarity=0.962  Sum_probs=17.4

Q ss_pred             EEEcccCCCCCeeeEEEE
Q psy534          107 LRISNIRSQDIGDYTCLA  124 (145)
Q Consensus       107 L~i~~v~~~d~G~Y~C~a  124 (145)
                      |.|.+++.+|+|.|+|.|
T Consensus        47 L~i~~v~~~d~G~Y~C~v   64 (64)
T PF00047_consen   47 LTISNVTPEDSGTYTCVV   64 (64)
T ss_dssp             EEESSCTGGGTEEEEEEE
T ss_pred             EEEccCCHHHCEEEEEEC
Confidence            999999999999999986


No 232
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins. Ig1_Neogenin: first immunoglobulin (Ig)-like domain in neogenin and related proteins. Neogenin  is a cell surface protein which is expressed in the developing nervous system of vertebrate embryos in the growing nerve cells. It is also expressed in other embryonic tissues, and may play a general role in developmental processes such as cell migration, cell-cell recognition, and tissue growth regulation. Included in this group is the tumor suppressor protein DCC, which is deleted in colorectal carcinoma . DCC and neogenin each have four Ig-like domains followed by six fibronectin type III domains, a transmembrane domain, and an intracellular domain.
Probab=97.83  E-value=6.1e-05  Score=46.35  Aligned_cols=24  Identities=33%  Similarity=0.523  Sum_probs=20.9

Q ss_pred             EEEEccc-----CCCCCeeeEEEEecC-CC
Q psy534          106 ELRISNI-----RSQDIGDYTCLATHV-LY  129 (145)
Q Consensus       106 ~L~i~~v-----~~~d~G~Y~C~a~n~-~g  129 (145)
                      .|.|.++     +++|+|.|+|.|.|. .|
T Consensus        55 ~l~i~~v~~~~~~~~D~G~Y~C~a~N~~~G   84 (95)
T cd05722          55 SLLITSVVHSKHNKPDEGFYQCVAQNDSLG   84 (95)
T ss_pred             eEEEeeeeccCCCCCcCEEEEEEEECCccC
Confidence            6777776     589999999999999 88


No 233
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins. Ig1_IL1R_like: domain similar to the first immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=97.80  E-value=2.3e-05  Score=48.48  Aligned_cols=26  Identities=27%  Similarity=0.391  Sum_probs=24.3

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|.++..+|+|.|+|.+.|..|
T Consensus        59 ~~~L~I~~~~~~DsG~Y~C~~~N~~g   84 (94)
T cd05756          59 KDLLWFLPAALEDSGLYTCVVRNSTY   84 (94)
T ss_pred             CCeEEEccCCcccCeEEEEEEcCCCc
Confidence            45899999999999999999999998


No 234
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin. Ig_Semaphorin_class III; Immunoglobulin (Ig)-like domain of class III semaphorins. Semaphorins are classified into various classes on the basis of structural features additional to the Sema domain. Class III semaphorins are a vertebrate class having a Sema domain, an Ig domain, a short basic domain, and are secreted. They have been shown to be axonal guidance cues and have a part in the regulation of the cardiovascular, immune and respiratory systems. Sema3A, the prototype member of this class III subfamily, induces growth cone collapse and is an inhibitor of axonal sprouting. In perinatal rat cortex as a chemoattractant, it functions to direct, for pyramidal neurons, the orientated extension of apical dendrites. It may play a role, prior to the development of apical dendrites, in signaling the radial migration of newborn cortical neurons towards the upper layers. Sema3A selectively inhibits vascula
Probab=97.77  E-value=7e-05  Score=45.98  Aligned_cols=25  Identities=28%  Similarity=0.515  Sum_probs=22.0

Q ss_pred             cEEEEcccCCCCCeeeEEEEec-CCC
Q psy534          105 TELRISNIRSQDIGDYTCLATH-VLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n-~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.+ ..+
T Consensus        53 ~~L~I~~~~~~DsG~Y~C~a~~~~~~   78 (91)
T cd05871          53 RGLLLRSLQRSDAGVYTCTAVEHSFS   78 (91)
T ss_pred             CeEEEeeCChhHCEEEEEEEEccCCe
Confidence            4799999999999999999984 555


No 235
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). Ig2_VEGFR-1: Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1). VEGFRs have an extracellular component with seven Ig-like domains, a transmembrane segment, and an intracellular tyrosine kinase domain interrupted by a kinase-insert domain. VEGFRs bind VEGFs with high affinity at the Ig-like domains. VEGFR-1 binds VEGF-A strongly; VEGF-A is important to the growth and maintenance of vascular endothelial cells and to the development of new blood- and lymphatic-vessels in physiological and pathological states. VEGFR-1 may play an inhibitory rolet in the function of VEGFR-2 by binding VEGF-A and interfering with its interaction with VEGFR-2. VEGFR-1 has a signaling role in mediating monocyte chemotaxis and may mediate a chemotactic and a survival signal in hematopoietic stem cells or leukemia cells.
Probab=97.76  E-value=1.9e-05  Score=46.39  Aligned_cols=26  Identities=35%  Similarity=0.487  Sum_probs=23.6

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +.+|.|.+++.+|+|.|+|.|+|...
T Consensus        35 ~~~L~I~~v~~~D~G~YtC~a~~~~~   60 (72)
T cd07702          35 GYSLVIKDVTEEDAGIYTILLGIKQY   60 (72)
T ss_pred             CCEEEECcCCHHHCEEEEEEEEcccc
Confidence            45899999999999999999999865


No 236
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). Ig1_PDGFR-alphabeta: The first immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b). PDGF is a potent mitogen for connective tissue cells. PDGF-stimulated processes are mediated by three different PDGFs (PDGF-A,-B, and C). PDGFRalpha binds to all three PDGFs, whereas the PDGFRbeta binds only to PDGF-B. PDGFRs alpha and beta have similar organization: an extracellular component with five Ig-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. In mice, PDGFRalpha and PDGFRbeta are essential for normal development.
Probab=97.73  E-value=4.6e-05  Score=46.02  Aligned_cols=25  Identities=24%  Similarity=0.448  Sum_probs=22.9

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.|.|..+
T Consensus        46 s~L~I~~~~~~DsG~Y~C~a~n~~~   70 (84)
T cd05861          46 STLTFPHATVEDSGTYECAAHESTQ   70 (84)
T ss_pred             EEEEECCCCcCCCEEEEEEEEECcc
Confidence            4799999999999999999999765


No 237
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=97.72  E-value=6.2e-05  Score=46.10  Aligned_cols=70  Identities=9%  Similarity=0.055  Sum_probs=42.1

Q ss_pred             hccceeeEEeecCC-Cc-cEEEEecCCCCcccccccceEEEecCCCCC-CeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           10 IFQMLSVGDFADDE-DI-PVYIWYDSYPTHEAEEYKGRISRVDKESPF-GMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        10 ~~~~~~~~~w~~g~-p~-p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~-~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+.++.+.|++.|. |. ..++|++++.............. ..+... -...|.|......|.+.|.|++.+.
T Consensus        12 ~~~~~~L~C~a~g~~P~~~~i~W~~~g~~~~~~~~~~~~~~-~~~gt~~~~s~l~v~~~~~~~~~~y~C~v~h~   84 (95)
T cd00098          12 LGGSVTLTCLATGFYPPDITVTWLKNGKELTSGVTTTPPVP-NSDGTYSVSSQLTVSPSDWNSGDTYTCVVTHE   84 (95)
T ss_pred             cCCCeEEEEEEeeEECCCcEEEEEECCEECCCceecccccc-CCCCCEEEEEEEEECHHHhCCCCCEEEEEEeC
Confidence            57899999999987 64 57999998754222111011111 110000 1334556655566999999999764


No 238
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). Ig6_NrCAM: sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule). NrCAM belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and an intracellular domain. NrCAM is primarily expressed in the nervous system.
Probab=97.71  E-value=0.00015  Score=42.95  Aligned_cols=26  Identities=23%  Similarity=0.211  Sum_probs=21.5

Q ss_pred             CcEEEEcccCC----CCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRS----QDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~----~d~G~Y~C~a~n~~g  129 (145)
                      +++|.|..+..    .|+|.|+|.|.|.+|
T Consensus        38 ~g~l~i~~~~~~~~~~d~G~Y~C~A~N~~G   67 (77)
T cd05874          38 TGTLVINIMNGEKAEAYEGVYQCTARNERG   67 (77)
T ss_pred             CceEEEeccccCCCCCCCEEEEEEEEcCCC
Confidence            34888887764    378999999999999


No 239
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin. Ig_Semaphorin_C; Immunoglobulin (Ig)-like domain in semaphorins. Semaphorins are transmembrane protein that have important roles in a variety of tissues. Functionally, semaphorins were initially characterized for their importance in the development of the nervous system and in axonal guidance. Later they have been found to be important for the formation and functioning of the cardiovascular, endocrine, gastrointestinal, hepatic, immune, musculoskeletal, renal, reproductive, and respiratory systems. Semaphorins function through binding to their receptors and transmembrane semaphorins also serves as receptors themselves. Although molecular mechanism of semaphorins is poorly understood, the Ig-like domains may involve in ligand binding or dimerization.
Probab=97.67  E-value=0.00011  Score=44.56  Aligned_cols=24  Identities=29%  Similarity=0.512  Sum_probs=21.9

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.|.+++.+|+|.|+|.|.+..+
T Consensus        52 ~L~I~~~~~~D~G~Y~C~a~~~~~   75 (89)
T cd04979          52 GLLIRSVSPADAGVYTCQSVEHGF   75 (89)
T ss_pred             CEEEccCCHHHCEEEEEEEecCcc
Confidence            699999999999999999998754


No 240
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D. Ig_Sema4D_like; Immunoglobulin (Ig)-like domain of Sema4D. Sema4D is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4D has extracellular Sema and Ig domains, a transmembrane domain, and a short cytoplasmic domain. Sema4D plays a part in the development of GABAergic synapses. Sema4D in addition is an immune semaphorin. It is abundant on resting T cells; its expression is weak on resting B cells and antigen presenting cells (APCs), but is upregulated by various stimuli. The receptor used by Sema4D in the immune system is CD72. Sem4D enhances the activation of B cells and DCs through binding CD72, perhaps by reducing CD72s inhibitory signals. The receptor used by Sema4D in the non-lymphatic tissues is plexin-B1. Sem4D is anchored to the cell surface but its extracellular domain can be released from the cell surface by a metalloproteas
Probab=97.67  E-value=7.7e-05  Score=45.48  Aligned_cols=24  Identities=33%  Similarity=0.504  Sum_probs=22.0

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVL  128 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~  128 (145)
                      ..|.|.+++.+|+|.|+|.|.+..
T Consensus        48 ~~L~I~nv~~~DsG~Y~C~a~e~~   71 (87)
T cd05873          48 DGLLIFNASEADAGRYQCLSVEKS   71 (87)
T ss_pred             CcEEEeCCCHHHCEEEEEEEEecc
Confidence            379999999999999999999874


No 241
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=97.66  E-value=0.00019  Score=46.07  Aligned_cols=36  Identities=22%  Similarity=0.329  Sum_probs=25.0

Q ss_pred             ccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEE
Q psy534           42 YKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVV   78 (145)
Q Consensus        42 ~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~   78 (145)
                      +.+|+....+ .......|.|.+++.+|+|.|+|.+.
T Consensus        61 ~~~rf~~~~~-~~~~~~~L~I~~~~~~Dsa~YyCa~~   96 (117)
T cd04981          61 VKGRFTITRD-TSKSTVYLQLNSLTPEDTAVYYCARG   96 (117)
T ss_pred             cCCcEEEEEE-ccCCEEEEEECCCCHHHCEEEEEEEE
Confidence            4456654211 11224579999999999999999875


No 242
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM). IG_CEACAM_D1: immunoglobulin (Ig)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surface. This family corresponds to the D
Probab=97.65  E-value=0.00017  Score=45.58  Aligned_cols=27  Identities=30%  Similarity=0.466  Sum_probs=23.7

Q ss_pred             cCCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          102 NDGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       102 ~~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .++ +|.|.+++.+|+|.|+|.+.+...
T Consensus        68 ~ng-SL~I~~v~~~D~G~Y~~~v~~~~~   94 (105)
T cd05774          68 PNG-SLLIQNVTQKDTGFYTLQTITTNF   94 (105)
T ss_pred             CCC-cEEEecCCcccCEEEEEEEEeCCc
Confidence            344 999999999999999999998763


No 243
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins. Ig1_Robo: domain similar to the first immunoglobulin (Ig)-like domain in Robo (roundabout) receptors. Robo receptors play a role in the development of the central nervous system (CNS), and are receptors of Slit protein. Slit is a repellant secreted by the neural cells in the midline. Slit acts through Robo to prevent most neurons from crossing the midline from either side. Three mammalian Robo homologs (robo1, -2, and -3), and three mammalian Slit homologs (Slit-1,-2, -3), have been identified. Commissural axons, which cross the midline, express low levels of Robo; longitudinal axons, which avoid the midline, express high levels of Robo. robo1, -2, and -3 are expressed by commissural neurons in the vertebrate spinal cord and Slits 1, -2, -3 are expressed at the ventral midline. Robo-3 is a divergent member of the Robo family which instead of being a positive regulator of slit res
Probab=97.65  E-value=0.00019  Score=43.96  Aligned_cols=18  Identities=33%  Similarity=0.482  Sum_probs=16.6

Q ss_pred             cCCCCCeeeEEEEecCCC
Q psy534          112 IRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       112 v~~~d~G~Y~C~a~n~~g  129 (145)
                      ++.+|+|.|+|.|+|.+|
T Consensus        71 ~~~~D~G~Y~C~a~N~~G   88 (100)
T cd07693          71 KGRSDEGVYVCVAHNSLG   88 (100)
T ss_pred             CCcCcCEEEEEEEEcccc
Confidence            368999999999999999


No 244
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig6_L1-CAM_like: domain similar to the sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM).  L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth. This group also contains NrCAM [Ng(neuronglia)CAM-related cell adhesion molecule], which is primarily expressed in the nervous system, and human neurofascin.
Probab=97.64  E-value=9.4e-05  Score=43.80  Aligned_cols=25  Identities=32%  Similarity=0.527  Sum_probs=21.8

Q ss_pred             cEEEEcccCC----CCCeeeEEEEecCCC
Q psy534          105 TELRISNIRS----QDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~----~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.    +|+|.|+|.|.|.+|
T Consensus        39 g~L~i~~~~~~~~~~d~G~Y~C~A~N~~G   67 (77)
T cd05733          39 GTLVIDNMNGGRAEDYEGEYQCYASNELG   67 (77)
T ss_pred             CEEEEeccCCCCCcCCCEEEEEEEEcCCC
Confidence            4888988754    789999999999999


No 245
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). Ig2_IL1R2_like: domain similar to the second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2). IL-1 alpha and IL-1 beta are cytokines which participate in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds the type II (IL1R2) represented in this group. Mature IL1R2 consists of three IG-like domains, a transmembrane domain, and a short cytoplasmic domain. It lacks the large cytoplasmic domain of Mature IL1R1, and does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of IL-1 alpha and IL-1 beta.
Probab=97.62  E-value=0.00017  Score=44.74  Aligned_cols=26  Identities=31%  Similarity=0.401  Sum_probs=23.9

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|.++..+|+|.|+|+|.+..|
T Consensus        54 ~~~L~I~~v~~~D~G~YtC~~~~~~~   79 (95)
T cd05897          54 STYLHIIDVSLNDSGYYTCKLQFTHE   79 (95)
T ss_pred             CCEEEEEEcChhhCEEEEEEEEEeeC
Confidence            34799999999999999999999986


No 246
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=97.58  E-value=0.0003  Score=43.37  Aligned_cols=66  Identities=15%  Similarity=0.077  Sum_probs=43.5

Q ss_pred             HhhhccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534            7 VKSIFQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus         7 ~~~~~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +...+.++.+.|+... +.-.+.|||++... ...+.....     .......+.|.+++.+|+|.|+|....
T Consensus        11 vV~~G~~VTL~C~~~~-~~~~f~l~k~g~~~-~~~~~~~~~-----~~~~~a~f~I~~~~~~~~G~Y~C~~~~   76 (94)
T cd05711          11 VVPSGENVTLQCHSDI-RFDRFILYKEGRSK-PVLHLYEKH-----HGGFQASFPLGPVTPAHAGTYRCYGSY   76 (94)
T ss_pred             ccCCCCeEEEEEecCC-CCCEEEEEECCCCC-Cceeccccc-----CCeEEEEEEecCCCcccCEEEEEEEEC
Confidence            4557788999997764 34578999987531 111100000     012266789999999999999999753


No 247
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig1_Necl-1: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-1, Necl-1 (also known as celll adhesion molecule 3 (CADM3), SynCAM2, IGSF4). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the format
Probab=97.57  E-value=0.00016  Score=44.84  Aligned_cols=24  Identities=33%  Similarity=0.533  Sum_probs=21.6

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVL  128 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~  128 (145)
                      ..|.|.+++.+|+|.|+|.+....
T Consensus        62 ~~L~I~nV~~~D~G~YtC~~~t~~   85 (95)
T cd05882          62 LIISISNVQLSDEGEYTCSIFTMP   85 (95)
T ss_pred             EEEEECCCCcccCEEEEEEEEeec
Confidence            489999999999999999998743


No 248
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=97.55  E-value=0.00042  Score=41.73  Aligned_cols=65  Identities=12%  Similarity=0.004  Sum_probs=39.5

Q ss_pred             eeeEEeecC-CCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEec
Q psy534           14 LSVGDFADD-EDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLN   81 (145)
Q Consensus        14 ~~~~~w~~g-~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~   81 (145)
                      +.+.|++.| .|.+.|.||+++...... ... ... .........+|.|..-...|...|.|++.+..
T Consensus         2 ~~L~C~s~gSkP~A~I~W~k~~~~l~~~-~~~-~~~-~~~~~t~~S~L~~~p~~eDdG~~~~C~a~~~~   67 (82)
T cd05883           2 IELNCTAMASKPAATIRWFKGNKELTGK-STV-EET-WSRMFTVTSQLMLKVTKEDDGVPVICLVDHPA   67 (82)
T ss_pred             EEEEEEecCCCCCCEEEEEECCEECcCc-ccc-eec-cCCCcEEEEEEEEECchhhCCCEEEEEEcCcc
Confidence            457899985 699999999998542211 000 000 00001125667786666666779999998654


No 249
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins. Ig_CEACAM_D1_like : immunoglobulin (IG)-like domain 1 in carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) protein subfamily-like. The CEA family is a group of anchored or secreted glycoproteins, expressed by epithelial cells, leukocytes, endothelial cells and placenta. The CEA family is divided into the CEACAM and pregnancy-specific glycoprotein (PSG) subfamilies. This group represents the CEACAM subfamily. CEACAM1 has many important cellular functions, it is a cell adhesion molecule, and a signaling molecule that regulates the growth of tumor cells, it is an angiogenic factor, and is a receptor for bacterial and viral pathogens, including mouse hepatitis virus (MHV). In mice, four isoforms of CEACAM1 generated by alternative splicing have either two [D1, D4] or four [D1-D4] Ig-like domains on the cell surf
Probab=97.49  E-value=0.00029  Score=42.80  Aligned_cols=25  Identities=28%  Similarity=0.287  Sum_probs=23.0

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+|.|.+++.+|+|.|+|.+....|
T Consensus        57 ~sL~I~~l~~~DsG~Y~c~v~~~~~   81 (92)
T cd05741          57 GSLLIQNLTKEDSGTYTLQIISTNG   81 (92)
T ss_pred             ceEEEccCCchhcEEEEEEEEcCCC
Confidence            5899999999999999999998765


No 250
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins. Ig1_Nectin-1_like: domain similar to the first immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111). Nectin-1 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. In addition nectins heterophilically trans-interact with other CAMs such as nectin-like molecules (Necls), nectin-1 for example, has been shown to trans-interact with Necl-1. Nectins also interact with various other proteins, including the actin filament (F-actin)-binding protein, afadin. Mutation in the human nectin-1 gene is 
Probab=97.48  E-value=0.00019  Score=44.77  Aligned_cols=26  Identities=19%  Similarity=0.285  Sum_probs=23.2

Q ss_pred             CcEEEEcccCCCCCeeeEEEEec-CCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATH-VLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n-~~g  129 (145)
                      +.+|.|.+++.+|+|.|.|.+.+ +.|
T Consensus        62 daSi~i~nl~~~D~G~Y~C~v~t~P~g   88 (99)
T cd05886          62 DGTISLSRLELEDEGVYICEFATFPTG   88 (99)
T ss_pred             cceEEEcCCccccCEEEEEEEEeCCCC
Confidence            34899999999999999999999 555


No 251
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins. Ig2_FGFR_like: domain similar to the second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor. FGF receptors bind FGF signaling polypeptides. FGFs participate in multiple processes such as morphogenesis, development, and angiogenesis. FGFs bind to four FGF receptor tyrosine kinases (FGFR1, -2, -3, -4). Receptor diversity is controlled by alternative splicing producing splice variants with different ligand binding characteristics and different expression patterns. FGFRs have an extracellular region comprised of three Ig-like domains, a single transmembrane helix, and an intracellular tyrosine kinase domain. Ligand binding and specificity reside in the Ig-like domains 2 and 3, and the linker region that connects these two. FGFR activation and signaling depend on FGF-induced dimerization, a process involving cell surface heparin or heparin 
Probab=97.47  E-value=0.00032  Score=41.67  Aligned_cols=24  Identities=25%  Similarity=0.517  Sum_probs=22.8

