Query         psy5392
Match_columns 100
No_of_seqs    123 out of 368
Neff          5.7 
Searched_HMMs 46136
Date          Sat Aug 17 01:25:49 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5392.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5392hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3611|consensus              100.0 1.1E-41 2.3E-46  289.4   6.8  100    1-100   191-295 (737)
  2 smart00630 Sema semaphorin dom 100.0 2.4E-37 5.2E-42  246.9   9.0   99    2-100   106-216 (390)
  3 PF01403 Sema:  Sema domain;  I 100.0 2.6E-30 5.7E-35  206.4   8.4   99    2-100   141-252 (433)
  4 COG2947 Uncharacterized conser  56.8       8 0.00017   28.1   1.8   62   20-89     33-108 (156)
  5 COG3350 Uncharacterized conser  26.6      45 0.00098   20.2   1.4   22   23-46     17-38  (53)
  6 cd00559 Cyanase_C Cyanase C-te  23.0      38 0.00082   21.5   0.6    8    1-8       4-11  (69)
  7 PF12996 DUF3880:  DUF based on  22.4      39 0.00084   21.0   0.6   28    2-29     49-76  (79)
  8 PF00045 Hemopexin:  Hemopexin;  22.1      93   0.002   16.9   2.1   11   28-38      4-15  (45)
  9 PHA02658 hypothetical protein;  21.8      47   0.001   21.5   0.9    9   59-67     43-51  (92)
 10 PF13964 Kelch_6:  Kelch motif   21.5      88  0.0019   17.1   1.9   17   27-43      6-22  (50)
 11 PF04146 YTH:  YT521-B-like dom  21.1      33 0.00071   23.8   0.1   56   22-84     31-93  (140)
 12 TIGR02616 tnaC_leader tryptoph  20.7      40 0.00086   17.6   0.3   18   14-40      5-22  (26)

No 1  
>KOG3611|consensus
Probab=100.00  E-value=1.1e-41  Score=289.42  Aligned_cols=100  Identities=66%  Similarity=1.127  Sum_probs=96.0

Q ss_pred             CCCeeecC-----CccccccCccCCCCCceEEeeecCCEEEEEEeeeccccccCCceeeEEEeeeecCCCCCCcccccce
Q psy5392           1 MDPIIYRE-----PLQTEQYDSMSLNAPNFVSSLTQGDFVYFFFRETAVEFINCGKAVYSRVARVCKYDRGGPHRFRNRW   75 (100)
Q Consensus         1 ~~~~i~R~-----~lrTe~~~~~wl~~p~FV~~~~~~dkvYffF~E~a~e~~~~~~~~~srVaRVCk~D~GG~~~L~~kW   75 (100)
                      .||+|||+     +|||++||++|||+|+||+++.++|+|||||||.++|...+++.++||||||||||+||++.|+++|
T Consensus       191 ~d~~I~Rs~g~~~~lrT~~~dskwLneP~FV~a~~i~~~vyFFFrE~a~e~~~~~~~v~sRVARVCknD~GG~~~l~~~W  270 (737)
T KOG3611|consen  191 SDALIYRSLGKNPTLRTVKYDSKWLNEPNFVGAFDIGDHVYFFFREIAVENNNCGKAVYSRVARVCKNDVGGRRVLEKKW  270 (737)
T ss_pred             CCceEEEecCCCCCceeccCCchhccCCcEEEeeeeCCEEEEEecccccccCcccceEEeeeeeEeccCCCCceEcccch
Confidence            48999993     7999999999999999999999999999999999999767999999999999999999999999999


Q ss_pred             eeeeeeeeccCCCCCCCCcCccccC
Q psy5392          76 TSFLKSRLNCSVPGDFPFYFDEIQV  100 (100)
Q Consensus        76 tTFlKArL~Cs~p~~~~~~fn~lq~  100 (100)
                      ||||||||+||+||+.+||||+||+
T Consensus       271 TSFLKARL~CSvp~~~~fyFn~lq~  295 (737)
T KOG3611|consen  271 TSFLKARLNCSVPGDSPFYFNELQS  295 (737)
T ss_pred             hHhhhhheecccCCCCCCcccccce
Confidence            9999999999999989999999995


