Diaphorina citri psyllid: psy5355

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70------
NNSDKDAKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMTESQVKVTGPERAKLAYALGMTESQVKS
cccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHcccHHHHHHHccHHHHccc
****************SGQQIFALEKTFEQTKYLAGPERAKLAYALGMTESQVKVTGPERA***************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NNSDKDAKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMTESQVKVTGPERAKLAYALGMTESQVKS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein Nkx-6.1 Transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. Involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.very confidentP78426
Homeobox protein Nkx-6.1 Transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. Involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.very confidentO35762
Homeobox protein Nkx-6.1 Transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. Involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals.very confidentQ99MA9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043565 [MF]sequence-specific DNA bindingconfidentGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:0003677, GO:1901363
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterconfidentGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0045666 [BP]positive regulation of neuron differentiationconfidentGO:0030154, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0007275, GO:0045664, GO:0065007, GO:0048518, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0008150, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0044763, GO:0051960, GO:2000026, GO:0048731, GO:0048522
GO:0007417 [BP]central nervous system developmentconfidentGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0003682 [MF]chromatin bindingconfidentGO:0003674, GO:0005488
GO:0003705 [MF]RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activityconfidentGO:0003700, GO:0003674, GO:0001071, GO:0000981
GO:0005730 [CC]nucleolusconfidentGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051594 [BP]detection of glucoseconfidentGO:0009746, GO:0009732, GO:0009730, GO:0034287, GO:0009743, GO:0034284, GO:0050896, GO:0009749, GO:0008150, GO:1901700, GO:0042221, GO:0009593, GO:0010033, GO:0051606
GO:0007224 [BP]smoothened signaling pathwayconfidentGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007154, GO:0050789, GO:0044699
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterconfidentGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0031018 [BP]endocrine pancreas developmentconfidentGO:0032502, GO:0048856, GO:0044707, GO:0032501, GO:0031016, GO:0044767, GO:0035270, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:2000078 [BP]positive regulation of type B pancreatic cell developmentprobableGO:0051239, GO:0051094, GO:0050793, GO:2000074, GO:0060284, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0030856, GO:0008150, GO:0010720, GO:0048518, GO:2000026, GO:0050789, GO:0048522
GO:0071345 [BP]cellular response to cytokine stimulusprobableGO:0051716, GO:0034097, GO:0050896, GO:0009987, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0035094 [BP]response to nicotineprobableGO:0009719, GO:0050896, GO:0010243, GO:0010033, GO:0008150, GO:0042221, GO:0043279, GO:1901698, GO:0014070
GO:0000976 [MF]transcription regulatory region sequence-specific DNA bindingprobableGO:0044212, GO:0043565, GO:0097159, GO:0003677, GO:0001067, GO:0003674, GO:0005488, GO:0003676, GO:0000975, GO:1901363
GO:0008283 [BP]cell proliferationprobableGO:0008150, GO:0044699
GO:0070491 [MF]repressing transcription factor bindingprobableGO:0008134, GO:0003674, GO:0005488, GO:0005515
GO:0021913 [BP]regulation of transcription from RNA polymerase II promoter involved in ventral spinal cord interneuron specificationprobableGO:0048856, GO:0080090, GO:0019222, GO:0060573, GO:0021515, GO:0021514, GO:0021517, GO:0030154, GO:0021511, GO:0060579, GO:0021513, GO:0032501, GO:0007275, GO:0044699, GO:0007417, GO:0007389, GO:0048869, GO:0001708, GO:2000112, GO:0050789, GO:0008150, GO:0019219, GO:0060850, GO:0065007, GO:0031326, GO:0048731, GO:0010468, GO:0021953, GO:0032502, GO:0021521, GO:0048665, GO:0048663, GO:0030182, GO:0010556, GO:0060255, GO:0031323, GO:0009987, GO:0009889, GO:0021510, GO:0060581, GO:0003002, GO:2001141, GO:0022008, GO:0050794, GO:0048699, GO:0045165, GO:0009953, GO:0007399, GO:0044707, GO:0051252, GO:0006355, GO:0006357, GO:0044763, GO:0051171
GO:0021912 [BP]regulation of transcription from RNA polymerase II promoter involved in spinal cord motor neuron fate specificationprobableGO:0032502, GO:0051252, GO:0080090, GO:0019222, GO:0021515, GO:0031326, GO:0021517, GO:0030154, GO:0031323, GO:0021510, GO:0032501, GO:0007275, GO:0044699, GO:0007417, GO:0048869, GO:0001708, GO:2000112, GO:0050789, GO:0008150, GO:0019219, GO:0060850, GO:0065007, GO:0010468, GO:0021953, GO:0021520, GO:0021522, GO:0048665, GO:0048663, GO:0030182, GO:0010556, GO:0060255, GO:0009987, GO:0009889, GO:0050794, GO:0044763, GO:0051171, GO:2001141, GO:0022008, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0006355, GO:0006357, GO:0048731