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.|.+++.+|+|.|+|.|.|..|
T Consensus        52 ~l~i~~~~~~d~g~Y~C~~~n~~g   75 (85)
T cd05729          52 TLILESVVPSDSGKYTCIVENKYG   75 (85)
T ss_pred             EEEEeECCcccCEEEEEEEEECCc
Confidence            689999999999999999999998


No 252
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins. Ig5_KIRREL3-like: domain similar to the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=97.45  E-value=0.00023  Score=44.10  Aligned_cols=24  Identities=33%  Similarity=0.457  Sum_probs=22.2

Q ss_pred             EEEEcccCCCC-CeeeEEEEecCCC
Q psy534          106 ELRISNIRSQD-IGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d-~G~Y~C~a~n~~g  129 (145)
                      .|.|.++..+| .|.|+|.|.|..|
T Consensus        65 ~L~I~~v~~~d~~G~Y~C~A~N~~G   89 (98)
T cd05758          65 TLTISNTQESDFQTSYNCTAWNSFG   89 (98)
T ss_pred             EEEECCccccccceeEEEEEEcCCC
Confidence            79999999855 8999999999999


No 253
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins. Ig2_L1-CAM_like: domain similar to the second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM). L1 belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains, five fibronectin type III domains, a transmembrane region and an intracellular domain. L1 is primarily expressed in the nervous system and is involved in its development and function. L1 is associated with an X-linked recessive disorder, X-linked hydrocephalus, MASA syndrome, or spastic paraplegia type 1, that involves abnormalities of axonal growth.
Probab=97.45  E-value=0.00023  Score=44.13  Aligned_cols=25  Identities=32%  Similarity=0.442  Sum_probs=22.9

Q ss_pred             cEEEEcccCCCCCe-eeEEEEecCCC
Q psy534          105 TELRISNIRSQDIG-DYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G-~Y~C~a~n~~g  129 (145)
                      +.|.|.+++.+|+| .|.|.|+|...
T Consensus        58 GnL~fs~v~~~D~g~~Y~C~a~~~~~   83 (95)
T cd05845          58 GNLYFANVEEQDSHPDYICHAHFPGL   83 (95)
T ss_pred             ceEEEEEEehhhCCCCeEEEEEcccc
Confidence            49999999999999 79999999864


No 254
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). Ig5_KIRREL3: the fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1). These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development. Neph1 and 2 may mediate axonal guidance and synapse formation in certain areas of the CNS. In the kidney, they participate in the formation of the slit diaphragm.
Probab=97.43  E-value=0.00051  Score=42.80  Aligned_cols=66  Identities=18%  Similarity=0.203  Sum_probs=39.0

Q ss_pred             ccCCCCCEEEEEEEEEecCCC--------CCCCCC--cEEEEEEe-EEecCCcEEEEcccCCCC-CeeeEEEEecCCC
Q psy534           64 KIRESDQGWYECKVVFLNRSP--------NSHKNG--TWFHLDVH-GVFNDGTELRISNIRSQD-IGDYTCLATHVLY  129 (145)
Q Consensus        64 ~v~~~D~G~Y~C~~~~~~~~~--------~~~~~g--~~~~l~c~-~~~~~~~~L~i~~v~~~d-~G~Y~C~a~n~~g  129 (145)
                      .+.+.|.+.-.|.+...-.+.        .....+  ..+.+.-. ......+.|.|.++.++| .|.|.|.|.|.+|
T Consensus        12 ~~~~G~~~~L~C~~~s~P~P~~i~W~w~~~~i~~~~~~r~~I~~~~~~~g~~S~L~I~~~~~~d~~g~Y~C~a~N~~G   89 (98)
T cd05898          12 YAVRGERGKVKCFIGSTPPPDRIAWAWKENVLESGTSERYTVERTSTGSGVLSTLTINNIMEADFQTHYNCTAWNSFG   89 (98)
T ss_pred             EEeCCCcEEEEEEEccCCCCcEEEEEEccccccCCCCCCEEEEEEccCCCcEEEEEECCCccccCCcEEEEEEEeCCc
Confidence            456889999999983211000        011111  12222211 011123479999998877 7999999999999


No 255
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. Ig1_CD4; first immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=97.41  E-value=8.9e-05  Score=45.88  Aligned_cols=25  Identities=24%  Similarity=0.335  Sum_probs=22.8

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.+.|..+
T Consensus        65 ~~L~I~~l~~sDsgtY~C~v~~~~~   89 (94)
T cd07690          65 FPLIIKNLKIEDSDTYICEVEDKKE   89 (94)
T ss_pred             EEEEECCCCHHHCEEEEEEECCccc
Confidence            3699999999999999999999865


No 256
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins. Ig1_Nectin-4_like: domain similar to the first immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor). Nectin-4 belongs to the nectin family, which is comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example nectin-4 trans-interacts with nectin-1. Nectin-4 has also been shown to interact with the actin filament-binding protein, afadin. Unlike the other nectins, which are widely expressed in adult tissues, nectin-4 is mainly expressed during embryogenesis, and is not detected in normal adult 
Probab=97.40  E-value=0.00021  Score=44.54  Aligned_cols=26  Identities=23%  Similarity=0.293  Sum_probs=22.7

Q ss_pred             CcEEEEcccCCCCCeeeEEEEec-CCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATH-VLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n-~~g  129 (145)
                      +.+|.|.+++.+|+|.|+|.+.+ +.|
T Consensus        63 ~~sL~I~nv~~sD~GtY~C~v~~~p~g   89 (100)
T cd05888          63 DGALILRNAVQADEGKYKCRVITFPAG   89 (100)
T ss_pred             ceEEEEecCccccceEEEEEEEeCCCC
Confidence            34899999999999999999987 445


No 257
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=97.40  E-value=0.00065  Score=42.50  Aligned_cols=74  Identities=14%  Similarity=0.065  Sum_probs=47.0

Q ss_pred             HHhhhccceeeEEeecCCCccE-EEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            6 AVKSIFQMLSVGDFADDEDIPV-YIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         6 ~~~~~~~~~~~~~w~~g~p~p~-~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .....+-.+.+.+-....|.|. +.|.+.+....+ ............-....+.|.+.+++.+|+|.|+|.+.+.
T Consensus        13 ~~v~~gE~~~L~V~ieAYP~p~~~~W~~~~~~l~~-~~~~~~~~~~~~~~rY~S~L~L~Rlk~~E~G~YTf~a~N~   87 (101)
T cd05860          13 IFVNAGENLDLIVEYEAYPKPEHQQWIYMNRTLTN-TSDHYVKSRNESNNRYVSELHLTRLKGTEGGTYTFLVSNS   87 (101)
T ss_pred             EEEECCCCEEEEEEEEeCCCCeeeEEEcCCcccCc-cccceeEEeccCceEEEEEEEEeecChhhCcEEEEEEECC
Confidence            3445566667777777899997 999887643211 1111111110000113588999999999999999999754


No 258
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). Ig_MOG_like:  immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG). MOG, a minor component of the myelin sheath, is an important CNS-specific autoantigen, linked to the pathogenesis of multiple sclerosis (MS) and experimental autoimmune encephalomyelitis (EAE). It is a transmembrane protein having an extracellular Ig domain. MOG is expressed in the CNS on the outermost lamellae of the myelin sheath, and on the surface of oligodendrocytes, and may participate in the completion, compaction, and/or maintenance of myelin. This group also includes butyrophilin (BTN). BTN is the most abundant protein in bovine milk-fat globule membrane (MFGM).
Probab=97.40  E-value=0.00019  Score=44.53  Aligned_cols=25  Identities=40%  Similarity=0.655  Sum_probs=22.8

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+|.|.+++.+|+|.|+|.+.+..+
T Consensus        65 ~sL~I~~v~~~D~G~Y~C~v~~~~~   89 (100)
T cd05713          65 VALRIHNVRASDEGLYTCFFQSDGF   89 (100)
T ss_pred             EEEEEEcCChhhCEEEEEEEecCCc
Confidence            4799999999999999999998765


No 259
>cd05761 Ig2_Necl-1-4_like Second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-4 (also known as cell adhesion molecules CADM3, CADM1, CADM2, and CADM4, respectively). Ig2_Necl-1-4_like: domain similar to the second immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), Necl-3 (CADM2) and Necl-4 (CADM4). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cel
Probab=97.40  E-value=0.00093  Score=40.03  Aligned_cols=65  Identities=14%  Similarity=0.165  Sum_probs=36.5

Q ss_pred             eeeEEeecC-CCccEEEEecCCCCcccccccceEEEecCCCCC-CeeeEEEcccCCCCCEEEEEEEEEec
Q psy534           14 LSVGDFADD-EDIPVYIWYDSYPTHEAEEYKGRISRVDKESPF-GMASLNLTKIRESDQGWYECKVVFLN   81 (145)
Q Consensus        14 ~~~~~w~~g-~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~-~~~sL~I~~v~~~D~G~Y~C~~~~~~   81 (145)
                      +.+.|++.| .|.+.+.||+++.......   ......+.... -...|.+......|.+.|.|++.+..
T Consensus         2 ~~L~C~~~~~~P~~~v~W~~~~~~l~~~~---~~~~~~~~~~~~~~s~l~~~~~~~d~g~~~~C~v~h~~   68 (82)
T cd05761           2 VELTCTSSGSKPAATIRWFKGDKELKGVK---LKEEDENGKTFTVTSSLRFQVDREDDGAPIICRVDHPA   68 (82)
T ss_pred             EEEEEEecCcCcCCeEEEEECCEEccCce---eeEecCCCCEEEEEEEEEEEcchhhCCCEEEEEEeChh
Confidence            467899984 5999999999975422111   11111110000 02334554444555679999998654


No 260
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins. Ig_CSPGs_LP: immunoglobulin (Ig)-like domain similar to that found in chondroitin sulfate proteoglycans (CSPGs) and human cartilage link protein (LP).  Included in this group are the CSPGs aggrecan, versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue.
Probab=97.39  E-value=0.00021  Score=44.86  Aligned_cols=26  Identities=27%  Similarity=0.512  Sum_probs=23.6

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..+|.|.+++.+|+|.|.|.+.+..+
T Consensus        67 ~~sL~I~~v~~sD~G~Y~C~v~~~~~   92 (106)
T cd05714          67 DASLVITDLRLEDSGRYRCEVIDGIE   92 (106)
T ss_pred             cceEEECCCCHHHCEEEEEEEEcCCC
Confidence            35899999999999999999999866


No 261
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). Ig6_hNeurofascin_like:  the sixth immunoglobulin (Ig)-like domain of human neurofascin (NF). NF belongs to the L1 subfamily of cell adhesion molecules (CAMs) and is comprised of an extracellular region having six Ig-like domains and five fibronectin type III domains, a transmembrane region, and a cytoplasmic domain. NF has many alternatively spliced isoforms having different temporal expression patterns during development. NF participates in axon subcellular targeting and synapse formation, however little is known of the functions of the different isoforms.
Probab=97.37  E-value=0.00028  Score=41.84  Aligned_cols=26  Identities=27%  Similarity=0.350  Sum_probs=21.3

Q ss_pred             CcEEEEcccC----CCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIR----SQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~----~~d~G~Y~C~a~n~~g  129 (145)
                      +.+|.|..+.    .+|+|.|+|.|+|.+|
T Consensus        38 ~~~L~i~~~~~~~~~~d~G~Y~C~A~N~~G   67 (77)
T cd05875          38 SGTLVIDFSGGGRPEDYEGEYQCFARNNLG   67 (77)
T ss_pred             CceEEEeccCCCCCCCCCEEEEEEEEeccc
Confidence            3489998764    2469999999999999


No 262
>cd05751 Ig1_LILRB1_like First immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1) and similar proteins. Ig1_LILRB1_like: domain similar to the first immunoglobulin (Ig)-like domain found in Leukocyte Ig-like receptors (LILR)B1 (also known as LIR-1). This group includes, LILRA5 (LIR9), an activating natural cytotoxicity receptor NKp46, and the immune-type receptor glycoprotein VI (GPVI). LILRs are a family of immunoreceptors expressed on expressed on T and B cells, on monocytes, dendritic cells, and subgroups of natural killer (NK) cells. The human LILR family contains nine proteins (LILRA1-3,and 5, and LILRB1-5). From functional assays, and as the cytoplasmic domains of various LILRs, for example LILRB1 (LIR-1), LILRB2 (LIR-2), and LILRB3 (LIR-3) contain immunoreceptor tyrosine-based inhibitory motifs (ITIMs) it is thought that LIR proteins are inhibitory receptors. Of the eight LIR family proteins, only LIR-1(LILRB1), and LIR-2 (LILRB2),
Probab=97.35  E-value=0.00036  Score=42.68  Aligned_cols=22  Identities=18%  Similarity=0.472  Sum_probs=20.5

Q ss_pred             EEEEcccCCCCCeeeEEEEecC
Q psy534          106 ELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      .+.|.+++.+|+|.|+|...+.
T Consensus        54 ~f~i~~v~~~~~G~Y~C~~~~~   75 (91)
T cd05751          54 KFFIPSMKREHAGRYRCYYRSG   75 (91)
T ss_pred             EEEccCCChhHCEEEEEEEECC
Confidence            5899999999999999999986


No 263
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP). Ig_LP_like: immunoglobulin (Ig)-like domain similar to that that found in human cartilage link protein (LP). In cartilage, chondroitin-keratan sulfate proteoglycan (CSPG), aggrecan, forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=97.32  E-value=0.00026  Score=44.40  Aligned_cols=26  Identities=31%  Similarity=0.542  Sum_probs=23.7

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..+|.|.+++.+|+|.|.|.+.++.+
T Consensus        67 ~~sL~I~~v~~~DsG~Y~C~v~~~~~   92 (106)
T cd05877          67 DASLVITDLRLEDYGRYRCEVIDGLE   92 (106)
T ss_pred             cEEEEEccCChHHCEEEEEEEEeccc
Confidence            34799999999999999999999887


No 264
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs). Ig2_Tyro3_like: the second immunoglobulin (Ig)-like domain in the Axl/Tyro3 family of receptor tyrosine kinases (RTKs). This family includes Axl (also known as Ark, Ufo, and Tyro7), Tyro3 (also known as Sky, Rse, Brt, Dtk, and Tif), and Mer (also known as Nyk, c-Eyk, and Tyro12). Axl/Tyro3 family receptors have an extracellular portion with two Ig-like domains followed by two fibronectin-types III (FNIII) domains, a membrane-spanning single helix, and a cytoplasmic tyrosine kinase domain. Axl, Tyro3 and Mer are widely expressed in adult tissues, though they show higher expression in the brain, in the lymphatic and vascular systems, and in the testis. Axl, Tyro3, and Mer bind the vitamin K dependent protein Gas6 with high affinity, and in doing so activate their tyrosine kinase activity. Axl/Gas6 signaling may play a part in cell adhesion processes, prevention of apoptosis, and c
Probab=97.31  E-value=0.00057  Score=41.00  Aligned_cols=24  Identities=13%  Similarity=0.353  Sum_probs=20.7

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +..|.|..+  .|+|.|.|.|+|.+|
T Consensus        48 ~s~L~i~~~--~d~g~Y~C~A~N~~G   71 (81)
T cd05749          48 PSVLNVPGL--NETSKFSCEAHNAKG   71 (81)
T ss_pred             CCEEEEccc--cCCeEEEEEEEeccC
Confidence            457899887  478999999999999


No 265
>cd05884 Ig2_Necl-3 Second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig2_Necl-3: second immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-3 has been shown to accumulate in tissues of the central and peripheral nervous system, where it is expressed in ependymal cells and myelinated axons.  It is observed at the interface between the axon shaft and the myelin sheath. Ig domains are likely to participate in ligand binding and recognition.
Probab=97.29  E-value=0.002  Score=38.85  Aligned_cols=66  Identities=11%  Similarity=0.101  Sum_probs=37.9

Q ss_pred             eeeEEeecC-CCccEEEEecCCCCcccccccceEEEecCCCC-CCeeeEEEcccCCCCCEEEEEEEEEec
Q psy534           14 LSVGDFADD-EDIPVYIWYDSYPTHEAEEYKGRISRVDKESP-FGMASLNLTKIRESDQGWYECKVVFLN   81 (145)
Q Consensus        14 ~~~~~w~~g-~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~-~~~~sL~I~~v~~~D~G~Y~C~~~~~~   81 (145)
                      +.++|++.| .|...++|+|++....+...  .......+.. ..-.+|.|..-...|...|.|++.+..
T Consensus         2 ~~LtC~a~gf~P~~~itW~kng~~l~~~~~--~~~~~~~~~t~~~~s~L~~~~~~~d~g~~ytC~v~h~~   69 (83)
T cd05884           2 MQLTCKTSGSKPAADIRWFKNDKEIKDVKY--LKEEDANRKTFTVSSTLDFRVDRSDDGVAIICRVDHES   69 (83)
T ss_pred             EEEEEEeCCccCCCEEEEEECCEECcCcee--eEeeCCCCCEEEEEEEEEEEcccccCCCEEEEEEechh
Confidence            568999995 68889999999864222111  0111011000 013445555444566779999997653


No 266
>PF13895 Ig_2:  Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A ....
Probab=97.22  E-value=0.00079  Score=39.29  Aligned_cols=24  Identities=38%  Similarity=0.559  Sum_probs=21.1

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+.+.+++.+|+|.|+|.|.+..+
T Consensus        46 ~~~~~~~~~~~~g~y~C~~~~~~~   69 (80)
T PF13895_consen   46 GLFIPNVSPEDSGNYTCRASNGSG   69 (80)
T ss_dssp             EEEESSEEGGGTEEEEEEEEETTE
T ss_pred             eeeeeeeccccCEEEEEEEEeCCC
Confidence            377889999999999999999765


No 267
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. Ig_Aggrecan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan. These aggregates contribute to the tissue's load bearing properties. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Aggrecan has a wide distribution in connective tissue and extracellular matrices. Members of the vertebrate HPLN (hyaluronan/HA and proteoglycan binding link) protein family are physically linked adjacent to CSPG genes.
Probab=97.17  E-value=0.00064  Score=43.41  Aligned_cols=27  Identities=33%  Similarity=0.623  Sum_probs=24.1

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ...+|.|.+++.+|+|.|+|.+.+++.
T Consensus        72 ~~asL~I~nl~~sDsG~Y~C~V~~g~~   98 (112)
T cd05900          72 SDATLEITELRSNDSGTYRCEVMHGIE   98 (112)
T ss_pred             CCcEEEEeecccccCEEEEEEEecCCC
Confidence            345899999999999999999998876


No 268
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)). Ig1_Necl-3: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-3, Necl-3 (also known as cell adhesion molecule 2 (CADM2), SynCAM2, IGSF4D).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses.  Necl-3 accumulates in central and peripheral nervous system tissue, and has been shown to selectively interact with oligodendrocytes.
Probab=97.14  E-value=0.00046  Score=42.64  Aligned_cols=25  Identities=28%  Similarity=0.462  Sum_probs=22.1

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+|.|.+++.+|+|.|+|.+.+..+
T Consensus        62 ~sL~I~~v~~~DsG~Y~C~~~t~~~   86 (95)
T cd07701          62 LSISISDVSLSDEGQYTCSLFTMPV   86 (95)
T ss_pred             EEEEECcCCcccCEEEEEEeEeecC
Confidence            4799999999999999999998543


No 269
>PF13927 Ig_3:  Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C ....
Probab=97.10  E-value=0.00037  Score=40.08  Aligned_cols=23  Identities=43%  Similarity=0.821  Sum_probs=20.9

Q ss_pred             CcEEEEcccCCCCCeeeEEEEec
Q psy534          104 GTELRISNIRSQDIGDYTCLATH  126 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n  126 (145)
                      ...|.|.++..+|.|.|+|.|+|
T Consensus        53 ~~~L~i~~v~~~~~g~y~C~a~N   75 (75)
T PF13927_consen   53 NSTLTISNVTRSDNGTYTCIASN   75 (75)
T ss_dssp             EEEEEESSCCGGGTEEEEEEEEE
T ss_pred             eeEEEEccCCHHhCcEEEEEEEC
Confidence            34899999999999999999987


No 270
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins. Ig1_ MRC-OX-2_like: domain similar to the first immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200). MRC OX-2 is a membrane glycoprotein expressed in a variety of lymphoid and non-lymphoid cells in rats. It has a similar broad distribution pattern in humans. MRC OX-2 may regulate myeloid cell activity. The protein has an extracellular portion containing two Ig-like domains, a transmembrane portion, and a cytoplasmic portion.
Probab=97.10  E-value=0.0012  Score=40.82  Aligned_cols=24  Identities=29%  Similarity=0.533  Sum_probs=21.2

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      ..+|.|.+++.+|+|.|.|.....
T Consensus        60 ~~sL~I~nv~~~D~G~Y~C~~~~~   83 (97)
T cd05846          60 STSITIWNVTLEDEGCYKCIFNTF   83 (97)
T ss_pred             ccEEEEeCCceeeeEEEEEEEEeC
Confidence            458999999999999999998754


No 271
>smart00407 IGc1 Immunoglobulin C-Type.
Probab=97.09  E-value=0.003  Score=37.09  Aligned_cols=67  Identities=7%  Similarity=0.033  Sum_probs=38.0

