Diaphorina citri psyllid: psy5364


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------
MSLRRRRINLRTEGEGVDVPGSPFTVRVSGAPDASKVRVYGPGIEHGVLATFQSRFICDTRGAGAGQLTVRVRGPKGF
cccccEEEEEEEEEccCCcccccEEEEEccccccccEEEEcccccccEEEcccEEEEEEcccccccccEEEEEccccc
MSLRRRRINLRTEGEGVDVPGSPFTVRVSGAPDASKVRVYGPGIEHGVLATFQSRFICDTRGAGAGQLTVRVRGPKG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLRRRRINLRTEGEGVDVPGSPFTVRVSGAPDASKVRVYGPGIEHGVLATFQSRFICDTRGAGAGQLTVRVRGPKGF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048104 [BP]establishment of body hair or bristle planar orientationprobableGO:0032502, GO:0002009, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0001738, GO:0007164, GO:0048729, GO:0008150, GO:0009653, GO:0001736, GO:0044699
GO:0009612 [BP]response to mechanical stimulusprobableGO:0009628, GO:0050896, GO:0008150, GO:0009605
GO:0003779 [MF]actin bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0015629 [CC]actin cytoskeletonprobableGO:0005856, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0018996 [BP]molting cycle, collagen and cuticulin-based cuticleprobableGO:0008150, GO:0032501, GO:0042303, GO:0044699, GO:0044707
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DI9, chain A
Confidence level:very confident
Coverage over the Query: 5-77
View the alignment between query and template
View the model in PyMOL