GO:0010454 [BP]negative regulation of cell fate commitmentprobableGO:0051093, GO:0050793, GO:0010453, GO:0050794, GO:0008150, GO:0045596, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0010455 [BP]positive regulation of cell fate commitmentprobableGO:0051094, GO:0050793, GO:0010453, GO:0050794, GO:0045597, GO:0045595, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0072560 [BP]type B pancreatic cell maturationprobableGO:0031018, GO:0060429, GO:0030154, GO:0048468, GO:0007569, GO:0032501, GO:0010259, GO:0007275, GO:0044699, GO:0003309, GO:0003323, GO:0002068, GO:0048513, GO:0030855, GO:0002066, GO:0002067, GO:0002064, GO:0002065, GO:0032502, GO:0031016, GO:0009987, GO:0009888, GO:0044767, GO:0035270, GO:0044763, GO:0048731, GO:0035883, GO:0044707, GO:0048856, GO:0048869, GO:0008150
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0071375 [BP]cellular response to peptide hormone stimulusprobableGO:0070887, GO:0044699, GO:0009719, GO:0051716, GO:0071417, GO:0071310, GO:0071495, GO:0009987, GO:0032870, GO:0008150, GO:0010243, GO:0042221, GO:0043434, GO:0010033, GO:1901700, GO:1901701, GO:0009725, GO:0050896, GO:1901699, GO:1901652, GO:1901653, GO:0044763, GO:1901698
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0032024 [BP]positive regulation of insulin secretionprobableGO:0090087, GO:0051046, GO:0051047, GO:0051049, GO:0023051, GO:0010646, GO:0050789, GO:0060341, GO:0065007, GO:0048518, GO:0051050, GO:0050796, GO:0050794, GO:0090276, GO:0046883, GO:0008150, GO:0046887, GO:0032879, GO:0002791, GO:0002793, GO:0090277, GO:0048522
GO:0045686 [BP]negative regulation of glial cell differentiationprobableGO:0030154, GO:0060284, GO:0050789, GO:0045685, GO:0014014, GO:0050767, GO:0014013, GO:0048869, GO:0050768, GO:0007275, GO:0008150, GO:0065007, GO:0044699, GO:0010721, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0051093, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0048731, GO:0048523
GO:0050885 [BP]neuromuscular process controlling balanceprobableGO:0032501, GO:0044707, GO:0050877, GO:0008150, GO:0050905, GO:0044699, GO:0003008
GO:0051091 [BP]positive regulation of sequence-specific DNA binding transcription factor activityprobableGO:0009889, GO:0051090, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:0044093, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0045687 [BP]positive regulation of glial cell differentiationprobableGO:0030154, GO:0050789, GO:0045685, GO:0014015, GO:0014013, GO:0048869, GO:0060284, GO:0050769, GO:0008150, GO:0065007, GO:0044699, GO:0010720, GO:0048518, GO:0032502, GO:0032501, GO:0050767, GO:0050793, GO:0009987, GO:0050794, GO:0045597, GO:0045595, GO:0044763, GO:0051239, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0051094, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0048731, GO:0048522
GO:0022010 [BP]central nervous system myelinationprobableGO:0042391, GO:0019226, GO:0021782, GO:0050801, GO:0030154, GO:0048468, GO:0042592, GO:0023052, GO:0010001, GO:0001508, GO:0007272, GO:0007275, GO:0044699, GO:0007417, GO:0042552, GO:0035637, GO:0048869, GO:0008150, GO:0065007, GO:0050877, GO:0019725, GO:0065008, GO:0032502, GO:0032501, GO:0032291, GO:0019228, GO:0009987, GO:0048709, GO:0042063, GO:0006873, GO:0044767, GO:0044763, GO:0008366, GO:0014003, GO:0007154, GO:0022008, GO:0003008, GO:0044700, GO:0044707, GO:0007399, GO:0048856, GO:0048878, GO:0055082, GO:0048731
GO:0048646 [BP]anatomical structure formation involved in morphogenesisprobableGO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0050774 [BP]negative regulation of dendrite morphogenesisprobableGO:0022604, GO:0044707, GO:0051239, GO:0022603, GO:0030154, GO:0051129, GO:0051128, GO:0060284, GO:0031345, GO:0031344, GO:0044699, GO:0050767, GO:0048869, GO:0050768, GO:0050789, GO:0045664, GO:0010769, GO:0065007, GO:0010721, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045596, GO:0045595, GO:0044763, GO:0010975, GO:0048731, GO:0022008, GO:0051093, GO:0048699, GO:0007399, GO:0050773, GO:0048856, GO:0051960, GO:2000026, GO:0048814, GO:0007275, GO:0008150, GO:0048523
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0042471 [BP]ear morphogenesisprobableGO:0048598, GO:0032502, GO:0009887, GO:0048562, GO:0044707, GO:0007423, GO:0048568, GO:0032501, GO:0048856, GO:0044767, GO:0009790, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0009653, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3A03, chain A
Confidence level:very confident
Coverage over the Query: 16-66
View the alignment between query and template
View the model in PyMOL