Q ss_pred             ceeeEEeecCC-Cc-cEEEEecCCCCcccccccceEEEecCCCCCC-eeeEEEcccCCCCCEEEEEEEEEe
Q psy534           13 MLSVGDFADDE-DI-PVYIWYDSYPTHEAEEYKGRISRVDKESPFG-MASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        13 ~~~~~~w~~g~-p~-p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~-~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ++.+.|.+.|. |. ..+.|+|++... ......-..+...+.... -..|.|......+...|.|++.+.
T Consensus         1 ~~~L~C~a~gf~P~~i~v~W~k~g~~~-~~~~~~~~~~~~~~gt~~~~s~L~v~~~~~~~~~~~tC~V~H~   70 (75)
T smart00407        1 KATLVCLVSGFYPPDITVTWLRNGQEV-TSGVSTTDPLKNSDGTYFLSSYLTVSASTWESGDTYTCQVTHE   70 (75)
T ss_pred             CeEEEEEEEeEeCCCCEEEEEECCEEC-CCCEEECceEECCCCCEEEEEEEEEccccCCCCCEEEEEEEEc
Confidence            46789999975 65 579999987532 222211111111111111 344555554556778999999754


No 272
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively). Ig1_Necl-1-3_like:  N-terminal immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 (also known as cell adhesion molecule 3 (CADM3)), Necl-2 (CADM1), and Necl-3 (CADM2). At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1, Necl-2, and Necl-3 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue, and is important to the form
Probab=97.08  E-value=0.00063  Score=41.76  Aligned_cols=25  Identities=32%  Similarity=0.472  Sum_probs=22.2

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.+.+...
T Consensus        62 ~~L~I~~v~~~DsG~Y~C~~~~~~~   86 (95)
T cd05717          62 LSISISNVSLSDEGRYTCSLYTMPV   86 (95)
T ss_pred             eEEEEccCCcccCEEEEEEEecCCC
Confidence            4799999999999999999998654


No 273
>cd07705 Ig2_Necl-1 Second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). Ig2_Necl-1: second immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)). These nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. The N-terminal Ig-like domain of the extracellular region belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-1 and Necl-2 have Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is specifically expressed in neural tissue and is important to the formation of synapses, axon bundles, and myel
Probab=97.07  E-value=0.0041  Score=37.38  Aligned_cols=64  Identities=14%  Similarity=0.146  Sum_probs=37.9

Q ss_pred             eeeEEeecC-CCccEEEEecCCCCcccccccceEEEecC-CC-CC-CeeeEEEcccCCCCCEEEEEEEEEec
Q psy534           14 LSVGDFADD-EDIPVYIWYDSYPTHEAEEYKGRISRVDK-ES-PF-GMASLNLTKIRESDQGWYECKVVFLN   81 (145)
Q Consensus        14 ~~~~~w~~g-~p~p~~~w~k~~~~~~~~~~~~R~~~~~~-~~-~~-~~~sL~I~~v~~~D~G~Y~C~~~~~~   81 (145)
                      ..+.|.+.| .|.+.++|++++... .....   ....+ +. .. -...|.|......|...|.|++.+..
T Consensus         2 ~~LtC~a~g~~P~~~ItW~k~g~~l-~~~~~---~~~~~~~~~t~~~~s~l~~~~~~~d~g~~~tC~v~h~~   69 (83)
T cd07705           2 AKLRCTSSGSKPAANIKWRKGDQEL-EGAPT---SVLEDGNGKTFTVSSSVEFQVTREDDGAEITCSVGHES   69 (83)
T ss_pred             EEEEEEecCccCCCEeEEEECCEEC-CCcce---eEEECCCCCEEEEEEEEEEEecchhCCCEEEEEEECcc
Confidence            357899985 598999999998542 21111   11111 00 00 02445555555667789999998643


No 274
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0). Ig_P0ex: immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an Ig domain.  The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin.
Probab=97.03  E-value=0.00068  Score=43.55  Aligned_cols=26  Identities=23%  Similarity=0.339  Sum_probs=23.3

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +.+|.|.+++.+|.|.|+|.+.|+-+
T Consensus        79 daSI~I~nv~~sD~G~Y~C~v~n~p~  104 (116)
T cd05879          79 DGSIVIHNLDYTDNGTFTCDVKNPPD  104 (116)
T ss_pred             eeEEEEccCCcccCEEEEEEEEcCCC
Confidence            34899999999999999999999865


No 275
>PF11465 Receptor_2B4:  Natural killer cell receptor 2B4;  InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells. It plays a role in activating NK-mediated cytotoxicity through its interaction with CD48 on target cells in a subset of CD8 T cells []. The structure of 2B4 consists of an immunoglobulin variable domain fold and contains two beta-sheets. One of the beta-sheets, the six-stranded sheet, contains structural features that may have a role in ligand recognition and receptor function []. This entry represents the 2B4 immunoglobulin domain.; GO: 0005488 binding; PDB: 2PTU_D 2PTT_B 1Z2K_A.
Probab=97.01  E-value=0.002  Score=40.46  Aligned_cols=65  Identities=12%  Similarity=0.154  Sum_probs=40.9

Q ss_pred             hccceeeEEeec---CCCcc--EEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           10 IFQMLSVGDFAD---DEDIP--VYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        10 ~~~~~~~~~w~~---g~p~p--~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +-+-+.-+.|..   ..+..  +++|..+........+..|+.+.     .++.+|.|..++++|+|.|.-++.+
T Consensus        23 ~Qtk~~sv~WK~~l~s~~~~~~IltW~n~~~~~~~~~~n~r~~F~-----~enlaLlIkaAq~qDSG~Y~LEvT~   92 (108)
T PF11465_consen   23 IQTKVYSVQWKMQLPSQKKFEVILTWKNDSTPSYNSSFNNRFNFT-----SENLALLIKAAQPQDSGLYCLEVTN   92 (108)
T ss_dssp             ---SSEEEEEEEEETSSSEEE-EEEEETTEEEESSTTHHHHEEEE-----TTTTEEEESS-SGGG-EEEEEEEEE
T ss_pred             ccceeEEEEEEEEcccCCceEEEEEEcCCCcccccccccceEeee-----ccCceEEEeecCcccCceEEEEEEc
Confidence            334455678876   44444  35564443222223367888875     4599999999999999999999874


No 276
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig1_PVR_like: domain similar to the first immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), that result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane, may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus "c
Probab=97.00  E-value=0.00093  Score=41.05  Aligned_cols=26  Identities=31%  Similarity=0.483  Sum_probs=22.3

Q ss_pred             CcEEEEcccCCCCCeeeEEEEec-CCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATH-VLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n-~~g  129 (145)
                      ..+|.|.+++.+|+|.|.|.+.. +.|
T Consensus        61 ~~sL~I~~v~~~D~G~Y~C~v~~~~~g   87 (98)
T cd05718          61 DATISISNLRLEDEGNYICEFATFPQG   87 (98)
T ss_pred             ceEEEEccCCcccCEEEEEEEEeCCCC
Confidence            34899999999999999999875 455


No 277
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG). Ig_Aggrecan_like: immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG)s. Included in this group are the Ig domains of other CSPGs: versican, and neurocan. In CSPGs this Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, aggrecan forms cartilage link protein stabilized aggregates with hyaluronan (HA). These aggregates contribute to the tissue's load bearing properties. Aggrecan and versican have a wide distribution in connective tissue and extracellular matrices. Neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substi
Probab=96.96  E-value=0.0011  Score=42.05  Aligned_cols=25  Identities=40%  Similarity=0.624  Sum_probs=22.3

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+|.|.+++.+|+|.|.|.+.....
T Consensus        72 asL~I~~l~~sD~G~Y~C~v~~~~~   96 (110)
T cd05878          72 ASLEISRLRSSDSGVYRCEVMHGIE   96 (110)
T ss_pred             EEEEECCCChhhCEEEEEEEEeCCC
Confidence            4799999999999999999988654


No 278
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. Ig_Versican: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Like aggrecan, versican has a wide distribution in connective tissue and extracellular matrices. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many different tissues. Members of the vertebrate HPLN (hyaluronan/HA
Probab=96.90  E-value=0.0016  Score=41.94  Aligned_cols=26  Identities=31%  Similarity=0.558  Sum_probs=23.7

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +.+|.|.+++.+|+|.|.|.+.++..
T Consensus        78 ~asL~i~~v~~sD~G~Y~C~V~~g~~  103 (117)
T cd05901          78 DASLTIVKLRASDAGVYRCEVMHGIE  103 (117)
T ss_pred             ceEEEEcccccccCEEEEEEEEECCc
Confidence            35899999999999999999998876


No 279
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA). Ig_EVA: immunoglobulin (Ig) domain of epithelial V-like antigen 1 (EVA). EVA is also known as myelin protein zero-like 2. EVA is an adhesion molecule, which may play a role in structural organization of the thymus and early lymphocyte development.
Probab=96.89  E-value=0.00094  Score=42.72  Aligned_cols=26  Identities=23%  Similarity=0.396  Sum_probs=22.9

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..+|.|.+++.+|+|.|+|.+.|.-.
T Consensus        78 ~~sL~I~~v~~~D~G~Y~C~v~~~~~  103 (115)
T cd05880          78 DASILIWQLQPTDNGTYTCQVKNPPD  103 (115)
T ss_pred             ceEEEEeeCChhhCEEEEEEEEeCCC
Confidence            34799999999999999999998654


No 280
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. Ig_Neurocan: immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan. In CSPGs, the Ig-like domain is followed by hyaluronan (HA)-binding tandem repeats, and a C-terminal region with epidermal growth factor-like, lectin-like, and complement regulatory protein-like domains. Separating these N- and C-terminal regions is a nonhomologous glycosaminoglycan attachment region. In cartilage, the CSPG aggrecan (not included in this group) forms cartilage link protein stabilized aggregates with HA. These aggregates contribute to the tissue's load bearing properties. Unlike aggrecan which is widely distributed in connective tissue and extracellular matrices, neurocan is localized almost exclusively in nervous tissue. Aggregates having other CSPGs substituting for aggrecan may contribute to the structural integrity of many differen
Probab=96.86  E-value=0.0011  Score=42.26  Aligned_cols=26  Identities=27%  Similarity=0.468  Sum_probs=23.1

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..+|.|.+++.+|+|.|.|.+..+..
T Consensus        71 ~asL~i~nv~~~D~G~Y~C~v~~g~~   96 (110)
T cd05902          71 NASLVLSRLRYSDSGTYRCEVVLGIN   96 (110)
T ss_pred             eEEEEECCCCHHHCEEEEEEEEECCc
Confidence            34899999999999999999998764


No 281
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. Ig_SLAM-CD84_like_N: The N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like. The SLAM family is a group of immune-cell specific receptors that can regulate both adaptive and innate immune responses. Members of this group include proteins such as CD84, SLAM (CD150), Ly-9 (CD229), NTB-A (ly-108, SLAM6), 19A (CRACC), and SLAMF9. The genes coding for the SLAM family are nested on chromosome 1, in humans at 1q23, and in mice at 1H2. The SLAM family is a subset of the CD2 family, which also includes CD2 and CD58 located on chromosome 1 at 1p13 in humans. In mice, CD2 is located on chromosome 3, and there is no CD58 homolog. The SLAM family proteins are organized as an extracellular domain with either two or four Ig-like domains, a single transmembrane segment, and a cytoplasmic region 
Probab=96.85  E-value=0.0012  Score=40.82  Aligned_cols=25  Identities=28%  Similarity=0.356  Sum_probs=23.1

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+|.|.+++.+|+|.|.|.+.+..|
T Consensus        61 ~sL~I~~~~~~DsG~Y~c~v~~~~~   85 (97)
T cd05775          61 YSLQISNLKMEDAGSYRAEINTKNG   85 (97)
T ss_pred             eeEEECCCchHHCEEEEEEEEcCCC
Confidence            4899999999999999999998876


No 282
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=96.81  E-value=0.0087  Score=38.28  Aligned_cols=39  Identities=15%  Similarity=0.248  Sum_probs=28.6

Q ss_pred             ccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEec
Q psy534           42 YKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLN   81 (145)
Q Consensus        42 ~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~   81 (145)
                      .++|+.. ..+......+|.|.+++.+|++.|.|......
T Consensus        59 ~~~r~tc-s~~~s~ntv~L~l~~L~a~DTa~Y~Ca~e~my   97 (115)
T cd05721          59 SLDGFNC-DGTLGNEQVNFTLQNLRANQTDIYFCKIELMY   97 (115)
T ss_pred             cCCCeEE-eEeCCCCEEEEEEcCCCHHHCeEEEEEeeecc
Confidence            4566643 22344557889999999999999999875443


No 283
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins. Ig_P0ex-like: domain similar to the immunoglobulin (Ig) domain of Protein zero (P0). P0 accounts for over 50% of the total protein in peripheral nervous system (PNS) myelin. P0 is a single-pass transmembrane glycoprotein with a highly basic intracellular domain and an extracellular Ig domain. The extracellular domain of P0 (P0-ED) is similar to the Ig variable domain, carrying one acceptor sequence for N-linked glycosylation. P0 plays a role in membrane adhesion in the spiral wraps of the myelin sheath. The intracellular domain is thought to mediate membrane apposition of the cytoplasmic faces and may, through electrostatic interactions, interact directly with lipid headgroups. It is thought that homophilic interactions of the P0 extracellular domain mediate membrane juxtaposition in the extracellular space of PNS myelin. This group also contains the Ig domain of Sodium channel subunit beta-2 
Probab=96.76  E-value=0.0015  Score=41.64  Aligned_cols=25  Identities=28%  Similarity=0.421  Sum_probs=22.3

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .+|.|.+++.+|+|.|.|.+.|.-.
T Consensus        80 ~sL~I~~v~~~D~G~Y~C~v~~~~~  104 (116)
T cd05715          80 ASIVIHNLQFTDNGTYTCDVKNPPD  104 (116)
T ss_pred             eEEEEeeCCcccCEEEEEEEEeCCC
Confidence            4799999999999999999998643


No 284
>KOG3515|consensus
Probab=96.72  E-value=0.0061  Score=50.35  Aligned_cols=109  Identities=16%  Similarity=0.171  Sum_probs=74.4

Q ss_pred             hhccceeeEEeecC-CCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEecC-----
Q psy534            9 SIFQMLSVGDFADD-EDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFLNR-----   82 (145)
Q Consensus         9 ~~~~~~~~~~w~~g-~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~~~-----   82 (145)
                      ..+..|.+-|.+++ .|.+.+.||+.+....     +|-..      ..+..|...++.+..-+.|.|++.+...     
T Consensus        20 ~~g~~v~l~C~v~~~pp~~~~eW~h~~~~~~-----~~~~~------~~~~~~~~~~~~~~~~~~~~c~a~ns~~~~~~~   88 (741)
T KOG3515|consen   20 RLGEDVPLPCRVNSNPPEIDVEWYHSTSGEH-----GRYAT------IADPTLVTTGDVRDTVAELNCRAFNSVGMPSRC   88 (741)
T ss_pred             ccCCcceeeeecCCCCCCcceEEEecCcccc-----ccccc------ccCCceeeecchhhhhhhhhhhhcccccCceec
Confidence            45778899999995 4677899999875421     33322      2377788888888889999999965421     


Q ss_pred             --------CC--------CCCCCCcEEEEEEe------------------------------------EEecCCcEEEEc
Q psy534           83 --------SP--------NSHKNGTWFHLDVH------------------------------------GVFNDGTELRIS  110 (145)
Q Consensus        83 --------~~--------~~~~~g~~~~l~c~------------------------------------~~~~~~~~L~i~  110 (145)
                              ++        .....+..+.+.|.                                    +.......+.+.
T Consensus        89 ~~~l~v~~~pa~~~~~~e~~~~~~~vvqi~c~~~~~~~P~~nlrW~~n~r~e~~~~~~~~~~~~~a~gss~t~~s~l~~~  168 (741)
T KOG3515|consen   89 PMILDVDYPPACLPELGEIFQVDKGVVQIICSAKVAGRPNPNLRWGFNNRAELNAVNQRGRVGAGALGSSYTEPSLLKQT  168 (741)
T ss_pred             ceeeccccCccccccccchhhhcCCeEEEEEeecCCCCCCcceeeeeccEEeecccCCcccccccccCceeccccceeeE
Confidence                    00        01233667777774                                    000223457788


Q ss_pred             ccCCCCCeeeEEEEecCC
Q psy534          111 NIRSQDIGDYTCLATHVL  128 (145)
Q Consensus       111 ~v~~~d~G~Y~C~a~n~~  128 (145)
                      ..+.++.|.|+|.|.|..
T Consensus       169 v~Rka~~g~~tC~A~nr~  186 (741)
T KOG3515|consen  169 VSRKADNGNYTCPANNRN  186 (741)
T ss_pred             EEEecCCceeEccccccc
Confidence            888999999999999963


No 285
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins. Ig1_Nectin-3_like: domain similar to the first immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3). Nectin-3 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through -4). Nectins are synaptic cell adhesion molecules (CAMs) which participate in adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion. For example, during spermatid development, the nectin-3,-2 trans-interaction is required for the formation of Sertoli cell-spermatid junctions in testis, and during morphogenesis of the ciliary body, the nectin-3,-1 trans-interaction is important for apex-apex adhesion between the pigment and non-pigment layers of the ciliary epithelia. Nectins also
Probab=96.69  E-value=0.0021  Score=39.91  Aligned_cols=26  Identities=31%  Similarity=0.479  Sum_probs=22.3

Q ss_pred             CcEEEEcccCCCCCeeeEEEEec-CCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATH-VLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n-~~g  129 (145)
                      +.+|.|.+++.+|+|.|+|.+.+ +.|
T Consensus        59 d~sl~i~nv~~~D~G~Y~C~v~tfP~G   85 (96)
T cd05887          59 DATIMLENVGFSDIGVYICKAVTFPLG   85 (96)
T ss_pred             ccEEEEeCCCccccEEEEEEEEeCCCC
Confidence            45999999999999999999755 456


No 286
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins. Ig1_DNAM-1_like: domain similar to the first immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226). DNAM-1 is a transmembrane protein having two Ig-like domains. It is an adhesion molecule which plays a part in tumor-directed cytotoxicity and adhesion in natural killer (NK) cells and T lymphocytes. It has been shown to regulate the NK cell killing of several tumor types, including myeloma cells and ovarian carcinoma cells. DNAM-1 interacts specifically with poliovirus receptor (PVR; CD155) and nectin -2 (CD211), other members of the Ig superfamily. DNAM-1 is expressed in most peripheral T cells, NK cells, monocytes and a subset of B lymphocytes.
Probab=96.65  E-value=0.0023  Score=39.69  Aligned_cols=26  Identities=23%  Similarity=0.373  Sum_probs=22.4

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecC-CC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHV-LY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~-~g  129 (145)
                      +.+|.|.+|+.+|+|.|+|.+... .|
T Consensus        59 d~sI~i~nvt~~D~G~Y~C~~~t~P~g   85 (96)
T cd05889          59 DMSLSFNNATEEDVGLYCCSLVTYPQG   85 (96)
T ss_pred             ccEEEEcCCCcccCEEEEEEEEeCCCC
Confidence            348999999999999999998764 55


No 287
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1). Ig1_ IL1RAPL-1_like: domain similar to the first immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1).  IL-1 alpha and IL-1 beta are cytokines which participates in the regulation of inflammation, immune responses, and hematopoiesis. These cytokines bind to the IL-1 receptor type 1 (IL1R1), which is activated on additional association with an accessory protein, IL1RAP. IL-1 also binds a second receptor designated type II (IL1R2). Mature IL1R1 consists of three Ig-like domains, a transmembrane domain, and a large cytoplasmic domain. Mature IL1R2 is organized similarly except that it has a short cytoplasmic domain. The latter does not initiate signal transduction. A naturally occurring cytokine IL-1RA (IL-1 receptor antagonist) is widely expressed and binds to IL-1 receptors, inhibiting the binding of 
Probab=96.61  E-value=0.0025  Score=40.03  Aligned_cols=28  Identities=25%  Similarity=0.461  Sum_probs=24.6

Q ss_pred             cCCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          102 NDGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       102 ~~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..+..|.|.++..+|+|.|+|++.|.-.
T Consensus        67 ~~~~~Lwf~Pa~~eDSG~Y~C~~rN~t~   94 (104)
T cd05896          67 KEEDSIWFRPAELQDSGLYTCVLRNSTY   94 (104)
T ss_pred             EeCCEEEEEeCChhhCeEEEEEECCCCc
Confidence            3455899999999999999999999865


No 288
>smart00409 IG Immunoglobulin.
Probab=96.61  E-value=0.0035  Score=36.36  Aligned_cols=25  Identities=44%  Similarity=0.658  Sum_probs=23.0

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.+.+..+
T Consensus        51 ~~l~i~~~~~~d~G~Y~C~v~~~~~   75 (86)
T smart00409       51 STLTISNVTPEDSGTYTCAATNSSG   75 (86)
T ss_pred             eEEEEEeeccccCeEEEEEEEcCCC
Confidence            4799999999999999999998876


No 289
>smart00410 IG_like Immunoglobulin like. IG domains that cannot be classified into one of IGv1, IGc1, IGc2, IG.
Probab=96.61  E-value=0.0035  Score=36.36  Aligned_cols=25  Identities=44%  Similarity=0.658  Sum_probs=23.0

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|.+++.+|+|.|+|.+.+..+
T Consensus        51 ~~l~i~~~~~~d~G~Y~C~v~~~~~   75 (86)
T smart00410       51 STLTISNVTPEDSGTYTCAATNSSG   75 (86)
T ss_pred             eEEEEEeeccccCeEEEEEEEcCCC
Confidence            4799999999999999999998876


