Diaphorina citri psyllid: psy5340

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
MNTHDKWERTLSLLSFAEIFPIFSQDFIQGLSVLSRGSVEEKLRWTFTLYDINGDGRITREEMTNIVTAIYELMGKFAETVLEDGSVTNRVDSVFKMTNIVTAIYELMGKFAETVLEDGSVTNRVDSVFKKMDKNQDGVVTLDEFLECCLNDEDIKRSIQVFDT
cccccccccccccHHHHccccccHHHHHHHHHHHccccHHHHHHHHHEEECccccccccHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHccHHHHHHHHcccc
****D*WERTLSLLSFAEIFPIFSQDFIQGLSVLSRGSVEEKLRWTFTLYDINGDGRITREEMTNIVTAIYELMGKFAETVLEDGSVTNRVDSVFKMTNIVTAIYELMGKFAETVLEDGSVTNRVDSVFKKMDKNQDGVVTLDEFLECCLNDEDIKRSIQVFD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTHDKWERTLSLLSFAEIFPIFSQDFIQGLSVLSRGSVEEKLRWTFTLYDINGDGRITREEMTNIVTAIYELMGKFAETVLEDGSVTNRVDSVFKMTNIVTAIYELMGKFAETVLEDGSVTNRVDSVFKKMDKNQDGVVTLDEFLECCLNDEDIKRSIQVFDT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0000287 [MF]magnesium ion bindingprobableGO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0045921 [BP]positive regulation of exocytosisprobableGO:0032879, GO:0060341, GO:0051046, GO:0051047, GO:0051049, GO:0051050, GO:0060627, GO:0065007, GO:0048522, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0017157
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0031045 [CC]dense core granuleprobableGO:0005737, GO:0043231, GO:0016023, GO:0030141, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0031410, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0031982
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016247 [MF]channel regulator activityprobableGO:0003674
GO:0048015 [BP]phosphatidylinositol-mediated signalingprobableGO:0044700, GO:0051716, GO:0044699, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0048017
GO:0008092 [MF]cytoskeletal protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0032991 [CC]macromolecular complexprobableGO:0005575
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1S6C, chain A
Confidence level:very confident
Coverage over the Query: 3-164
View the alignment between query and template
View the model in PyMOL