Diaphorina citri psyllid: psy5368

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400------

MVRYGTVRYGTVRLGSVKYGQVQLSTVRYGKVRYSQVRSDTVRSGTVRYDIVGSSTIRYGELQYDTVQNSQIRLGTVKYSQVRYDTITSHSEFERPRAGLSNLRAPEGRKRPRYVYIILEYCDGGDLCSFIRSHEKLSEFQCQQFVRQLVLALKFLRENNVCHFDLKPQNILIKNNTLKLADFGFAQFLAPNDQGDSIQGSPLYMAPEILAGSPYNAKADLWSLGVLVFEALFGHAPYASCNLSQLRAQALSSAPITIPPNSLSPDCMDFLSRLLQKDPMRRISYEDLFSHPYPDLIHAPCAESHQTAIRIVTDAIHHDRENNSRRAFSLYCEALNYLIPLAYDVLAEAIPNLKSGLEIGETGDMYLAEGNYELALEKLKASLAILIQFCEAETSSSQLKPLLAHQ

cccccccccccCCcccccccccccccEEccccccccccccccccccEEEEEEEEEEEEEEEEEEECccccEEEEEEEEccccccccHHHHHHHHHHcccccccccccCECccccEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccEEEcccccccccccccccccccccccccHHHHcccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccHHHHHccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccccccccccHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccc

***YGTVRYGTVRLGSVKYGQVQLSTVRYGKVRYSQVRSDTVRSGTVRYDIVGSSTIRYGELQYDTVQNSQIRLGTVKYSQVRYDTITSHSEFERPRAGLSNLRAPEGRKRPRYVYIILEYCDGGDLCSFIRSHEKLSEFQCQQFVRQLVLALKFLRENNVCHFDLKPQNILIKNNTLKLADFGFAQFLAPNDQGDSIQGSPLYMAPEILAGSPYNAKADLWSLGVLVFEALFGHAPYASCNLSQLRAQALSSAPITIPPNSLSPDCMDFLSRLLQKDPMRRISYEDLFSHPYPDLIHAPCAESHQTAIRIVTDAIHHDRENNSRRAFSLYCEALNYLIPLAYDVLAEAIPNLKSGLEIGETGDMYLAEGNYELALEKLKASLAILIQFC****************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Probable spindle assembly checkpoint kinase homolog	Required for high-fidelity chromosome segregation during the later part of each cell cycle. Has a role in attaching the kinetochores to the microtubules and ensuring that sister kinetochores connect to opposite poles. The promotion of bi-orientation is achieved by selectively detaching kinetochore-microtubule attachments that are not under tension.	confident	Q8SRL5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0035556 [BP]	intracellular signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0000287 [MF]	magnesium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0006974 [BP]	response to DNA damage stimulus	probable	GO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0033554, GO:0008150, GO:0044699
GO:0018105 [BP]	peptidyl-serine phosphorylation	probable	GO:0044267, GO:0006468, GO:0018209, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004674 [MF]	protein serine/threonine kinase activity	probable	GO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0005935 [CC]	cellular bud neck	probable	GO:0005575, GO:0044464, GO:0030427, GO:0005623, GO:0005933
GO:0000775 [CC]	chromosome, centromeric region	probable	GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0010604 [BP]	positive regulation of macromolecule metabolic process	probable	GO:0009893, GO:0019222, GO:0060255, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0000407 [CC]	pre-autophagosomal structure	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009967 [BP]	positive regulation of signal transduction	probable	GO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0042594 [BP]	response to starvation	probable	GO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0006950, GO:0008150
GO:0048856 [BP]	anatomical structure development	probable	GO:0032502, GO:0008150
GO:0048523 [BP]	negative regulation of cellular process	probable	GO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0010259 [BP]	multicellular organismal aging	probable	GO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0000794 [CC]	condensed nuclear chromosome	probable	GO:0031974, GO:0043229, GO:0043228, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0005694, GO:0000793, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044422
GO:0051233 [CC]	spindle midzone	probable	GO:0043234, GO:0005856, GO:0005819, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0043226, GO:0015630
GO:0048869 [BP]	cellular developmental process	probable	GO:0032502, GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0005524 [MF]	ATP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0000131 [CC]	incipient cellular bud site	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005881 [CC]	cytoplasmic microtubule	probable	GO:0005737, GO:0043234, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0005856, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044430, GO:0044424, GO:0043228, GO:0005874, GO:0043226, GO:0044422
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0016023 [CC]	cytoplasmic membrane-bounded vesicle	probable	GO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0044093 [BP]	positive regulation of molecular function	probable	GO:0008150, GO:0065009, GO:0065007
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0006996 [BP]	organelle organization	probable	GO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0046777 [BP]	protein autophosphorylation	probable	GO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0043005 [CC]	neuron projection	probable	GO:0005575, GO:0097458, GO:0042995, GO:0044464, GO:0005623
GO:0031325 [BP]	positive regulation of cellular metabolic process	probable	GO:0009893, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0005813 [CC]	centrosome	probable	GO:0005856, GO:0005575, GO:0015630, GO:0043232, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0043228, GO:0044430, GO:0044424, GO:0005622, GO:0043226, GO:0044422
GO:0051090 [BP]	regulation of sequence-specific DNA binding transcription factor activity	probable	GO:0009889, GO:0019219, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0006355, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0065009, GO:0010468
GO:0042981 [BP]	regulation of apoptotic process	probable	GO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0009628 [BP]	response to abiotic stimulus	probable	GO:0050896, GO:0008150
GO:0005940 [CC]	septin ring	probable	GO:0005856, GO:0005737, GO:0043228, GO:0005575, GO:0043232, GO:0044464, GO:0071944, GO:0043229, GO:0005623, GO:0032156, GO:0044446, GO:0044444, GO:0044430, GO:0005938, GO:0044424, GO:0005622, GO:0043226, GO:0044448, GO:0044422
GO:0007569 [BP]	cell aging	probable	GO:0032502, GO:0007568, GO:0009987, GO:0044767, GO:0044763, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XRW, chain A
Confidence level:very confident
Coverage over the Query: 3-42,73-185,202-299
View the alignment between query and template
View the model in PyMOL

Template: 2X7F, chain A
Confidence level:very confident
Coverage over the Query: 39-187,200-298
View the alignment between query and template
View the model in PyMOL

Template: 3MWU, chain A
Confidence level:very confident
Coverage over the Query: 56-395
View the alignment between query and template
View the model in PyMOL