No 290
>cd00099 IgV Immunoglobulin variable domain (IgV). IgV: Immunoglobulin variable domain (IgV). Members of the IgV family are components of immunoglobulin (Ig) and T cell receptors. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. Within the variable domain, there are regions of even more variability called the hypervariable or complementarity-determining regions (CDRs) which are responsible for antigen binding. A predominant feature of most Ig domains is the disulfide bridge connecting 2 beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=96.60  E-value=0.0015  Score=40.55  Aligned_cols=26  Identities=23%  Similarity=0.289  Sum_probs=23.0

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..+|.|.+++.+|+|.|.|.+.+..+
T Consensus        66 ~~sL~I~~v~~~D~G~Y~C~v~~~~~   91 (105)
T cd00099          66 SFTLTISSLQPEDSAVYYCAVSLSGG   91 (105)
T ss_pred             EEEEEECCCCHHHCEEEEEEEecCCC
Confidence            34799999999999999999998765


No 291
>cd04983 IgV_TCR_alpha_like Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) alpha chain and similar proteins. IgV_TCR_alpha: immunoglobulin (Ig) variable domain of the alpha chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group represents the variable domain of the alpha chain of TCRs and also includes the variable domain of delta chains of TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=96.53  E-value=0.005  Score=38.48  Aligned_cols=26  Identities=23%  Similarity=0.247  Sum_probs=22.5

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ...|.|.+++.+|+|.|.|.+.+..+
T Consensus        69 ~~~L~I~~~~~~DsG~Y~C~~~~~~~   94 (109)
T cd04983          69 SSSLHISAAQLSDSAVYFCALSESGG   94 (109)
T ss_pred             EEEEEECCCCHHHCEEEEEEEecCCC
Confidence            34799999999999999999997643


No 292
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=96.51  E-value=0.016  Score=36.26  Aligned_cols=68  Identities=10%  Similarity=0.095  Sum_probs=41.1

Q ss_pred             hhccceeeEEeec-CCCccE--EEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCE-EEEEEEEEec
Q psy534            9 SIFQMLSVGDFAD-DEDIPV--YIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQG-WYECKVVFLN   81 (145)
Q Consensus         9 ~~~~~~~~~~w~~-g~p~p~--~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G-~Y~C~~~~~~   81 (145)
                      ..+..+.+.|.+. +.|.+.  +.||+++.......+.+    ..........+|.+. +.++|-| .|.|+|.+..
T Consensus        14 ~eG~~~tL~C~v~g~~P~a~L~i~W~rG~~~l~~~~~~~----~~~~~~~~~stlt~~-~~r~D~g~~~sC~A~l~l   85 (100)
T cd05755          14 PVGKNYTLQCDVPGVAPRQNLTVVLLRGNETLSRQPFGD----NTKSPVNAPATITIT-VDREDHGANFSCETELDL   85 (100)
T ss_pred             cCCCcEEEEEEEcCcCCCCcEEEEEeeCCEEcccceecc----ccCCCceeEEEEEEe-cchhhCCcEEEEEEEecc
Confidence            4567889999998 468776  69999985432211111    000011224556665 4455555 9999997543


No 293
>cd05766 IgC_MHC_II_beta Class II major histocompatibility complex (MHC) beta chain immunoglobulin domain. IgC_MHC_II_beta: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II beta chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosome be
Probab=96.50  E-value=0.014  Score=35.93  Aligned_cols=67  Identities=10%  Similarity=0.015  Sum_probs=38.6

Q ss_pred             hhhccceeeEEeecCC-Ccc-EEEEecCCCCcccccccceEEEecCCCCCCeeeEEEc---ccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDE-DIP-VYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLT---KIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~-p~p-~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~---~v~~~D~G~Y~C~~~~~   80 (145)
                      ..++.+..++|.+.|. |.. .++|++++...........  ...    .++++..+.   .+..++...|.|++.+.
T Consensus        11 ~~~~~~~~L~C~~~gFyP~~i~v~W~~~g~~~~~~~~~~~--~~~----~~dgTy~~~s~L~~~~~~~~~ysC~V~H~   82 (94)
T cd05766          11 GSLSHPHLLVCHVWGFYPPEITVKWFKNGQEETEGVVSTE--LIP----NGDWTYQILVMLETTPSRGDTYTCVVEHS   82 (94)
T ss_pred             ccCCCCeEEEEEEeeecCCCCEEEEEECCeecCCCceecc--eEE----CCCCcEEEEEEEEEcCCCCCEEEEEEEeC
Confidence            3456788999999984 655 7899999854222101111  111    223332221   33455677999999764


No 294
>PHA02633 hypothetical protein; Provisional
Probab=96.50  E-value=0.0053  Score=34.71  Aligned_cols=36  Identities=28%  Similarity=0.435  Sum_probs=27.8

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC-----CcEEEEeCe
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY-----PDLLVVLGS  138 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g-----~~~~v~~~~  138 (145)
                      ++..|-|-+...+|+|.|.|...|.--     .++.|..+.
T Consensus        16 ~~~nLwilpa~~sDSGiYiC~~rn~t~c~~~si~l~V~~~~   56 (63)
T PHA02633         16 NCNNMLILNPTQSDSGIYMCITKNETYSDMMKFDLCICLRI   56 (63)
T ss_pred             ccccEEEeccccccCcEEEEEEcCCCeeEEEEEEEEEeecc
Confidence            455789999999999999999998743     555555544


No 295
>cd05770 IgC_beta2m Class I major histocompatibility complex (MHC) beta2-microglobulin. IgC_beta2m: Immunoglobulin-like domain in beta2-Microglobulin (beta2m). Beta2m is the non-covalently bound light chain of the human class I major histocompatibility complex (MHC-I). Beta2m is structured as a beta-sandwich domain composed of two facing beta-sheets (four stranded and three stranded), that is typical of the C-type immunoglobulin superfamily. This structure is stabilized by an intramolecular disulfide bridge connecting two Cys residues in the facing beta -sheets. In vivo, MHC-I continuously exposes beta2m on the cell surface, where it may be released to plasmatic fluids, transported to the kidneys, degraded and then excreted.
Probab=96.45  E-value=0.012  Score=36.23  Aligned_cols=65  Identities=6%  Similarity=-0.154  Sum_probs=39.9

Q ss_pred             hhccceeeEEeecCC-C-ccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEc---ccCCCCCEEEEEEEEEe
Q psy534            9 SIFQMLSVGDFADDE-D-IPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLT---KIRESDQGWYECKVVFL   80 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~-p-~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~---~v~~~D~G~Y~C~~~~~   80 (145)
                      +.+.+..++|.+.|- | ...+.|.+++....  +..... .+.    .++++.++.   .+..++...|.|++.+.
T Consensus        13 ~~g~~~~L~C~a~gFyP~~i~v~W~~dg~~~~--~~~~~~-~~p----~~d~tyq~~s~l~~~~~~~~~ysC~V~H~   82 (93)
T cd05770          13 ENGKPNVLNCYVTGFHPPDIEIRLLKNGVKIP--KVEQSD-LSF----SKDWTFYLLKSTEFTPTKGDEYACRVRHN   82 (93)
T ss_pred             cCCCceEEEEEEEEEeCCCCEEEEEECCEECC--CcEECc-EEE----CCCCCEEEEEEEEECCCCCCeEEEEEEEC
Confidence            445566899999984 5 44689999985422  221111 111    234454442   34677888999999763


No 296
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain. IgC_Tapasin_R: Immunoglobulin-like domain on Tapasin-R. Tapasin is a V-C1 (variable-constant) immunoglobulin superfamily molecule present in the endoplasmic reticulum (ER), where it links MHC class I molecules to the transporter associated with antigen processing (TAP). Tapasin-R is a tapasin-related protein that contains similar structural motifs to Tapasin, with some marked differences, especially in the V domain, transmembrane and cytoplasmic regions. The majority of Tapasin-R is located within the ER; however, there may be some expression of Tapasin-R at the cell surface. Tapasin-R lacks an obvious ER retention signal.
Probab=96.44  E-value=0.029  Score=36.81  Aligned_cols=70  Identities=13%  Similarity=0.190  Sum_probs=38.3

Q ss_pred             hccceeeEEeecCC-Cc-cEEEEecCCCCccc-----cccc-ceEEEecCCCCCC-eeeEEEcccCCCCCEEEEEEEEEe
Q psy534           10 IFQMLSVGDFADDE-DI-PVYIWYDSYPTHEA-----EEYK-GRISRVDKESPFG-MASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        10 ~~~~~~~~~w~~g~-p~-p~~~w~k~~~~~~~-----~~~~-~R~~~~~~~~~~~-~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .+..+.+.|.+.|. |. +.+.|++++.....     .... ..... ..+.... ...|.|..-...+.+.|.|++.+.
T Consensus        52 ~~~~~~L~C~a~g~~P~~~~i~W~~~g~~~~~~~~~~~~~~~~~~~~-~~dgt~~~~s~L~v~~~~~~~g~~ytC~V~H~  130 (139)
T cd05771          52 IEEPQTLICHIAGYYPLDVQVEWTREPPGDSPPPVSLSNVSFSSHRQ-HQDGTYSLSSHLTLEPGTEDAGATYTCRVSHV  130 (139)
T ss_pred             cCCcEEEEEEECCCCCCCeEEEEEECCCCCccceeccCCeEecceEe-CCCCCEEEEEEEEecCCccCCCCEEEEEEEcC
Confidence            35667899999985 65 48999998742111     0100 00110 1111111 345566544445567999999754


No 297
>cd07703 Ig2_Nectin-2_like Second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112) and similar proteins. Ig2_Nectin-2_like: domain similar to the second immunoglobulin (Ig) domain of nectin-2 (also known as poliovirus receptor related protein 2 or CD112). Nectin-2 belongs to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.
Probab=96.36  E-value=0.016  Score=35.86  Aligned_cols=60  Identities=13%  Similarity=0.149  Sum_probs=36.7

Q ss_pred             ceeeEEeec-CCCccEEEEecCCCCcc----cccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           13 MLSVGDFAD-DEDIPVYIWYDSYPTHE----AEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        13 ~~~~~~w~~-g~p~p~~~w~k~~~~~~----~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      -....|++. |.|.+.|+|+++.....    .....+++..        ...|.+..-...|...|.|++.+.
T Consensus        17 ~~va~C~s~~gkPaa~IsW~~~~~g~~~~~~~~~~~gt~tv--------~S~l~~~P~~~d~Gk~ltC~v~h~   81 (95)
T cd07703          17 VPVAKCVSANGRPPARISWSSTLGGNANTTSKENGDGTVTV--------TSEYSLVPTPEANGKEVTCKVEHE   81 (95)
T ss_pred             cEEEEEEcCCCCCCcEEEEEcCCCCCeeEEEEeCCCCCEEE--------EEEEEEecCHHHCCCEEEEEEeCc
Confidence            345678887 78999999998832100    0111122222        445666655566666899999854


No 298
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig1_Necl-2: domain similar to the N-terminal immunoglobulin (Ig)-like domain of nectin-like molecule-2, Necl-2 (also known as cell adhesion molecule 1 (CADM1), SynCAM1, IGSF4A, Tslc1, sgIGSF, and RA175).  Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). They all have an extracellular region containing three Ig-like domains, a transmembrane region, and a cytoplasmic region. The N-terminal Ig-like domain of the extracellular region, belongs to the V-type subfamily of Ig domains, is essential to cell-cell adhesion, and plays a part in the interaction with the envelope glycoprotein D of various viruses. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-2 is expressed in a wide variety of tissues, and is a 
Probab=96.36  E-value=0.004  Score=38.55  Aligned_cols=23  Identities=26%  Similarity=0.392  Sum_probs=20.7

Q ss_pred             EEEEcccCCCCCeeeEEEEecCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVL  128 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~  128 (145)
                      +|.|.+++.+|+|.|+|.+....
T Consensus        63 tL~I~~vq~~D~G~Y~Cqv~t~p   85 (95)
T cd05881          63 RVSLSNVSLSDEGRYFCQLYTDP   85 (95)
T ss_pred             EEEECcCCcccCEEEEEEEEccc
Confidence            69999999999999999998654


No 299
>PHA02633 hypothetical protein; Provisional
Probab=96.36  E-value=0.0037  Score=35.32  Aligned_cols=24  Identities=21%  Similarity=0.326  Sum_probs=21.3

Q ss_pred             CeeeEEEcccCCCCCEEEEEEEEE
Q psy534           56 GMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        56 ~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ....|.|.++..+|+|.|.|.+.+
T Consensus        16 ~~~nLwilpa~~sDSGiYiC~~rn   39 (63)
T PHA02633         16 NCNNMLILNPTQSDSGIYMCITKN   39 (63)
T ss_pred             ccccEEEeccccccCcEEEEEEcC
Confidence            367799999999999999999963


No 300
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B. Ig_Sema4B_like; Immunoglobulin (Ig)-like domain of Sema4B_like. Sema4B is a Class IV semaphorin. Semaphorins are classified based on structural features additional to the Sema domain. Sema4B has extracellular Sema and Ig domains, a transmembrane domain and a short cytoplasmic domain. Sema4B has been shown to preferentially regulate the development of the postsynaptic specialization at the glutamatergic synapses. This cytoplasmic domain includes a PDZ-binding motif upon which the synaptic localization of Sem4B is dependent. Sema4B is a ligand of CLCP1, CLCP1 was identified in an expression profiling analysis, which compared a highly metastic lung cancer subline with its low metastic parental line. Sema4B was shown to promote CLCP1 endocytosis, and their interaction is a potential target for therapeutic intervention of metastasis.
Probab=96.32  E-value=0.012  Score=35.63  Aligned_cols=23  Identities=22%  Similarity=0.271  Sum_probs=20.0

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.|..++.+|+|.|.|.+. +.|
T Consensus        48 GLlI~~~~~~dsG~Y~C~s~-E~g   70 (85)
T cd05872          48 GLLILVTSPEHSGTYRCYSE-EEG   70 (85)
T ss_pred             CCEEEECCHhhCEEEEEEEe-cCC
Confidence            47899999999999999987 556


No 301
>cd07698 IgC_MHC_I_alpha3 Class I major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_I_alpha3;  Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class I alpha chain. Class I MHC proteins bind antigenic peptide fragments and present them to CD8+ T lymphocytes.  Class I molecules consist of a transmembrane alpha chain and a small chain called the beta2 microglobulin. The alpha chain contains three extracellular domains, two of which fold together to form the peptide-binding cleft (alpha1 and alpha2), and one which has an Ig fold (alpha3).  Peptide binding to class I molecules occurs in the endoplasmic reticulum (ER) and involves both chaperones and dedicated factors to assist in peptide loading.  Class I MHC molecules are expressed on most nucleated cells.
Probab=96.32  E-value=0.012  Score=36.00  Aligned_cols=64  Identities=16%  Similarity=0.172  Sum_probs=37.4

Q ss_pred             ccceeeEEeecCC-Ccc-EEEEecCCCCcccccccceEEEecCCCCCCeeeEE---EcccCCCCCEEEEEEEEEe
Q psy534           11 FQMLSVGDFADDE-DIP-VYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLN---LTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        11 ~~~~~~~~w~~g~-p~p-~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~---I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ...+.++|.+.|. |.. .+.|++++..............      .++++..   ...+..+|.+.|.|++.+.
T Consensus        14 ~~~~~L~C~a~gF~P~~i~v~W~~~g~~~~~~~~~~~~~~------~~d~ty~~~s~l~v~~~~~~~ytC~V~H~   82 (93)
T cd07698          14 DGSLTLSCHATGFYPRDIEVTWLRDGEDSVDDVESGEILP------NGDGTYQLWVTLEVPPEDKARYSCRVEHS   82 (93)
T ss_pred             CCcEEEEEEEEEEeCCCcEEEEEECCEECcccccccceEE------CCCCeEEEEEEEEECCCCCCEEEEEEEeC
Confidence            4567999999985 654 7899999742111111112211      1222222   2244556889999999764


No 302
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=96.22  E-value=0.024  Score=34.46  Aligned_cols=25  Identities=20%  Similarity=0.516  Sum_probs=21.7

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      .+.+|.+.++...|+|.++|.+...
T Consensus        49 ~~ktL~~~qv~~qdSG~WtC~V~~~   73 (88)
T cd07694          49 DKKTLNLVQLGPNDSGTWDCIVSVN   73 (88)
T ss_pred             CccEEEeceeCcccCCEEEEEEEEC
Confidence            4568999999999999999999654


No 303
>cd07694 Ig2_CD4 Second immunoglobulin (Ig) domain of CD4. Ig2_CD4; second immunoglobulin (Ig) domain of CD4.  CD4 and CD8 are the two primary co-receptor proteins found on the surface of T cells, and the presence of either CD4 or CD8 determines the function of the T cell.  CD4 is found on helper T cells, where it is required for the binding of MHC (major histocompatibility complex) class II molecules, while CD8 is found on cytotoxic T cells, where it is required for the binding of MHC class I molecules.  CD4 contains four immunoglobulin domains, with the first three included in this hierarchy.  The fourth domain has a general Ig architecture, but has slight topological changes in the arrangement of beta strands relative to the other structures in this family and is not specifically included in the hierarchy.
Probab=96.20  E-value=0.031  Score=34.00  Aligned_cols=56  Identities=16%  Similarity=0.178  Sum_probs=39.4

Q ss_pred             ccceeeEEeecCC--CccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEE
Q psy534           11 FQMLSVGDFADDE--DIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVV   78 (145)
Q Consensus        11 ~~~~~~~~w~~g~--p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~   78 (145)
                      +..+.+.|-....  |.+.+.|+.-+....        ..    ...+..+|.+..+...|+|.+.|.+.
T Consensus        14 G~sLtLtl~~~s~s~p~~~i~w~~P~n~~~--------~~----~~~~~ktL~~~qv~~qdSG~WtC~V~   71 (88)
T cd07694          14 GTNLTLTLHGSSNSLPAFKVEWRGPGNKSK--------QI----LNQDKKTLNLVQLGPNDSGTWDCIVS   71 (88)
T ss_pred             CCcEEEEEecCCCCCCCccEEEeCCCCccc--------ee----ccCCccEEEeceeCcccCCEEEEEEE
Confidence            4566777877643  455899976654311        11    11358889999999999999999996


No 304
>cd05899 IgV_TCR_beta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) bet a chain. IgV_TCR_beta: immunoglobulin (Ig) variable domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the alpha chain of alpha/beta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The variable domain of TCRs is responsible for antigen recognition, and is located at the N-terminus of the receptor.  Gamma/delta TCRs recognize intact protein antigens; they recognize proteins antigens directly and without antigen processing, and MHC independently of the bound peptide.
Probab=96.20  E-value=0.0073  Score=38.02  Aligned_cols=25  Identities=20%  Similarity=0.288  Sum_probs=22.1

Q ss_pred             CcEEEEcccCCCCCeeeEEEEecCC
Q psy534          104 GTELRISNIRSQDIGDYTCLATHVL  128 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~n~~  128 (145)
                      ...|.|.+++.+|+|.|+|.+.+..
T Consensus        71 ~~~L~I~~~~~~Dsg~Y~Ca~~~~~   95 (110)
T cd05899          71 RSSLTIKSAEPEDSAVYLCASSLGG   95 (110)
T ss_pred             ccEEEECCCChhhCEEEEEEeeCCC
Confidence            3479999999999999999998764


No 305
>cd05712 Ig_Siglec_N Immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Ig_Siglec_N: immunoglobulin (Ig) domain at the N terminus of Siglec (sialic acid-binding Ig-like lectins). Siglec refers to a structurally related protein family that specifically recognizes sialic acid in oligosaccharide chains of glycoproteins and glycolipids. Siglecs are type I transmembrane proteins, organized as an extracellular module composed of Ig-like domains (an N-terminal variable set of Ig-like carbohydrate recognition domains, and 1 to 16 constant Ig-like domains), followed by transmembrane and short cytoplasmic domains. Human siglecs are classified into two subgroups, one subgroup is comprised of sialoadhesin (Siglec-1), CD22 (Siglec-2), and MAG, the other subgroup is comprised of CD33-related Siglecs which include CD33 (Siglec-3) and human Siglecs 5-11.
Probab=96.20  E-value=0.0082  Score=38.47  Aligned_cols=33  Identities=18%  Similarity=0.113  Sum_probs=25.1

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCCCcEEEEeC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLYPDLLVVLG  137 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g~~~~v~~~  137 (145)
                      .+|.|.+++.+|+|.|.|.+...-+..+....|
T Consensus        80 ~sL~I~~l~~~Dsg~Y~C~~~~~~~~~~~f~~g  112 (119)
T cd05712          80 CSLLISDAQPEDSGKYFFRVELGDSNKYNFLKN  112 (119)
T ss_pred             EEEEEccCChhhCeEEEEEEEcCCccEEEecCC
Confidence            479999999999999999987654444444433


No 306
>cd05767 IgC_MHC_II_alpha Class II major histocompatibility complex (MHC) alpha chain immunoglobulin domain. IgC_MHC_II_alpha: Immunoglobulin (Ig) domain of major histocompatibility complex (MHC) class II alpha chain.  MHC class II molecules play a key role in the initiation of the antigen-specific immune reponse. In both humans and in mice these molecules have been shown to be expressed constitutively on the cell surface of professional antigen-presenting cells (APCs), for example on B-lymphocytes, monocytes, and macrophages. The expression of these molecules has been shown to be induced in nonprofessional APCs such as keratinocyctes, and they are expressed on the surface of activated human T cells and on T cells from other species. The MHC II molecules present antigenic peptides to CD4(+) T-lymphocytes. These peptides derive mostly from protelytic processing via the endocytic pathway, of antigens internalized by the APC. These peptides bind to the MHC class II molecules in the endosom
Probab=96.20  E-value=0.02  Score=35.31  Aligned_cols=66  Identities=12%  Similarity=0.038  Sum_probs=36.8

Q ss_pred             hhccceeeEEeecCC-Cc-cEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEc---ccCCCCCEEEEEEEEEe
Q psy534            9 SIFQMLSVGDFADDE-DI-PVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLT---KIRESDQGWYECKVVFL   80 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~-p~-p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~---~v~~~D~G~Y~C~~~~~   80 (145)
                      +...+..++|++.|- |. ..+.|.+++...........+  ..    .++++.++.   .+..++...|.|++.+.
T Consensus        13 ~~~~~~tL~C~a~gFyP~~I~v~W~~~g~~~~~~~~~~~~--~~----~~Dgty~~~s~L~v~~~~~~~ytC~V~H~   83 (94)
T cd05767          13 ELGEPNTLICFVDNFFPPVLNVTWLKNGVPVTDGVSETRY--YP----RQDLSFQKFSYLNFTPEEGDIYSCIVEHW   83 (94)
T ss_pred             cCCCCeEEEEEEEEEECCcCEEEEEECCeEccCceEEeee--Ee----CCCCcEEEEEEEEEECCCCCeEEEEEEeC
Confidence            344557899999984 54 568999988542211111111  11    223332221   33455677999999753


No 307
>PF07686 V-set:  Immunoglobulin V-set domain;  InterPro: IPR013106 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the V-set domains, which are Ig-like domains resembling the antibody variable domain. V-set domains are found in diverse protein families, including immunoglobulin light and heavy chains; in several T-cell receptors such as CD2 (Cluster of Differentiation 2), CD4, CD80, and CD86; in myelin membrane adhesion molecules; in junction adhesion molecules (JAM); in tyrosine-protein kinase receptors; and in the programmed cell death protein 1 (PD1).; PDB: 1PY9_A 2NXY_D 1U9K_B 3RNK_A 3BP6_A 3BIK_B 3SBW_A 1NPU_A 3BP5_A 3RNQ_A ....
Probab=96.05  E-value=0.0046  Score=38.42  Aligned_cols=23  Identities=30%  Similarity=0.579  Sum_probs=21.3

Q ss_pred             cEEEEcccCCCCCeeeEEEEecC
Q psy534          105 TELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      .+|.|.+++.+|+|.|.|.+...
T Consensus        79 ~sL~i~~l~~~DsG~Y~C~v~~~  101 (114)
T PF07686_consen   79 FSLTIKNLQPSDSGTYFCQVSTS  101 (114)
T ss_dssp             EEEEESSESGGGEEEEEEEEEES
T ss_pred             EEEEECCCCcCcCEEEEEEEEEC
Confidence            47999999999999999999876


No 308
>cd07704 Ig2_Nectin-3-4_like Second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3), nectin-4 (poliovirus receptor related protein 4) and similar proteins. Ig2_Nectin-3-4_like: domain similar to the second immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and nectin-4 (poliovirus receptor related protein 4). Nectin-3 and nectin-4 belong to the nectin family comprised of four transmembrane glycoproteins (nectins-1 through 4). Nectins are synaptic cell adhesion molecules (CAMs) which facilitate adhesion and signaling at various intracellular junctions. Nectins form homophilic cis-dimers, followed by homophilic and heterophilic trans-dimers involved in cell-cell adhesion.  Nectin-2 and nectin-3 localize at Sertoli-spermatid junctions where they form heterophilic trans-interactions between the cells that are essential for the formation and maintenance of the junctions and for spermatid development.  Nect
Probab=96.03  E-value=0.023  Score=35.32  Aligned_cols=66  Identities=11%  Similarity=0.014  Sum_probs=41.8

Q ss_pred             Hhhhccceee-EEeec-CCCccEEEEecCCCCcc----cccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534            7 VKSIFQMLSV-GDFAD-DEDIPVYIWYDSYPTHE----AEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         7 ~~~~~~~~~~-~~w~~-g~p~p~~~w~k~~~~~~----~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+.+.++.+ .|++. |.|++.|.|+.+..-..    .....+.+..        ...+.+..-+..|.-.+.|++.+.
T Consensus        12 ~~~~g~~~~vA~C~sa~gkPaa~IsW~~~~~G~~~~~~~~~~ngT~TV--------~S~~~l~p~r~d~G~~vtC~V~H~   83 (97)
T cd07704          12 LIDGGNGTTLAACCAAEGRPAADVTWETNVYGTSESHSQEHPNGTTTV--------TSEYIWVPSRHANGHPLTCVVSHP   83 (97)
T ss_pred             EeecCcceeEEEEEccCCccCCEeEEeCCCCCccceeeecCCCCCEEE--------EEEEEEEeCHHHCCcEEEEEEeCc
Confidence            3455666677 89887 88999999998732111    1111223332        455666666666777999999754


No 309
>cd05860 Ig4_SCFR Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR). Ig4_SCFR: The fourth Immunoglobulin (Ig)-like domain in stem cell factor receptor (SCFR). SCFR is organized as an extracellular component having five IG-like domains, a transmembrane segment, and a cytoplasmic portion having protein tyrosine kinase activity. SCFR and its ligand SCF are critical for normal hematopoiesis, mast cell development, melanocytes and gametogenesis. SCF binds to the second and third Ig-like domains of SCFR. This fourth Ig-like domain participates in SCFR dimerization, which follows ligand binding. Deletion of this fourth domain abolishes the ligand-induced dimerization of SCFR and completely inhibits signal transduction.
Probab=95.91  E-value=0.012  Score=36.88  Aligned_cols=25  Identities=24%  Similarity=0.456  Sum_probs=23.2

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.|..++.+|+|.|+|.|+|+..
T Consensus        65 S~L~L~Rlk~~E~G~YTf~a~N~~~   89 (101)
T cd05860          65 SELHLTRLKGTEGGTYTFLVSNSDA   89 (101)
T ss_pred             EEEEEeecChhhCcEEEEEEECCCC
Confidence            3799999999999999999999976


No 310
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=95.90  E-value=0.013  Score=42.56  Aligned_cols=50  Identities=18%  Similarity=0.326  Sum_probs=36.6

Q ss_pred             CCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           23 EDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        23 ~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      -..|.+.|...++..+..  .+++.+      -..++|.+.+.+.+++|.|+|.....
T Consensus        10 ~iDP~y~W~GP~g~~l~g--n~~~nI------T~TG~L~~~~F~esmSG~YTCtLsYk   59 (271)
T PF07354_consen   10 LIDPTYLWTGPNGKPLSG--NSYVNI------TETGKLMFKNFQESMSGSYTCTLSYK   59 (271)
T ss_pred             cCCCceEEECCCCcccCC--CCeEEE------ccCceEEeeccccccCCceEEEEEEE
Confidence            357899998776543332  235555      23788999999999999999998543


No 311
>cd05719 Ig2_PVR_like Second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins. Ig2_PVR_like: domain similar to the second immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155). Poliovirus (PV) binds to its cellular receptor (PVR/CD155) to initiate infection. CD155 is a membrane-anchored, single-span glycoprotein; its extracellular region has three Ig-like domains. There are four different isotypes of CD155 (referred to as alpha, beta, gamma, and delta), these result from alternate splicing of the CD155 mRNA, and have identical extracellular domains. CD155-beta and - gamma, are secreted, CD155-alpha and delta are membrane-bound and function as PV receptors. The virus recognition site is contained in the amino-terminal domain, D1. Having the virus attachment site on the receptor distal from the plasma membrane may be important for successful initiation of infection of cells by the virus. CD155 binds in the poliovirus 
Probab=95.88  E-value=0.039  Score=34.06  Aligned_cols=61  Identities=13%  Similarity=0.171  Sum_probs=35.8

Q ss_pred             cceeeEEeec-CCCccEEEEecCCCCccc----ccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFAD-DEDIPVYIWYDSYPTHEA----EEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~-g~p~p~~~w~k~~~~~~~----~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .-....|.+. |.|.+.|+|+++......    ....+.+..        ...|.+..-...|.-.|.|++.+.
T Consensus        16 ~~~va~C~s~~gkP~a~ItW~~~~~~~~~~~~~~~~~g~~tv--------~S~l~~~p~~~d~G~~~tC~v~h~   81 (95)
T cd05719          16 PVTVATCVSANGKPPATISWETTLGGEAETQSKENPNGTVTV--------TSEYRLVPSREANGKELTCVVSHP   81 (95)
T ss_pred             ccEEEEEECCCCcCCCEEEEEeCCCCcceeEeecCCCCCEEE--------EEEEEEecCHHHCCCEEEEEEeCc
Confidence            3445668886 889999999997211000    001111211        345666555555666899999754


No 312
>cd04984 IgV_L_lambda Immunoglobulin (Ig) lambda light chain variable (V) domain. IgV_L_lambda: Immunoglobulin (Ig) light chain, lambda type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=95.83  E-value=0.0084  Score=36.91  Aligned_cols=23  Identities=30%  Similarity=0.495  Sum_probs=20.5

Q ss_pred             cEEEEcccCCCCCeeeEEEEecC
Q psy534          105 TELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      ..|.|.+++.+|+|.|.|.+.+.
T Consensus        63 ~~L~I~~~~~~Dsg~Y~C~~~~~   85 (98)
T cd04984          63 ASLTISGAQTEDEADYYCQVWDS   85 (98)
T ss_pred             EEEEECCCChhhCEEEEEEEccC
Confidence            46999999999999999998754


No 313
>smart00406 IGv Immunoglobulin V-Type.
Probab=95.79  E-value=0.0043  Score=36.26  Aligned_cols=20  Identities=45%  Similarity=0.820  Sum_probs=17.9

Q ss_pred             cEEEEcccCCCCCeeeEEEE
Q psy534          105 TELRISNIRSQDIGDYTCLA  124 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a  124 (145)
                      .+|.|.+++.+|+|.|.|.+
T Consensus        62 ~~L~i~~~~~~D~G~Y~C~v   81 (81)
T smart00406       62 VSLTISNLRVEDTGTYYCAV   81 (81)
T ss_pred             EEEEEcCCCHHHCEEEEEcC
Confidence            47999999999999999963


No 314
>cd04980 IgV_L_kappa Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. IgV_L_kappa: Immunoglobulin (Ig) light chain, kappa type, variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=95.73  E-value=0.0066  Score=37.96  Aligned_cols=23  Identities=26%  Similarity=0.398  Sum_probs=20.4

Q ss_pred             cEEEEcccCCCCCeeeEEEEecC
Q psy534          105 TELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      ..|.|.+++.+|+|.|.|.+.+.
T Consensus        71 ~~L~I~~~~~~Dsg~Y~Ca~~~~   93 (106)
T cd04980          71 FTLTISRVEPEDAAVYYCQQYGT   93 (106)
T ss_pred             EEEEECCCChHHCEEEEEEEeCC
Confidence            36999999999999999998764


No 315
>cd05711 Ig_FcalphaRI Immunoglobulin (IG)-like domain of of FcalphaRI. IG_FcalphaRI : immunoglobulin (IG)-like domain of of FcalphaRI. FcalphaRI (CD89) is an IgA-specific receptor that is expressed on monocytes, eosinophils, neutrophils and macrophages. FcalphaRI mediates IgA-induced immune effector responses such as phagocytosis, antibody-dependent cell-mediated cytotoxicity and respiratory burst. Both monomeric and dimeric IgA can bind to FcalphaRI, and monomeric or dimeric IgA immune complexes can activate phagocytosis and other immune responses through the clustering of FcalphaRI. The Fc RI ectodomain is comprised of two Ig-like domains oriented at about 90 degree to each another.
Probab=95.65  E-value=0.026  Score=34.64  Aligned_cols=20  Identities=15%  Similarity=0.567  Sum_probs=17.8

Q ss_pred             EEEEcccCCCCCeeeEEEEe
Q psy534          106 ELRISNIRSQDIGDYTCLAT  125 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~  125 (145)
                      .+.|..++.+|+|.|.|...
T Consensus        56 ~f~I~~~~~~~~G~Y~C~~~   75 (94)
T cd05711          56 SFPLGPVTPAHAGTYRCYGS   75 (94)
T ss_pred             EEEecCCCcccCEEEEEEEE
Confidence            46899999999999999964


No 316
>cd05716 Ig_pIgR Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). Ig_pIgR: Immunoglobulin (Ig)-like domain in the polymeric Ig receptor (pIgR). pIgR delivers dimeric IgA and pentameric IgM to mucosal secretions. Polymeric immunoglobulin (pIgs) are the first defense against pathogens and toxins. IgA and IgM can form polymers via an 18-residue extension at their c-termini referred to as the tailpiece. pIgR transports pIgs across mucosal epithelia into mucosal secretions. Human pIgR is a glycosylated type I transmembrane protein, comprised of a 620 residue extracellular region, a 23 residue transmembrane region, and a 103 residue cytoplasmic tail. The extracellular region contains five domains that share sequence similarity with Ig variable (v) regions.
Probab=95.60  E-value=0.0071  Score=37.17  Aligned_cols=24  Identities=21%  Similarity=0.304  Sum_probs=21.3

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVL  128 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~  128 (145)
                      ..|.|.+++.+|+|.|.|.+....
T Consensus        64 ~~L~I~~v~~~DsG~Y~C~~~~~~   87 (98)
T cd05716          64 FTVTLNQLRKEDAGWYWCGVGDDG   87 (98)
T ss_pred             EEEEEcCCCHHHCEEEEEEcccCC
Confidence            379999999999999999988754


No 317
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Ig2_Necl-4: second immunoglobulin (Ig)-like domain of nectin-like molecule-4  (Necl-4, also known as cell adhesion molecule 4 (CADM4)). Nectin-like molecules have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1-Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Ig domains are likely to participate in ligand binding and recognition. Necl-4 is expressed on Schwann cells, and plays a key part in initiating peripheral nervous system (PNS) myelination.  In injured peripheral nerve cells, the mRNA signal for both Necl-4 and Necl-5 was observed to be elevated.  Necl-4 participates in cell-cell adhesion and is proposed to play a role in tumor suppression.
Probab=95.40  E-value=0.015  Score=34.75  Aligned_cols=24  Identities=25%  Similarity=0.314  Sum_probs=22.0

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +|.+......|.+.|+|+|.|+++
T Consensus        44 ~L~~~~~~~Ddg~~~~C~A~n~a~   67 (80)
T cd05885          44 TIRFPVDRKDDGAILSCEASHPAL   67 (80)
T ss_pred             EEEEEeeeccCCcEEEEEEEChhh
Confidence            689988889999999999999987


No 318
>PF08205 C2-set_2:  CD80-like C2-set immunoglobulin domain ;  InterPro: IPR013162 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents the C2-set type domains found in the T-cell antigen CD80, as well as in related proteins. CD80 (B7-1) is a glycoprotein expressed on antigen-presenting cells []. The shared ligands on CD80 and CD86 (B7-2) deliver the co-stimulatory signal through CD28 and CTLA-4 on T-cells, where CD28 augments the T-cell response and CTLA-4 attenuates it [].; PDB: 3S58_A 3O3U_N 3CJJ_A 3S59_A 2PF6_B 2PET_A 3ALP_A 3SKU_D 3U83_A 3U82_B ....
Probab=95.38  E-value=0.077  Score=31.81  Aligned_cols=68  Identities=18%  Similarity=0.155  Sum_probs=38.2

Q ss_pred             ccceeeEEeec-CCCccEEEEecCCCCcccccccceEEEecCCCCC-CeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           11 FQMLSVGDFAD-DEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPF-GMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        11 ~~~~~~~~w~~-g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~-~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +..+.+.|-+. |.|.|.++|+.++.......  ........+... -...|.+..-...+...+.|++.+.
T Consensus        14 ~~~~~~~C~s~~~~P~~~i~W~~~~~~~~~~~--~~~~~~~~~~~~~~~S~l~~~~~~~~~~~~~~C~~~~~   83 (89)
T PF08205_consen   14 GEEVTLTCSSSGGYPPPQITWYLDGGPVVASN--TTQSSSPDNGLFTVSSTLTLTPTREDHGKTLTCRASHP   83 (89)
T ss_dssp             TEEEEEEEEEEEEBS-EEEEEEETTCEECEEE--EEEEEETTTTTEEEEEEEEEETTGGGTTEEEEEEEEET
T ss_pred             ceEEEEEEEeCCeECCeEEEEEECCCceeeee--eeeeeccCCCcceEEEEEEEEcChHHCCeEEEEEEECC
Confidence            45778889766 78999999999986431111  111111111111 1345666544455667889999764


No 319
>cd04982 IgV_TCR_gamma Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) gamma chain. IgV_TCR_gamma: immunoglobulin (Ig) variable (V) domain of the gamma chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=95.22  E-value=0.014  Score=36.97  Aligned_cols=23  Identities=26%  Similarity=0.458  Sum_probs=20.5

Q ss_pred             cEEEEcccCCCCCeeeEEEEecC
Q psy534          105 TELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      ..|+|.+++.+|+|.|.|.+...
T Consensus        77 ~~L~I~~~~~~Dsg~Y~C~~~~~   99 (116)
T cd04982          77 STLTIQNLEKEDSATYYCAYWES   99 (116)
T ss_pred             EEEEEEECCHHHCEEEEEEEecC
Confidence            47999999999999999998753


No 320
>PHA03376 BARF1; Provisional
Probab=95.12  E-value=0.03  Score=38.99  Aligned_cols=25  Identities=16%  Similarity=0.119  Sum_probs=22.2

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      -+|.|.+++.+|.|.|+|..+-...
T Consensus        87 vsLvI~~l~lSDdGtY~C~fQkge~  111 (221)
T PHA03376         87 FFLVVTAANISHDGNYLCRMKLGET  111 (221)
T ss_pred             EEEEEEeeeecCCceEEEEEEcCCC
Confidence            4789999999999999999998764


No 321
>cd07699 IgC_L Immunoglobulin Constant domain. IgC_L: Immunoglobulin (Ig) light chain constant (C) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin:  IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which seem to be functionally identical, and can associate with any of the heavy chains.
Probab=95.11  E-value=0.071  Score=33.13  Aligned_cols=69  Identities=14%  Similarity=0.166  Sum_probs=36.8

Q ss_pred             ccceeeEEeecC-CC-ccEEEEecCCCCcccccccceEEEecCCCCCC-eeeEEEcccCCCCCEEEEEEEEEe
Q psy534           11 FQMLSVGDFADD-ED-IPVYIWYDSYPTHEAEEYKGRISRVDKESPFG-MASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        11 ~~~~~~~~w~~g-~p-~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~-~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..++.++|++.| .| ...+.|++++.... .+..........+.... ...|.+..-.-.+...|.|++.+.
T Consensus        17 ~~~~~L~C~~~gfyP~~i~v~W~~~g~~~~-~~~~~~~~~~~~dgty~~~s~L~v~~~~w~~~~~~sC~V~H~   88 (100)
T cd07699          17 SGKATLVCLINDFYPGFATVQWKVDGATVS-SGVQTSTTEQQSDNTYSLSSYLTLTKSDWNKHKVYTCEVTHE   88 (100)
T ss_pred             CCCcEEEEEEEeEECCCCEEEEEECCEECc-ccEeccccEECCCCCEEEEEEEEEcHHHhCCCCeEEEEEEec
Confidence            567899999997 45 55789999885421 11111011111111111 233334333333467999999764


No 322
>cd05720 Ig_CD8_alpha Immunoglobulin (Ig) like domain of CD8 alpha chain. Ig_CD8_alpha: immunoglobulin (Ig)-like domain in CD8 alpha. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alphaalpha or alphabeta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a v-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain. The Ig domain of CD8 alpha binds to antibodies.
Probab=94.91  E-value=0.016  Score=36.20  Aligned_cols=22  Identities=23%  Similarity=0.448  Sum_probs=19.7

Q ss_pred             cEEEEcccCCCCCeeeEEEEec
Q psy534          105 TELRISNIRSQDIGDYTCLATH  126 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n  126 (145)
                      ..|.|.+++.+|+|.|.|.+.+
T Consensus        69 ~~L~I~~~~~sDsgtY~Ca~~~   90 (104)
T cd05720          69 FVLTLKNFQKENEGYYFCSVAS   90 (104)
T ss_pred             EEEEECCCCHHHCEEEEEEEcc
Confidence            3799999999999999998764


No 323
>cd07706 IgV_TCR_delta Immunoglobulin (Ig) variable (V) domain of T-cell receptor (TCR) delta chain. IgV_TCR_delta: immunoglobulin (Ig) variable (V) domain of the delta chain of gamma/delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha/beta TCRs but a small subset contain gamma/delta TCRs. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma/delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma/delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds. The variable domain of gamma/delta TCRs is responsible for antigen recognition and is
Probab=94.83  E-value=0.018  Score=36.57  Aligned_cols=22  Identities=27%  Similarity=0.501  Sum_probs=20.2

Q ss_pred             cEEEEcccCCCCCeeeEEEEec
Q psy534          105 TELRISNIRSQDIGDYTCLATH  126 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n  126 (145)
                      .+|+|.+++.+|+|.|.|.+..
T Consensus        72 ~sL~I~~~~~~Dsg~Y~C~~~~   93 (116)
T cd07706          72 ISLTISALQLEDSAKYFCALST   93 (116)
T ss_pred             EEEEECCCCHHHCEEEEEEEEC
Confidence            4799999999999999999985


No 324
>cd00096 Ig Immunoglobulin domain. Ig: immunoglobulin (Ig) domain found in the Ig superfamily. The Ig superfamily is a heterogenous group of proteins, built on a common fold comprised of a sandwich of two beta sheets. Members of this group are components of immunoglobulin, neuroglia, cell surface glycoproteins, such as, T-cell receptors, CD2, CD4, CD8, and membrane glycoproteins, such as, butyrophilin and chondroitin sulfate proteoglycan core protein. A predominant feature of most Ig domains is a disulfide bridge connecting the two beta-sheets with a tryptophan residue packed against the disulfide bond.
Probab=94.77  E-value=0.037  Score=30.13  Aligned_cols=24  Identities=42%  Similarity=0.746  Sum_probs=21.4

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVL  128 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~  128 (145)
                      ..|.|.+++.+|.|.|.|.+.+..
T Consensus        43 ~~l~i~~~~~~d~g~y~C~~~~~~   66 (74)
T cd00096          43 STLTISNVTLEDSGTYTCVASNSA   66 (74)
T ss_pred             EEEEECccCcccCcEEEEEEecCc
Confidence            378999999999999999998875


No 325
>cd07700 IgV_CD8_beta Immunoglobulin (Ig) like domain of CD8 beta chain. IgV_CD8_beta: immunoglobulin (Ig)-like domain in CD8 beta. The CD8 glycoprotein plays an essential role in the control of T-cell selection, maturation and the T-cell receptor (TCR)-mediated response to peptide antigen. CD8 is comprised of alpha and beta subunits and is expressed as either an alpha/alpha or alpha/beta dimer. Both dimeric isoforms can serve as a coreceptor for T cell activation and differentiation, however they have distinct physiological roles, different cellular distributions, unique binding partners etc. Each CD8 subunit is comprised of an extracellular domain containing a V-type Ig-like domain, a single pass transmembrane portion and a short intracellular domain.
Probab=94.68  E-value=0.022  Score=35.74  Aligned_cols=21  Identities=29%  Similarity=0.741  Sum_probs=19.1

Q ss_pred             EEEEcccCCCCCeeeEEEEec
Q psy534          106 ELRISNIRSQDIGDYTCLATH  126 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n  126 (145)
                      .|+|.+++.+|+|.|.|...+
T Consensus        73 ~L~I~~~~~~Dsg~YyCa~~~   93 (107)
T cd07700          73 RLHINRVKPEDSGTYFCMTVG   93 (107)
T ss_pred             EEEECCCCHHHCEEEEEeEcC
Confidence            699999999999999999763


No 326
>cd05847 IgC_CH2_IgE CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin E (IgE). IgC_CH2_IgE: The second constant domain of the heavy chain of immunoglobulin E (IgE). The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma, and mu, all consisting of a variable domain (VH) and three (in alpha, delta, and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). The different classes of antibodies vary in their heavy chains; the IgE class has the epsilon type. This domain (Cepsilon2) of IgE is in place of the flexible hinge region found in IgG.
Probab=94.68  E-value=0.12  Score=31.74  Aligned_cols=68  Identities=15%  Similarity=0.099  Sum_probs=35.2

Q ss_pred             cceeeEEeecCC-Cc-cEEEEecCCCCcccccccceEEEecCCCCCC-eeeEEEcccCCCCCEEEEEEEEEe
Q psy534           12 QMLSVGDFADDE-DI-PVYIWYDSYPTHEAEEYKGRISRVDKESPFG-MASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        12 ~~~~~~~w~~g~-p~-p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~-~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .++.+.|.+.|- |. ..+.|++++............ ...++.... ...|.+..-.-.+...|.|++.+.
T Consensus        15 ~~~~L~C~a~gFyP~~I~vtW~~dg~~~~~~~~~s~~-~~~~~~Ty~~~S~L~v~~~~w~~~~~ytC~V~H~   85 (94)
T cd05847          15 ETIQLLCLISGYTPGTIEVEWLVDGQVATLVAASTAP-QKEEGSTFSTTSELNVTQEDWKSGKTYTCKVTHQ   85 (94)
T ss_pred             CCEEEEEEEEeEECCCCEEEEEECCEECcCceeeccc-EECCCCcEEEEEEEEEchHHhcCCCeEEEEEEEC
Confidence            457899999984 54 568999987542111111111 111111111 233434422223567999999753


No 327
>cd05772 IgC_SIRP Signal-regulatory protein (SIRP) immunoglobulin-like domain. IgC_SIRP: Immunoglobulin-like domain of signal-regulatory proteins (SIRP); the signal-regulatory proteins (SIRP) are Ig-like cell surface receptors detected in hematopoietic and non-hematopoietic cells. While their extracellular domains are similar, SIRP are classified as alpha or beta based on the length of the intracytoplasmic domain.  Those having a 110- to 113-amino acid tail are classified as SIRP-alpha, and those having a 5-amino acid tail as SIRP-beta. SIRP-alpha and SIRP-beta molecules are thought to have complementary roles in signal regulation:  SIRP-alpha inhibit signalling via their immunoreceptor tyrosine (IT)-based inhibition motifs while SIRP-beta are activating.  SIRP-beta lack the cytoplasmic domainof SIRP-alpha, and associate with at least one other transmembrane protein (DAP-12 or KARAP). The IT-based activation motifs within DAP-12's cytoplasmic domain may link SIRP-beta to the activating 
Probab=94.14  E-value=0.34  Score=30.79  Aligned_cols=67  Identities=15%  Similarity=0.154  Sum_probs=36.6

Q ss_pred             hccceeeEEeecC-CCc-cEEEEecCCCCcccccccceEEEecCCC-CCC-eeeEEEcccCCCCCE-EEEEEEEEe
Q psy534           10 IFQMLSVGDFADD-EDI-PVYIWYDSYPTHEAEEYKGRISRVDKES-PFG-MASLNLTKIRESDQG-WYECKVVFL   80 (145)
Q Consensus        10 ~~~~~~~~~w~~g-~p~-p~~~w~k~~~~~~~~~~~~R~~~~~~~~-~~~-~~sL~I~~v~~~D~G-~Y~C~~~~~   80 (145)
                      .+.+..++|++.| .|. ..+.|++|+.... ... ... ....+. ... ...|.+. ....|.| .|.|++.+.
T Consensus        20 ~g~~~tL~C~a~gF~P~~i~v~W~kng~~~~-~~~-~~~-~p~~d~~ty~~~S~L~~~-~~~~d~~~~ytC~V~H~   91 (111)
T cd05772          20 PGQSVNFTCSAHGFSPRDITVKWLKNGNELS-AEQ-PNI-TPEGDSVSYNVTSTVQVK-LTEDDVHSQVTCEVQHR   91 (111)
T ss_pred             CCCCEEEEEEEeeEeCCCCEEEEEECCEECc-ccc-cce-eeCCCCCcEEEEEEEEEE-CccccccCceEEEEEeC
Confidence            4556789999997 464 6899999985422 111 111 111110 011 2334444 3455554 499999764


No 328
>PF07654 C1-set:  Immunoglobulin C1-set domain;  InterPro: IPR003597 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C1-set domains, which are classical Ig-like domains resembling the antibody constant domain. C1-set domains are found almost exclusively in molecules involved in the immune system, such as in immunoglobulin light and heavy chains, in the major histocompatibility complex (MHC) class I and II complex molecules [, ], and in various T-cell receptors.; PDB: 3BVN_D 3BXN_A 3PWV_E 3L9R_F 2XFX_B 1BMG_A 1K8I_A 3M1B_G 3M17_C 1EXU_A ....
Probab=93.73  E-value=0.17  Score=30.04  Aligned_cols=69  Identities=10%  Similarity=0.134  Sum_probs=38.2

Q ss_pred             hhhccceeeEEeecCC-Ccc-EEEEecCCCCcccccccceEEEecCCCCCC-eeeEEEcccCCCCCEEEEEEEEEe
Q psy534            8 KSIFQMLSVGDFADDE-DIP-VYIWYDSYPTHEAEEYKGRISRVDKESPFG-MASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus         8 ~~~~~~~~~~~w~~g~-p~p-~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~-~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..+...+.+.|.+.|. |.. .+.|++++........... .....+.... ...|.+.   ..+...|.|++.+.
T Consensus         5 ~~~~~~~~L~C~v~~f~P~~i~v~W~~~~~~~~~~~~~~~-~~~~~dgty~~~s~l~v~---~~~~~~ysC~V~H~   76 (83)
T PF07654_consen    5 EELGGSVTLTCLVSGFYPKDITVTWLKNGKEVTEGVETTP-PPPNSDGTYSVTSSLTVT---WNSGDEYSCRVTHE   76 (83)
T ss_dssp             HHSTSEEEEEEEEEEEBSSTEEEEEEETTEEETTTEEEEE-EEEETTSEEEEEEEEEEE---TTTTGGEEEEEEET
T ss_pred             ccCCCCEEEEEEEEEEECCCcEEEEEeccceeeeeeeecc-cccccccceeeeEEEEec---CCCCCEEEEEEEEC
Confidence            4457888999999974 655 5899998753221111111 1111101111 3334444   55566899999764


No 329
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain. Ig_CD3_epsilon; immunoglobulin (Ig)-like domain of CD3 epsilon chain. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=93.72  E-value=0.13  Score=29.40  Aligned_cols=38  Identities=18%  Similarity=0.135  Sum_probs=25.9

Q ss_pred             CCcEEEEEEeE------Ee-------cCCcEEEEcccCCCCCeeeEEEEecC
Q psy534           89 NGTWFHLDVHG------VF-------NDGTELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus        89 ~g~~~~l~c~~------~~-------~~~~~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      .|..|+|+|+.      +.       ..+..+.+.+-. ++.|.|.|.+.+.
T Consensus         6 sGTtVtlTCP~~~~~i~W~~n~~~~~g~~~~~~~~~~~-e~~G~Y~C~~~~~   56 (65)
T cd07692           6 SGTTVTVTCPLSGDDIKWKKNDQVSQGSDEKYLSLNHF-SSSGYYHCTADNA   56 (65)
T ss_pred             eccEEEEECCCCCCCceEEeCCccCCCCCceEEeeccC-CCCceEEEEeCCC
Confidence            57889999971      11       122345556666 8899999999754


No 330
>cd07697 IgC_TCR_gamma T cell receptor (TCR) gamma chain constant immunoglobulin domain. IgC_TCR_gamma;  immunoglobulin (Ig) constant (C) domain of the gamma chain of gamma-delta T-cell receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are heterodimers consisting of alpha and beta chains or gamma and delta chains.  Each chain contains a variable (V) and a constant (C) region. The majority of T cells contain alpha-beta TCRs but a small subset contain gamma-delta TCRs. Alpha-beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. Gamma-delta TCRs recognize intact protein antigens; they recognize protein antigens directly and without antigen processing, and MHC independently of the bound peptide. Gamma-delta T cells can also be stimulated by non-peptide antigens such as small phosphate- or amine-containing compounds.
Probab=93.59  E-value=0.26  Score=30.50  Aligned_cols=26  Identities=4%  Similarity=-0.101  Sum_probs=19.5

Q ss_pred             ccceeeEEeecCC-C-ccEEEEecCCCC
Q psy534           11 FQMLSVGDFADDE-D-IPVYIWYDSYPT   36 (145)
Q Consensus        11 ~~~~~~~~w~~g~-p-~p~~~w~k~~~~   36 (145)
                      ..+..++|.+.|- | ...+.|.+++..
T Consensus        16 ~~~~tL~C~a~gFyP~~I~v~W~kng~~   43 (96)
T cd07697          16 QGQGIYLCLLENFFPDVIQVHWREGNSP   43 (96)
T ss_pred             CCCEEEEEEEEEEeCCCeEEEEEECCEE
Confidence            3467999999984 5 445899999854


No 331
>cd05759 Ig2_KIRREL3-like Second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). Ig2_KIRREL3-like: domain similar to the second immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2). This protein has five Ig-like domains, one transmembrane domain, and a cytoplasmic tail. Included in this group is mammalian Kirrel (Neph1), Kirrel2 (Neph3), and Drosophila RST (irregular chiasm C-roughest) protein. These proteins contain multiple Ig domains, have properties of cell adhesion molecules, and are important in organ development.
Probab=93.37  E-value=0.085  Score=31.16  Aligned_cols=24  Identities=21%  Similarity=0.250  Sum_probs=19.4

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.+.....+|.|.|+|.|.|...
T Consensus        47 ~L~i~~~~~~~~~~y~C~a~n~~l   70 (82)
T cd05759          47 TLPITPSDHDTGRTFTCRARNEAL   70 (82)
T ss_pred             EEEEeCceecCCCEEEEEEcCccC
Confidence            577777777788999999999764


No 332
>PHA02987 Ig domain OX-2-like protein; Provisional
Probab=93.26  E-value=0.078  Score=36.78  Aligned_cols=24  Identities=29%  Similarity=0.575  Sum_probs=20.6

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEec
Q psy534          103 DGTELRISNIRSQDIGDYTCLATH  126 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n  126 (145)
                      ....|+|.+++++|+|.|+|...-
T Consensus        83 ~~StItIknVt~sDeGcY~C~F~t  106 (189)
T PHA02987         83 NESTILIKNVSLKDNGCYTCIFNT  106 (189)
T ss_pred             CcceEEEEeCChhhCeEEEEEEEe
Confidence            345899999999999999998653


No 333
>cd07692 Ig_CD3_epsilon Immunoglobulin (Ig)-like domain of CD3 epsilon chain. Ig_CD3_epsilon; immunoglobulin (Ig)-like domain of CD3 epsilon chain. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=93.12  E-value=0.34  Score=27.74  Aligned_cols=48  Identities=15%  Similarity=0.176  Sum_probs=27.9

Q ss_pred             ccceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEE
Q psy534           11 FQMLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVV   78 (145)
Q Consensus        11 ~~~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~   78 (145)
                      ++-|.+.|-.....   +.|++++....  .              ....+.+.+-. +++|.|.|.+.
T Consensus         7 GTtVtlTCP~~~~~---i~W~~n~~~~~--g--------------~~~~~~~~~~~-e~~G~Y~C~~~   54 (65)
T cd07692           7 GTTVTVTCPLSGDD---IKWKKNDQVSQ--G--------------SDEKYLSLNHF-SSSGYYHCTAD   54 (65)
T ss_pred             ccEEEEECCCCCCC---ceEEeCCccCC--C--------------CCceEEeeccC-CCCceEEEEeC
Confidence            45566667544222   88999974311  1              02223333444 89999999874


No 334
>cd05768 IgC_CH4 CH4 domain (fourth constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH4: The fourth immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=93.08  E-value=0.49  Score=29.50  Aligned_cols=27  Identities=4%  Similarity=0.046  Sum_probs=20.7

Q ss_pred             hccceeeEEeecCC-Ccc-EEEEecCCCC
Q psy534           10 IFQMLSVGDFADDE-DIP-VYIWYDSYPT   36 (145)
Q Consensus        10 ~~~~~~~~~w~~g~-p~p-~~~w~k~~~~   36 (145)
                      .+..+.++|++.|. |.. .+.|++++..
T Consensus        15 ~~~~~tL~C~a~gFyP~~i~v~W~k~g~~   43 (102)
T cd05768          15 LQETATLTCLVKGFSPSDIFVKWLQNGQP   43 (102)
T ss_pred             cCCceEEEEEEeeEeCCCCEEEEEECCEE
Confidence            35678999999984 544 5799999754


No 335
>cd04981 IgV_H Immunoglobulin (Ig) heavy chain (H), variable (V) domain. IgV_H: Immunoglobulin (Ig) heavy chain (H), variable (V) domain. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. In Ig, each chain is composed of one variable domain (IgV) and one or more constant domains (IgC); these names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. There are five types of heavy chains (alpha, gamma, delta, epsilon, and mu), which determine the type of immunoglobulin: IgA, IgG, IgD, IgE, and IgM, respectively. In higher vertebrates, there are two types of light chain, designated kappa and lambda, which can associate with any of the heavy chains. This family includes alpha, gamma, delta, epsilon, and mu heavy chains.
Probab=92.67  E-value=0.077  Score=33.90  Aligned_cols=21  Identities=19%  Similarity=0.420  Sum_probs=19.4

Q ss_pred             EEEEcccCCCCCeeeEEEEec
Q psy534          106 ELRISNIRSQDIGDYTCLATH  126 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n  126 (145)
                      .|.|.++..+|+|.|.|.+..
T Consensus        77 ~L~I~~~~~~Dsa~YyCa~~~   97 (117)
T cd04981          77 YLQLNSLTPEDTAVYYCARGL   97 (117)
T ss_pred             EEEECCCCHHHCEEEEEEEEc
Confidence            699999999999999998865


No 336
>KOG3515|consensus
Probab=92.66  E-value=0.57  Score=39.22  Aligned_cols=38  Identities=21%  Similarity=0.048  Sum_probs=26.4

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCCCcEEEEeCeeEEec
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLYPDLLVVLGSFHIHT  143 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g~~~~v~~~~~~~~~  143 (145)
                      .+.+.++.+.|.|.|.|.|.|..|.......+.++.+|
T Consensus       459 ~~s~~~v~~~d~g~y~~tatns~gg~~~~~~~~~~~sp  496 (741)
T KOG3515|consen  459 LGSGVNVSRSDGGSYGLTATNSPGGAQAYLLLGVHTSP  496 (741)
T ss_pred             ccccceeeeccCCcceeeeccCCCceeeEEeeccccCC
Confidence            44466789999999999999999833333334444433


No 337
>cd05769 IgC_TCR_beta T cell receptor (TCR) beta chain constant immunoglobulin domain. IgC_TCR_beta: Constant domain of the beta chain of alpha/beta T-cell antigen receptors (TCRs). TCRs mediate antigen recognition by T lymphocytes, and are composed of alpha and beta, or gamma and delta, polypeptide chains with variable (V) and constant (C) regions. This group includes the variable domain of the beta chain. Alpha/beta TCRs recognize antigen as peptide fragments presented by major histocompatibility complex (MHC) molecules. The antigen binding site is formed by the variable domains of the alpha and beta chains, located at the N-terminus of each chain. Alpha/beta TCRs recognize antigens differently from gamma/delta TCRs.
Probab=91.60  E-value=0.7  Score=29.58  Aligned_cols=69  Identities=10%  Similarity=0.084  Sum_probs=35.9

Q ss_pred             cceeeEEeecCC-Cc-cEEEEecCCCCccccccc-ceEEEecCCCCCC-eeeEEEcccCCCC-CEEEEEEEEEec
Q psy534           12 QMLSVGDFADDE-DI-PVYIWYDSYPTHEAEEYK-GRISRVDKESPFG-MASLNLTKIRESD-QGWYECKVVFLN   81 (145)
Q Consensus        12 ~~~~~~~w~~g~-p~-p~~~w~k~~~~~~~~~~~-~R~~~~~~~~~~~-~~sL~I~~v~~~D-~G~Y~C~~~~~~   81 (145)
                      ..+.++|.+.|. |. ..+.|++++..... ... .......++.... ...|.|..-.-.| ...|.|++.+..
T Consensus        19 ~~~tL~Cla~gFyP~~I~V~W~kng~~l~~-g~~~~~~~~~~~~gTYs~~S~L~v~~~~w~~~~~~ytC~V~H~g   92 (115)
T cd05769          19 RKATLVCLATGFYPDHVSLSWKVNGKEVTD-GVATDPQALRENTSTYSISSRLRVSATEWFNPRNTFTCIVQFYG   92 (115)
T ss_pred             CCcEEEEEEEeEeCCCcEEEEEECCEECCC-CcccccceecCCCCeEEEEEEEEEChHHhccCCCeEEEEEEEeC
Confidence            457889999984 65 47899998754221 211 1111111100011 3334444333223 568999997643


No 338
>PF08204 V-set_CD47:  CD47 immunoglobulin-like domain;  InterPro: IPR013270 This family represents the CD47 leukocyte antigen V-set like Ig domain [, ].; PDB: 2VSC_B 2JJS_D 2JJT_C.
Probab=91.51  E-value=0.28  Score=32.11  Aligned_cols=33  Identities=33%  Similarity=0.385  Sum_probs=21.3

Q ss_pred             eEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           45 RISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        45 R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +..+  .+...++.+|.+...+.- .|.|+|++...
T Consensus        75 sa~i--~~l~kG~aSL~~~~~~a~-~GnYTCeVt~~  107 (130)
T PF08204_consen   75 SAKI--SELLKGNASLKMDKSDAV-EGNYTCEVTEL  107 (130)
T ss_dssp             T-BE--GGGGGTB--EEEEHHHHH--EEEEEEEEET
T ss_pred             ccch--hHhhCCCEEEEEcchhcc-ccceEEEEEec
Confidence            4444  345677999999986666 99999999743


No 339
>cd07696 IgC_CH3 CH3 domain (third constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH3: The third immunoglobulin constant domain (IgC) of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=91.04  E-value=1.6  Score=26.86  Aligned_cols=65  Identities=11%  Similarity=0.151  Sum_probs=36.2

Q ss_pred             hhccceeeEEeecCC--Cc-cEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEc---ccCCC---CCEEEEEEEEE
Q psy534            9 SIFQMLSVGDFADDE--DI-PVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLT---KIRES---DQGWYECKVVF   79 (145)
Q Consensus         9 ~~~~~~~~~~w~~g~--p~-p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~---~v~~~---D~G~Y~C~~~~   79 (145)
                      .++.+..++|.+.|-  |. ..++|.++++........  ..     ....+++.++.   .+..+   +.-.|.|.+.+
T Consensus        12 ~~~~~~tLtC~v~gf~yP~~i~v~W~r~~~~~~~~~~~--~~-----~~~~dgty~~~s~l~v~~~~w~~g~~ysC~V~H   84 (96)
T cd07696          12 LLTKSVKLTCLVTNLTSPEGVNVTWTRGSGEPVKASIQ--PP-----ESHNNATLSVTSTLNVSTDDWISGDTFQCKVTH   84 (96)
T ss_pred             ccCCCeEEEEEEeCCCCCCCcEEEEEECCeEeeeEEec--cc-----ccCCCCCEEEEEEEEeCHHHccCCCcEEEEEEC
Confidence            346788999999977  43 357999986432111110  01     11234444443   22333   34589999975


Q ss_pred             e
Q psy534           80 L   80 (145)
Q Consensus        80 ~   80 (145)
                      .
T Consensus        85 ~   85 (96)
T cd07696          85 P   85 (96)
T ss_pred             C
Confidence            4


No 340
>cd07691 Ig_CD3_gamma_delta Immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. Ig_CD3_gamma_delta; immunoglobulin (Ig)-like domain of CD3 gamma and delta chains. CD3 is a T cell surface receptor that is associated with alpha/beta T cell receptors (TCRs).  The CD3 complex consists of one gamma, one delta, two epsilon, and two zeta chains.  The CD3 subunits form heterodimers as gamma/epsilon, delta/epsilon, and zeta/zeta.  The gamma, delta, and epsilon chains each contain an extracellular Ig domain, whereas the extracellular domains of the zeta chains are very small and have unknown structure. The CD3 domain participates in intracellular signalling once the TCR has bound an MHC/antigen complex.
Probab=90.86  E-value=0.36  Score=27.94  Aligned_cols=47  Identities=15%  Similarity=0.128  Sum_probs=31.7

Q ss_pred             ceeeEEeecCCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           13 MLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        13 ~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      .|.+.|-.    ...|.|+|+... ..               ..+.+|.+..+.+.-.|.|.|.+..
T Consensus         8 ~V~L~C~~----~tsi~W~kG~~~-~~---------------~~~~tlnLGs~~~DPRG~Y~C~~s~   54 (69)
T cd07691           8 KVFLKCNG----ATNITWKKGKEI-LE---------------VSNTLLDLGSRINDPRGTYSCKESE   54 (69)
T ss_pred             eEEEEecC----CCcEEEecCccc-cc---------------ccccEEeccCcccCCCcceEecCcc
Confidence            35566622    356999995422 10               1166778888889999999998853


No 341
>cd00098 IgC Immunoglobulin Constant domain. IgC: Immunoglobulin constant domain (IgC). Members of the IgC family are components of immunoglobulin, T-cell receptors, CD1 cell surface glycoproteins, secretory glycoproteins A/C, and Major Histocompatibility Complex (MHC) class I/II molecules. In immunoglobulins, each chain is composed of one variable domain (IgV) and one or more IgC domains. These names reflect the fact that the variability in sequences is higher in the variable domain than in the constant domain. The IgV domain is responsible for antigen binding, and the IgC domain is involved in oligomerization and molecular interactions.
Probab=90.60  E-value=0.29  Score=29.45  Aligned_cols=24  Identities=29%  Similarity=0.411  Sum_probs=18.2

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.+......+.|.|+|.|.+...
T Consensus        63 ~l~v~~~~~~~~~~y~C~v~h~~~   86 (95)
T cd00098          63 QLTVSPSDWNSGDTYTCVVTHESL   86 (95)
T ss_pred             EEEECHHHhCCCCCEEEEEEeCCC
Confidence            455655555689999999999754


No 342
>cd07689 Ig2_VCAM-1 Second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106) and intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ VCAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of vascular endothelial cell adhesion molecule-1 (VCAM-1, CD106). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. The interaction of VCAM-1 binding to the beta1 integrin very late antigen (VLA-4) expressed by lymphocytes and monocytes mediates the adhesion of leucocytes to blood vessel walls, and regulates migration across the endothelium. During metastasis, some circulating cancer cells extravasate to a secondary site by a similar process.  VCAM-1 may be involved in organ targeted tumor metastasis and may also act as host receptors for viruses and parasites.  VCAM-1 contains seven Ig domains.
Probab=90.34  E-value=1.4  Score=27.45  Aligned_cols=71  Identities=8%  Similarity=-0.006  Sum_probs=40.5

Q ss_pred             HHhhhccceeeEEeecC-CCc--cEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCE-EEEEEEEE
Q psy534            6 AVKSIFQMLSVGDFADD-EDI--PVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQG-WYECKVVF   79 (145)
Q Consensus         6 ~~~~~~~~~~~~~w~~g-~p~--p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G-~Y~C~~~~   79 (145)
                      .+-..+.++.+.|-+.+ .|.  ..+.|+++........+.+....-.  .......+.|.- +++|.| .|.|+|..
T Consensus        10 ~~l~~G~~vtv~C~v~~v~P~~~l~v~LlkG~~~l~~~~f~~~~~~ks--~~~~~~~vtftp-treD~g~~fsC~A~L   84 (99)
T cd07689          10 GPLEEGKPVTVKCEVPDVYPFDRLEIELLKGETLLPSKSFLEDMDKKS--LETKSLEVTFTP-TIEDIGKVLVCRAKL   84 (99)
T ss_pred             CcccCCceEEEEEEecCcccCCceEEEEecCcceecccccccccccCC--CCCcceeEEEec-chhhCCcEEEEEEEE
Confidence            34467889999999884 455  6788998875422222222110000  001123444544 477777 99999953


No 343
>cd04985 IgC_CH1 CH1 domain (first constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH1: The first immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fab antigen-binding fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=89.50  E-value=1.3  Score=27.27  Aligned_cols=26  Identities=12%  Similarity=0.227  Sum_probs=19.5

Q ss_pred             ccceeeEEeecCC-C-ccEEEEecCCCC
Q psy534           11 FQMLSVGDFADDE-D-IPVYIWYDSYPT   36 (145)
Q Consensus        11 ~~~~~~~~w~~g~-p-~p~~~w~k~~~~   36 (145)
                      ...+.+.|.+.|. | ...++|++++..
T Consensus        16 ~~~~~L~C~a~gFyP~~i~vtW~k~g~~   43 (95)
T cd04985          16 SDSVTLGCLATGFLPEPVTFTWNSGSNS   43 (95)
T ss_pred             CCcEEEEEEEeeEECCCcEEEEeECCEE
Confidence            3457899999984 5 446899999854


No 344
>PHA02982 hypothetical protein; Provisional
Probab=88.26  E-value=1.9  Score=30.69  Aligned_cols=67  Identities=13%  Similarity=0.216  Sum_probs=44.0

Q ss_pred             hccceeeEEeec-CCCccEEEEecCCCCcccc----------------cccceEEEecCCCCCCeeeEEEcccCCCCCEE
Q psy534           10 IFQMLSVGDFAD-DEDIPVYIWYDSYPTHEAE----------------EYKGRISRVDKESPFGMASLNLTKIRESDQGW   72 (145)
Q Consensus        10 ~~~~~~~~~w~~-g~p~p~~~w~k~~~~~~~~----------------~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~   72 (145)
                      -..++.+-|-++ +.......|++....-+..                ++++...+.   .....++|.|.++..+..|-
T Consensus        38 vd~~V~L~C~~~~~~~i~~~~W~~~~~~~la~~~~~~~~iN~~~y~~~~~kd~y~~s---v~g~~STLTIkk~~i~N~GC  114 (251)
T PHA02982         38 VDQEVKLQCLFKDADEISRAMWKGDAGFMLAQEANGGTGINAFNYVPGPYKDKYALS---VSGNSSTFTMKKPDPQNLGC  114 (251)
T ss_pred             CCCcEEEEecCCCcchhhhheeeCCCCeEEEeeecCcceeccccccCCccceeEEEE---EeccceeEEeccCCcccCCc
Confidence            357788888877 4556678898865421110                122222221   12347889999999999999


Q ss_pred             EEEEEEE
Q psy534           73 YECKVVF   79 (145)
Q Consensus        73 Y~C~~~~   79 (145)
                      |.|++..
T Consensus       115 Ytc~~ks  121 (251)
T PHA02982        115 FTCEAKD  121 (251)
T ss_pred             eEEEEec
Confidence            9999953


No 345
>PHA02982 hypothetical protein; Provisional
Probab=87.09  E-value=1.9  Score=30.65  Aligned_cols=27  Identities=19%  Similarity=0.375  Sum_probs=23.8

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +.++|+|+.+..+..|=|+|+|....+
T Consensus        98 ~~STLTIkk~~i~N~GCYtc~~ks~~~  124 (251)
T PHA02982         98 NSSTFTMKKPDPQNLGCFTCEAKDAEG  124 (251)
T ss_pred             cceeEEeccCCcccCCceEEEEecCCC
Confidence            345899999999999999999998775


No 346
>KOG1480|consensus
Probab=87.05  E-value=0.22  Score=41.58  Aligned_cols=58  Identities=16%  Similarity=0.204  Sum_probs=40.6

Q ss_pred             eeeEEeec-CCCccEEEEecCCCCcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEEe
Q psy534           14 LSVGDFAD-DEDIPVYIWYDSYPTHEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        14 ~~~~~w~~-g~p~p~~~w~k~~~~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      +...|... +.|+.-..|+|++.. +++  ...+      ....+..|+|..+.+.|+|.|+|++.+.
T Consensus       147 ~~l~cr~pe~~paae~~w~k~e~~-~~p--d~n~------~~~~d~~li~~~arlsd~~nytc~a~ni  205 (909)
T KOG1480|consen  147 LQLPCRPPEGDPKAEVEWLKNEVV-IDP--DANV------IRASDHNLIISQARLSDSGNYTCEATNI  205 (909)
T ss_pred             ccccccCcccchhhhhhccccCCC-CCc--cccc------hhhhcCCccccchhhhhcccceeeeehh
Confidence            34445443 777888899999853 333  1111      1234889999999999999999999654


No 347
>cd05755 Ig2_ICAM-1_like Second immunoglobulin (Ig)-like domain of  intercellular cell adhesion molecule-1 (ICAM-1, CD54) and similar proteins. Ig2_ ICAM-1_like: domain similar to the second immunoglobulin (Ig)-like domain of intercellular cell adhesion molecule-1 (ICAM-1, CD54). During the inflammation process, these molecules recruit leukocytes onto the vascular endothelium before extravasation to the injured tissues. ICAM-1 may be involved in organ targeted tumor metastasis. The interaction of ICAM-1 with leukocyte function-associated antigen-1 (LFA-1) plays a part in leukocyte-endothelial cell recognition. This group also contains ICAM-2, which also interacts with LFA-1. Transmigration of immature dendritic cells across resting endothelium is dependent on the interaction of ICAM-2 with, yet unidentified, ligand(s) on the dendritic cells. ICAM-1 has five Ig-like domains and ICAM-2 has two. ICAM-1 may also act as host receptor for viruses and parasites.
Probab=84.52  E-value=2.8  Score=26.14  Aligned_cols=23  Identities=22%  Similarity=0.534  Sum_probs=16.5

Q ss_pred             EEEEcccCCCCCe-eeEEEEecCCC
Q psy534          106 ELRISNIRSQDIG-DYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G-~Y~C~a~n~~g  129 (145)
                      +|.+. +.++|.| .|+|+|.+.++
T Consensus        63 tlt~~-~~r~D~g~~~sC~A~l~l~   86 (100)
T cd05755          63 TITIT-VDREDHGANFSCETELDLR   86 (100)
T ss_pred             EEEEe-cchhhCCcEEEEEEEeccC
Confidence            34543 4567766 69999999876


No 348
>PHA02865 MHC-like TNF binding protein; Provisional
Probab=82.57  E-value=4.1  Score=31.09  Aligned_cols=20  Identities=20%  Similarity=0.212  Sum_probs=15.7

Q ss_pred             eeeEEeecCC-Cc-cEEEEecC
Q psy534           14 LSVGDFADDE-DI-PVYIWYDS   33 (145)
Q Consensus        14 ~~~~~w~~g~-p~-p~~~w~k~   33 (145)
                      +.+.||+.|- |. ..+.|.|+
T Consensus       217 ~tL~C~A~GFYP~~I~v~W~kd  238 (338)
T PHA02865        217 TTLFCTFDSHYPSSVAAKWYNS  238 (338)
T ss_pred             ceEEEEEEeEeCCccEEEEEec
Confidence            5789999985 54 45789999


No 349
>PF07354 Sp38:  Zona-pellucida-binding protein (Sp38);  InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals. These are sperm proteins that bind to the 90 kDa family of zona pellucida glycoproteins in a calcium-dependent manner []. These represent some of the specific molecules that mediate the first steps of gamete interaction, allowing fertilisation to occur [].; GO: 0007339 binding of sperm to zona pellucida, 0005576 extracellular region
Probab=81.76  E-value=1.5  Score=32.22  Aligned_cols=25  Identities=28%  Similarity=0.465  Sum_probs=22.3

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecCC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHVL  128 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~~  128 (145)
                      .| .|.+.+...+++|.|+|..+...
T Consensus        36 TG-~L~~~~F~esmSG~YTCtLsYk~   60 (271)
T PF07354_consen   36 TG-KLMFKNFQESMSGSYTCTLSYKP   60 (271)
T ss_pred             Cc-eEEeeccccccCCceEEEEEEEe
Confidence            44 79999999999999999998875


No 350
>cd05721 IgV_CTLA-4 Immunoglobulin (Ig) domain of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4). IgV_CTLA-4: domain similar to the variable(v)-type immunoglobulin (Ig) domain found in cytotoxic T lymphocyte-associated antigen 4 (CTLA-4).  CTLA-4 is involved in the regulation of T cell response, acting as an inhibitor of intracellular signalling.  CTLA-4 is similar to CD28, a T cell co-receptor protein that recognizes the B7 proteins (CD80 and CD86). CD28 binding of the B7 proteins occurs after the presentation of antigen to the T cell receptor (TCR) via the peptide-MHC complex on the surface of an antigen presenting cell (APC).  CTLA-4 also binds the B7 molecules with a higher affinity than does CD28.  The B7/CTLA-4 interaction generates inhibitory signals down-regulating the response, and may prevent T cell activation by weak TCR signals. CD28 and CTLA-4 then elicit opposing signals in the regulation of T cell responsiveness and homeostasis. T cell activation leads to increased 
Probab=75.34  E-value=2.6  Score=27.05  Aligned_cols=32  Identities=16%  Similarity=0.444  Sum_probs=23.2

Q ss_pred             EEeEEec-CCcEEEEcccCCCCCeeeEEEEecC
Q psy534           96 DVHGVFN-DGTELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus        96 ~c~~~~~-~~~~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      .|.+... +.-.|.|.+++.+|.+.|.|..+.-
T Consensus        64 tcs~~~s~ntv~L~l~~L~a~DTa~Y~Ca~e~m   96 (115)
T cd05721          64 NCDGTLGNEQVNFTLQNLRANQTDIYFCKIELM   96 (115)
T ss_pred             EEeEeCCCCEEEEEEcCCCHHHCeEEEEEeeec
Confidence            4554433 3346899999999999999976543


No 351
>cd05883 Ig2_Necl-2 Second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Ig2_Necl-2: second immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)). Nectin-like molecules (Necls) have similar domain structures to those of nectins. At least five nectin-like molecules have been identified (Necl-1 - Necl-5). These have an extracellular region containing three Ig-like domains, one transmembrane region, and one cytoplasmic region. Necl-2 has Ca(2+)-independent homophilic and heterophilic cell-cell adhesion activity. Necl-1 is expressed in a wide variety of tissues, and is a putative tumour suppressor gene, which is downregulated in aggressive neuroblastoma. Ig domains are likely to participate in ligand binding and recognition.
Probab=74.01  E-value=3.6  Score=24.61  Aligned_cols=23  Identities=26%  Similarity=0.497  Sum_probs=15.8

Q ss_pred             EEEEcccCCCCCe-eeEEEEecCCC
Q psy534          106 ELRISNIRSQDIG-DYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G-~Y~C~a~n~~g  129 (145)
                      +|.+. ++++|.| .|+|+|.|+.-
T Consensus        45 ~L~~~-p~~eDdG~~~~C~a~~~~l   68 (82)
T cd05883          45 QLMLK-VTKEDDGVPVICLVDHPAV   68 (82)
T ss_pred             EEEEE-CchhhCCCEEEEEEcCccc
Confidence            56664 4455555 59999999863


No 352
>PHA03282 envelope glycoprotein E; Provisional
Probab=73.73  E-value=4.5  Score=32.23  Aligned_cols=21  Identities=38%  Similarity=0.540  Sum_probs=19.8

Q ss_pred             eeeEEEcccCCCCCEEEEEEE
Q psy534           57 MASLNLTKIRESDQGWYECKV   77 (145)
Q Consensus        57 ~~sL~I~~v~~~D~G~Y~C~~   77 (145)
                      |.+|.|.+++.+|+|.|.-.+
T Consensus       123 n~tl~l~~a~~~DsG~Y~L~~  143 (540)
T PHA03282        123 NGTLVLREARETDSGMYVLSV  143 (540)
T ss_pred             cceEEEeeccccCCceEEEEe
Confidence            888999999999999999877


No 353
>PF11465 Receptor_2B4:  Natural killer cell receptor 2B4;  InterPro: IPR024303 2B4 is a transmembrane receptor which is expressed primarily on natural killer (NK) cells. It plays a role in activating NK-mediated cytotoxicity through its interaction with CD48 on target cells in a subset of CD8 T cells []. The structure of 2B4 consists of an immunoglobulin variable domain fold and contains two beta-sheets. One of the beta-sheets, the six-stranded sheet, contains structural features that may have a role in ligand recognition and receptor function []. This entry represents the 2B4 immunoglobulin domain.; GO: 0005488 binding; PDB: 2PTU_D 2PTT_B 1Z2K_A.
Probab=72.93  E-value=5.8  Score=25.09  Aligned_cols=25  Identities=28%  Similarity=0.167  Sum_probs=21.2

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      -.|.|+.++..|+|.|.-++.+.-|
T Consensus        71 laLlIkaAq~qDSG~Y~LEvT~~sG   95 (108)
T PF11465_consen   71 LALLIKAAQPQDSGLYCLEVTNESG   95 (108)
T ss_dssp             TEEEESS-SGGG-EEEEEEEEETTS
T ss_pred             ceEEEeecCcccCceEEEEEEcCCC
Confidence            3899999999999999999999887


No 354
>KOG4597|consensus
Probab=71.75  E-value=5.3  Score=31.91  Aligned_cols=59  Identities=14%  Similarity=0.196  Sum_probs=36.6

Q ss_pred             EEeecCCCccEEEEecCCC---CcccccccceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEEEE
Q psy534           17 GDFADDEDIPVYIWYDSYP---THEAEEYKGRISRVDKESPFGMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        17 ~~w~~g~p~p~~~w~k~~~---~~~~~~~~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      .|-..|.+.+.++|-+...   ..+.+    +-+..++-....-+-|.|.+....|+|.|.|.+..
T Consensus       217 tCg~~G~q~r~V~c~qv~anr~~vv~~----~nq~~e~p~vtstcql~ic~ewq~~a~w~tCs~rc  278 (560)
T KOG4597|consen  217 TCGVQGRQYRVVTCEQVFANRENVVMR----PNQTVENPVVTSTCQLVICNEWQADAGWYTCSARC  278 (560)
T ss_pred             cccccCCcCceeeeehhhccccceeec----CccccCCcceeeeeeEEEcchhhcCCCceeecccc
Confidence            3434477888999965431   11111    12222222223467799999999999999999854


No 355
>PF05790 C2-set:  Immunoglobulin C2-set domain;  InterPro: IPR008424 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds. There are two types of light chains: kappa and lambda, each composed of a constant domain (CL) and a variable domain (VL). There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are highly modular proteins, in which the variable and constant domains have clear, conserved sequence patterns. The domains in Ig and Ig-like molecules are grouped into four types: V-set (variable; IPR013106 from INTERPRO), C1-set (constant-1; IPR003597 from INTERPRO), C2-set (constant-2; IPR008424 from INTERPRO) and I-set (intermediate; IPR013098 from INTERPRO) []. Structural studies have shown that these domains share a common core Greek-key beta-sandwich structure, with the types differing in the number of strands in the beta-sheets as well as in their sequence patterns [, ]. Immunoglobulin-like domains that are related in both sequence and structure can be found in several diverse protein families. Ig-like domains are involved in a variety of functions, including cell-cell recognition, cell-surface receptors, muscle structure and the immune system [].  This entry represents C2-set domains, which are Ig-like domains resembling the antibody constant domain. C2-set domains are found primarily in the mammalian T-cell surface antigens CD2 (Cluster of Differentiation 2), CD4 and CD80, as well as in vascular (VCAM) and intercellular (ICAM) cell adhesion molecules. CD2 mediates T-cell adhesion via its ectodomain, and signal transduction utilising its 117-amino acid cytoplasmic tail []. CD2 displays structural and functional similarities with African swine fever virus (ASFV) LMW8-DR, a protein that is involved in cell-cell adhesion and immune response modulation, suggesting a possible role in the pathogenesis of ASFV infection []. CD4 is the primary receptor for HIV-1. CD4 has four immunoglobulin-like domains in its extracellular region that share the same structure, but can differ in sequence. Certain extracellular domains may be involved in dimerisation [].; GO: 0007155 cell adhesion, 0016021 integral to membrane; PDB: 1CID_A 1CDU_A 1WIQ_B 2NY4_B 2NY2_B 1WIP_B 1WIO_A 3S4S_G 1CDY_A 3S5L_G ....
Probab=68.30  E-value=22  Score=21.05  Aligned_cols=22  Identities=18%  Similarity=0.350  Sum_probs=18.0

Q ss_pred             CcEEEEcccCCCCCeeeEEEEe
Q psy534          104 GTELRISNIRSQDIGDYTCLAT  125 (145)
Q Consensus       104 ~~~L~i~~v~~~d~G~Y~C~a~  125 (145)
                      ...+.......+|+|.+.|.|+
T Consensus        42 ~~~~~~~~~~~~d~G~w~C~a~   63 (80)
T PF05790_consen   42 KKLVSTFTPTTEDSGTWVCTAS   63 (80)
T ss_dssp             SSEEEEESBTCGGSEEEEEEEE
T ss_pred             ceEEEEecCCCCCCEEEEEEEc
Confidence            3356777888899999999994


No 356
>PHA03189 UL14 tegument protein; Provisional
Probab=66.03  E-value=21  Score=26.94  Aligned_cols=19  Identities=16%  Similarity=0.406  Sum_probs=15.8

Q ss_pred             ccCCCCCeeeEEEEecCCC
Q psy534          111 NIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       111 ~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ++..+-+|.|.|+..|...
T Consensus       139 ~v~t~taG~Y~CvLrN~tH  157 (348)
T PHA03189        139 RVSTSTAGMYECVLRNETH  157 (348)
T ss_pred             EEEecccceEEEEeccccc
Confidence            5667789999999999863


No 357
>PHA02914 Immunoglobulin-like domain protein; Provisional
Probab=64.55  E-value=6  Score=30.99  Aligned_cols=24  Identities=21%  Similarity=0.192  Sum_probs=21.4

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVL  128 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~  128 (145)
                      ++|+|+.+..+.+|=|+|+|..+.
T Consensus       346 STLTIkka~I~N~GCY~~~a~~g~  369 (500)
T PHA02914        346 STLTIKKAHINNAGCYEAQAFMGK  369 (500)
T ss_pred             ceEEeeeEEEEcCCceEEEEecCc
Confidence            589999999999999999998764


No 358
>PF01688 Herpes_gI:  Alphaherpesvirus glycoprotein I;  InterPro: IPR002874 This family consists of glycoprotein I from various members of the alphaherpesvirinae. These include Human herpesvirus 1 (HHV-1), Human herpesvirus 3 (HHV-3) and Suid herpesvirus 1 (Pseudorabies virus). Glycoprotein I (gI) is important during natural infection, mutants lacking gI produce smaller lesions at the site of infection and show reduced neuronal spread []. gI forms a heterodimeric complex with gE; this complex displays Fc receptor activity (binds to the Fc region of immunoglobulin) []. Glycoproteins are also important in the production of virus-neutralizing antibodies and cell mediated immunity []. The alphaherpesviridae have a dsDNA genome and have no RNA stage during viral replication.; GO: 0033643 host cell part
Probab=63.80  E-value=9.2  Score=26.05  Aligned_cols=24  Identities=25%  Similarity=0.263  Sum_probs=20.4

Q ss_pred             eeeEEEcccCCCCCEEEEEEEEEe
Q psy534           57 MASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        57 ~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      ..-|+|.+.+.+|+|.|.-++...
T Consensus       123 ~~lL~i~~p~~~dsG~Y~lRV~l~  146 (161)
T PF01688_consen  123 GVLLRIRNPRPEDSGIYYLRVWLD  146 (161)
T ss_pred             ceEEEeCCCCcccceEEEEEEEEC
Confidence            445899999999999999998643


No 359
>cd04986 IgC_CH2 CH2 domain (second constant Ig domain of the heavy chain) in immunoglobulin. IgC_CH2: The second immunoglobulin constant domain (IgC), of immunoglobulin (Ig) heavy chains. This domain is found on the Fc fragment. The basic structure of Ig molecules is a tetramer of two light chains and two heavy chains linked by disulfide bonds. There are two types of light chains: kappa and lambda; each composed of a constant domain and a variable domain. There are five types of heavy chains: alpha, delta, epsilon, gamma and mu, all consisting of a variable domain (VH) and three (in alpha, delta and gamma) or four (in epsilon and mu) constant domains (CH1 to CH4). Ig molecules are modular proteins, in which the variable and constant domains have clear, conserved sequence patterns.
Probab=59.77  E-value=39  Score=20.91  Aligned_cols=26  Identities=15%  Similarity=0.015  Sum_probs=18.8

Q ss_pred             ccceeeEEeecC-C-C-ccEEEEecCCCC
Q psy534           11 FQMLSVGDFADD-E-D-IPVYIWYDSYPT   36 (145)
Q Consensus        11 ~~~~~~~~w~~g-~-p-~p~~~w~k~~~~   36 (145)
                      ...+.++|...| . | ...+.|.+++..
T Consensus        19 ~~~atLtClV~~f~~P~~i~V~W~~~g~~   47 (99)
T cd04986          19 GSSASLTCTLSGLRDPEGAVFTWTPSGGK   47 (99)
T ss_pred             CCccEEEEEEeccCCCCCeEEEEEECCcc
Confidence            456789999987 3 4 346889888753


No 360
>PHA03286 envelope glycoprotein E; Provisional
Probab=58.25  E-value=14  Score=29.32  Aligned_cols=24  Identities=21%  Similarity=0.502  Sum_probs=20.5

Q ss_pred             CeeeEEEcccCCCCCEEEEEEEEE
Q psy534           56 GMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        56 ~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +..+|++.|+..+|+|.|.|.+..
T Consensus       305 ~i~nL~f~nA~~s~SGLYVfVl~y  328 (492)
T PHA03286        305 DIPSFRLANAQPTDAGLYVVVALY  328 (492)
T ss_pred             CCCceeecCCCcccCceEEEEEEE
Confidence            344699999999999999999954


No 361
>PHA02914 Immunoglobulin-like domain protein; Provisional
Probab=54.76  E-value=20  Score=28.27  Aligned_cols=21  Identities=24%  Similarity=0.355  Sum_probs=19.0

Q ss_pred             eeeEEEcccCCCCCEEEEEEE
Q psy534           57 MASLNLTKIRESDQGWYECKV   77 (145)
Q Consensus        57 ~~sL~I~~v~~~D~G~Y~C~~   77 (145)
                      ..++.+.|++++|.|.|+|.+
T Consensus        80 eYsf~~~Nvs~sdEGrYrCIF  100 (500)
T PHA02914         80 EYSFIEENIGEHEDGDFKCIF  100 (500)
T ss_pred             eeEEEecCcccccCCcEEEEE
Confidence            567888999999999999988


No 362
>PHA03282 envelope glycoprotein E; Provisional
Probab=49.19  E-value=23  Score=28.39  Aligned_cols=23  Identities=30%  Similarity=0.531  Sum_probs=20.4

Q ss_pred             eeeEEEcccCCCCCEEEEEEEEE
Q psy534           57 MASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        57 ~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +..|+|.|...+++|.|.|++..
T Consensus       332 ~VdL~F~nAp~saSGLYVfVl~y  354 (540)
T PHA03282        332 TVNLQLRDASEASGGLYVCVVYV  354 (540)
T ss_pred             ccceEecCCCcccCceEEEEEEE
Confidence            55799999999999999999953


No 363
>PHA03290 envelope glycoprotein I; Provisional
Probab=45.87  E-value=29  Score=26.50  Aligned_cols=23  Identities=22%  Similarity=0.193  Sum_probs=20.1

Q ss_pred             eeeEEEcccCCCCCEEEEEEEEE
Q psy534           57 MASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        57 ~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..-|.|.+.+.+|+|.|.-++..
T Consensus       128 ~vLL~I~~P~~~DSGiY~LRV~L  150 (357)
T PHA03290        128 EIIFKINKPGIEDAGIYLLLVQL  150 (357)
T ss_pred             ceEEEeCCCCcccCeeEEEEEEe
Confidence            45689999999999999999954


No 364
>KOG1480|consensus
Probab=45.62  E-value=11  Score=32.12  Aligned_cols=25  Identities=44%  Similarity=0.675  Sum_probs=22.5

Q ss_pred             cEEEEcccCCCCCeeeEEEEecCCC
Q psy534          105 TELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       105 ~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      ..|.+..+...|.|+|+|+|.|-++
T Consensus       183 ~~li~~~arlsd~~nytc~a~ni~~  207 (909)
T KOG1480|consen  183 HNLIISQARLSDSGNYTCEATNIVA  207 (909)
T ss_pred             CCccccchhhhhcccceeeeehhhc
Confidence            3688899999999999999999887


No 365
>COG5475 Uncharacterized small protein [Function unknown]
Probab=42.79  E-value=54  Score=18.16  Aligned_cols=26  Identities=23%  Similarity=0.281  Sum_probs=19.8

Q ss_pred             cCCcEEEEcccCCCCCeeeEEEEecCCC
Q psy534          102 NDGTELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       102 ~~~~~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      +.|+...+...+.  .|.|.|...++.|
T Consensus        15 sGGP~Mtvs~~ss--~Gmy~C~Wf~g~g   40 (60)
T COG5475          15 SGGPRMTVSGYSS--DGMYECRWFDGYG   40 (60)
T ss_pred             cCCceEEEecccc--CCeEEEEEecCCC
Confidence            3455677776654  4999999999998


No 366
>PHA03289 envelope glycoprotein I; Provisional
Probab=41.02  E-value=39  Score=25.73  Aligned_cols=24  Identities=29%  Similarity=0.318  Sum_probs=20.4

Q ss_pred             eeeEEEcccCCCCCEEEEEEEEEe
Q psy534           57 MASLNLTKIRESDQGWYECKVVFL   80 (145)
Q Consensus        57 ~~sL~I~~v~~~D~G~Y~C~~~~~   80 (145)
                      .--|.|.+.+.+|+|.|.-++...
T Consensus       121 gvLL~I~~Pr~~DSGiYyLRV~Ld  144 (352)
T PHA03289        121 GLLLTIIEPRMSDTGIYYIRVSLA  144 (352)
T ss_pred             ceEEEeCCCCcccCeeEEEEEEeC
Confidence            446889999999999999999643


No 367
>KOG4597|consensus
Probab=40.75  E-value=27  Score=28.10  Aligned_cols=24  Identities=38%  Similarity=0.345  Sum_probs=22.3

Q ss_pred             EEEEcccCCCCCeeeEEEEecCCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVLY  129 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~g  129 (145)
                      .|.|-+-...|+|-|+|.|.+..|
T Consensus       258 ql~ic~ewq~~a~w~tCs~rcg~g  281 (560)
T KOG4597|consen  258 QLVICNEWQADAGWYTCSARCGAG  281 (560)
T ss_pred             eEEEcchhhcCCCceeeccccccc
Confidence            588888999999999999999999


No 368
>PHA03052 Hypothetical protein; Provisional
Probab=40.33  E-value=57  Score=18.86  Aligned_cols=29  Identities=10%  Similarity=-0.011  Sum_probs=21.4

Q ss_pred             hhhccceeeEEeec---CCCccEEEEecCCCC
Q psy534            8 KSIFQMLSVGDFAD---DEDIPVYIWYDSYPT   36 (145)
Q Consensus         8 ~~~~~~~~~~~w~~---g~p~p~~~w~k~~~~   36 (145)
                      ++++.++.+-|-+.   |...+.+.|.-|+..
T Consensus         9 ~slGs~ltI~Ckv~lg~g~~~a~V~W~~N~~~   40 (69)
T PHA03052          9 TSLGSNLTITCKVSLRPPTTDADVFWISNGMY   40 (69)
T ss_pred             EEccCCceEeEEEEecCCCcceEEEEEeCCcE
Confidence            56888889999876   444667888877754


No 369
>PHA03292 envelope glycoprotein I; Provisional
Probab=39.94  E-value=40  Score=26.31  Aligned_cols=23  Identities=30%  Similarity=0.367  Sum_probs=20.2

Q ss_pred             eeeEEEcccCCCCCEEEEEEEEE
Q psy534           57 MASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        57 ~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      ..-|.|.+.+.+|+|.|.-++..
T Consensus       127 ~vLL~I~~P~~~DSGiY~LRV~L  149 (413)
T PHA03292        127 NVLLNITGPQPADSGAYILRVKL  149 (413)
T ss_pred             ceEEEeCCCCcccceeEEEEEEe
Confidence            46689999999999999999954


No 370
>PHA03042 CD47-like protein; Provisional
Probab=39.11  E-value=17  Score=26.98  Aligned_cols=22  Identities=27%  Similarity=0.480  Sum_probs=14.1

Q ss_pred             EEEEcccCCCCCeeeEEEEecCC
Q psy534          106 ELRISNIRSQDIGDYTCLATHVL  128 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~~  128 (145)
                      +|.+.. ...-.|+|||.|.+..
T Consensus        72 SL~~~f-~~~l~GNYTCEv~~l~   93 (286)
T PHA03042         72 SLKFNF-SKNLSGNYTCEAINKF   93 (286)
T ss_pred             EEEEec-cccCCCceeEEEeecc
Confidence            354432 2334899999998754


No 371
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=38.16  E-value=28  Score=27.71  Aligned_cols=24  Identities=29%  Similarity=0.393  Sum_probs=18.1

Q ss_pred             CeeeEEEcccCCCCCEEEEEEEEE
Q psy534           56 GMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        56 ~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +.-.|++.|+..+++|.|.|.+..
T Consensus       267 ~~~~l~f~~a~~~~sGLYv~V~~~  290 (439)
T PF02480_consen  267 NGVDLQFTNAPESASGLYVFVVYY  290 (439)
T ss_dssp             TSSSEEESS--GGG-EEEEEEEEE
T ss_pred             CCcceEecCCCcccCceEEEEEEE
Confidence            467799999999999999999943


No 372
>PHA03283 envelope glycoprotein E; Provisional
Probab=34.30  E-value=54  Score=26.74  Aligned_cols=24  Identities=17%  Similarity=0.301  Sum_probs=20.9

Q ss_pred             CeeeEEEcccCCCCCEEEEEEEEE
Q psy534           56 GMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        56 ~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +.-.|++.|+..+++|.|.|.+..
T Consensus       313 ~~v~L~f~nap~~~SGLYVfVv~y  336 (542)
T PHA03283        313 NRVDLLFKNAPASASGLYVFVLLY  336 (542)
T ss_pred             CCcceEeccCCcccCceEEEEEEE
Confidence            357799999999999999999943


No 373
>PF06214 SLAM:  Signaling lymphocytic activation molecule (SLAM) protein;  InterPro: IPR010407 This entry is found in several mammalian signalling lymphocytic activation molecule (SLAM) proteins. Optimal T cell activation and expansion require engagement of the TCR plus co-stimulatory signals delivered through accessory molecules. SLAM, a 70 kDa co-stimulatory molecule belonging to the Ig superfamily, is defined as a human cell surface molecule that mediates CD28-independent proliferation of human T cells and IFN-gamma production by human Th1 and Th2 clones []. SLAM has also been recognised as a receptor for Measles virus [].; GO: 0004872 receptor activity, 0046649 lymphocyte activation, 0009986 cell surface, 0016021 integral to membrane; PDB: 3ALX_D 3ALZ_B 3ALW_A.
Probab=31.93  E-value=59  Score=20.80  Aligned_cols=30  Identities=23%  Similarity=0.429  Sum_probs=20.1

Q ss_pred             cceEEEecCCCCCCeeeEEEcccCCCCCEEEEEEE
Q psy534           43 KGRISRVDKESPFGMASLNLTKIRESDQGWYECKV   77 (145)
Q Consensus        43 ~~R~~~~~~~~~~~~~sL~I~~v~~~D~G~Y~C~~   77 (145)
                      .++..+.     ..+-+|.|..-+++|.|-|.-..
T Consensus        93 edgY~Fh-----lEnLsL~Il~SrkE~EGWYfmtl  122 (126)
T PF06214_consen   93 EDGYKFH-----LENLSLEILESRKEDEGWYFMTL  122 (126)
T ss_dssp             SSSEEEE-----TTTTEEEETT--GGG-EEEEEEE
T ss_pred             ccccEEe-----cccceeehhccccccCceEEEEe
Confidence            4455553     45899999999999999997543


No 374
>PF09969 DUF2203:  Uncharacterized conserved protein (DUF2203);  InterPro: IPR018699  This family has no known function.
Probab=30.25  E-value=56  Score=21.03  Aligned_cols=28  Identities=14%  Similarity=0.201  Sum_probs=17.5

Q ss_pred             ceeeEEeecCCCccEEEEecCCCCcccccccceE
Q psy534           13 MLSVGDFADDEDIPVYIWYDSYPTHEAEEYKGRI   46 (145)
Q Consensus        13 ~~~~~~w~~g~p~p~~~w~k~~~~~~~~~~~~R~   46 (145)
                      -...+||-.|.+  .+.||+..    +..|.+|-
T Consensus        90 ~~v~LCWk~GE~--~I~~wH~~----d~GFaGRk  117 (120)
T PF09969_consen   90 REVYLCWKEGEP--EIAYWHGL----DEGFAGRK  117 (120)
T ss_pred             CEEEEEeCCCCc--ceeeeccC----CcccccCc
Confidence            346689998884  45566653    23566664


No 375
>PHA03291 envelope glycoprotein I; Provisional
Probab=28.83  E-value=77  Score=24.59  Aligned_cols=23  Identities=17%  Similarity=0.127  Sum_probs=20.0

Q ss_pred             eeeEEEcccCCCCCEEEEEEEEE
Q psy534           57 MASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        57 ~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      .--|.|.+.+.+|+|.|.-++..
T Consensus       128 ~vLL~i~~P~~~DsGiYvLRV~v  150 (401)
T PHA03291        128 QPLLRARGAARAVVGLYVLRVWV  150 (401)
T ss_pred             ceEEEecCCCcccceeEEEEEEe
Confidence            45688999999999999999964


No 376
>PHA03286 envelope glycoprotein E; Provisional
Probab=27.46  E-value=62  Score=25.95  Aligned_cols=22  Identities=27%  Similarity=0.433  Sum_probs=19.7

Q ss_pred             EEEEcccCCCCCeeeEEEEecC
Q psy534          106 ELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus       106 ~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      .|.+.+...+++|-|.|++.-.
T Consensus       308 nL~f~nA~~s~SGLYVfVl~yN  329 (492)
T PHA03286        308 SFRLANAQPTDAGLYVVVALYN  329 (492)
T ss_pred             ceeecCCCcccCceEEEEEEEC
Confidence            6889999999999999998754


No 377
>PHA03240 envelope glycoprotein M; Provisional
Probab=27.21  E-value=28  Score=24.98  Aligned_cols=20  Identities=25%  Similarity=0.270  Sum_probs=17.5

Q ss_pred             CeeeEEEcccCCCCCEEEEE
Q psy534           56 GMASLNLTKIRESDQGWYEC   75 (145)
Q Consensus        56 ~~~sL~I~~v~~~D~G~Y~C   75 (145)
                      .+.+|.|-+|..+|.|.|--
T Consensus       103 ~NstL~i~~vn~sd~~nYcr  122 (258)
T PHA03240        103 HNSTLIIAHLNLSDAGEYCR  122 (258)
T ss_pred             ccceEEEEEEeecCcchhhh
Confidence            38999999999999999843


No 378
>PHA03281 envelope glycoprotein E; Provisional
Probab=25.65  E-value=78  Score=26.08  Aligned_cols=24  Identities=29%  Similarity=0.420  Sum_probs=20.7

Q ss_pred             CeeeEEEcccCCCCCEEEEEEEEE
Q psy534           56 GMASLNLTKIRESDQGWYECKVVF   79 (145)
Q Consensus        56 ~~~sL~I~~v~~~D~G~Y~C~~~~   79 (145)
                      +...|++.+...+++|.|.|.+..
T Consensus       473 n~vdL~F~nApasaSGLYVfVl~y  496 (642)
T PHA03281        473 GGSALKFVDAAESLSGLYVFIIHF  496 (642)
T ss_pred             CCcceEeccCCcccCceEEEEEEE
Confidence            356699999999999999999943


No 379
>PF02480 Herpes_gE:  Alphaherpesvirus glycoprotein E;  InterPro: IPR003404 Glycoprotein E (gE) of Alphaherpesvirus forms a complex with glycoprotein I (gI), functioning as an immunoglobulin G (IgG) Fc binding protein. gE is involved in virus spread but is not essential for propagation [].; GO: 0016020 membrane; PDB: 2GJ7_F 2GIY_B.
Probab=23.30  E-value=60  Score=25.92  Aligned_cols=25  Identities=20%  Similarity=0.336  Sum_probs=18.6

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      ++..|++.+...+++|-|.|++.-.
T Consensus       267 ~~~~l~f~~a~~~~sGLYv~V~~~n  291 (439)
T PF02480_consen  267 NGVDLQFTNAPESASGLYVFVVYYN  291 (439)
T ss_dssp             TSSSEEESS--GGG-EEEEEEEEET
T ss_pred             CCcceEecCCCcccCceEEEEEEEC
Confidence            4457999999999999999998764


No 380
>PHA03283 envelope glycoprotein E; Provisional
Probab=20.86  E-value=1.1e+02  Score=25.01  Aligned_cols=25  Identities=16%  Similarity=0.170  Sum_probs=21.4

Q ss_pred             CCcEEEEcccCCCCCeeeEEEEecC
Q psy534          103 DGTELRISNIRSQDIGDYTCLATHV  127 (145)
Q Consensus       103 ~~~~L~i~~v~~~d~G~Y~C~a~n~  127 (145)
                      ++..|.+.+...+++|-|.|++.-.
T Consensus       313 ~~v~L~f~nap~~~SGLYVfVv~yN  337 (542)
T PHA03283        313 NRVDLLFKNAPASASGLYVFVLLYN  337 (542)
T ss_pred             CCcceEeccCCcccCceEEEEEEEC
Confidence            3457999999999999999998764


Done!