No 2  
>smart00630 Sema semaphorin domain.
Probab=100.00  E-value=2.4e-37  Score=246.95  Aligned_cols=99  Identities=67%  Similarity=1.121  Sum_probs=93.8

Q ss_pred             CCeeecC------------CccccccCccCCCCCceEEeeecCCEEEEEEeeeccccccCCceeeEEEeeeecCCCCCCc
Q psy5392           2 DPIIYRE------------PLQTEQYDSMSLNAPNFVSSLTQGDFVYFFFRETAVEFINCGKAVYSRVARVCKYDRGGPH   69 (100)
Q Consensus         2 ~~~i~R~------------~lrTe~~~~~wl~~p~FV~~~~~~dkvYffF~E~a~e~~~~~~~~~srVaRVCk~D~GG~~   69 (100)
                      +|+|+|+            .+||+.++++||++|+||++|..|++|||||+|++.|.+.+++.++||||||||||.||++
T Consensus       106 ~~~i~r~~~~r~l~~~~~~~l~t~~~~~~~l~~~~FV~sf~~~~~vYFff~e~~~e~~~~~~~~~SRVaRVCk~D~Gg~~  185 (390)
T smart00630      106 DPAIPRSLSVRRLKGTSGVSLRTVLYDSKWLNEPNFVYAFESGDFVYFFFRETAVEDDNCGKAVHSRVARVCKNDVGGPR  185 (390)
T ss_pred             CcceeccccccccccccCceeeccccCcccccCCcEEEEEEcCCEEEEEEEEEccccCcCCceeeeeeeeecccCcCccc
Confidence            5788884            5799999999999999999999999999999999999888899999999999999999999


Q ss_pred             ccccceeeeeeeeeccCCCCCCCCcCccccC
Q psy5392          70 RFRNRWTSFLKSRLNCSVPGDFPFYFDEIQV  100 (100)
Q Consensus        70 ~L~~kWtTFlKArL~Cs~p~~~~~~fn~lq~  100 (100)
                      +|+++||||+||||+|+.||+.++|||+||+
T Consensus       186 ~l~~~wtSflka~L~Cs~~g~~~~~fn~lQ~  216 (390)
T smart00630      186 SLDKKWTSFLKARLECSVPGESPFYFNELQA  216 (390)
T ss_pred             cccccccEEEEEEEEecCCCcCCccchhhhh
Confidence            9999999999999999999988999999996


No 3  
>PF01403 Sema:  Sema domain;  InterPro: IPR001627 The Sema domain occurs in semaphorins, which are a large family of secreted and transmembrane proteins, some of which function as repellent signals during axon guidance. Sema domains also occur in a hepatocyte growth factor receptor, in SEX protein [] and in viral proteins. CD100 (also called SEMA4D) is associated with PTPase and serine kinase activity. CD100 increases PMA, CD3 and CD2 induced T cell proliferation, increases CD45 induced T cell adhesion, induces B cell homotypic adhesion and down-regulates B cell expression of CD23.  The Sema domain is characterised by a conserved set of cysteine residues, which form four disulphide bonds to stabilise the structure. The Sema domain fold is a variation of the beta propeller topology, with seven blades radially arranged around a central axis. Each blade contains a four- stranded (strands A to D) antiparallel beta sheet. The inner strand of each blade (A) lines the channel at the centre of the propeller, with strands B and C of the same repeat radiating outward, and strand D of the next repeat forming the outer edge of the blade. The large size of the Sema domain is not due to a single inserted domain but results from the presence of additional secondary structure elements inserted in most of the blades. The Sema domain uses a 'loop and hook' system to close the circle between the first and the last blades. The blades are constructed sequentially with an N-terminal beta- strand closing the circle by providing the outermost strand (D) of the seventh (C-terminal) blade. The beta-propeller is further stabilised by an extension of the N terminus, providing an additional, fifth beta-strand on the outer edge of blade 6 [, , ]. CD molecules are leucocyte antigens on cell surfaces. CD antigens nomenclature is updated at Protein Reviews On The Web (http://prow.nci.nih.gov/). ; GO: 0005515 protein binding; PDB: 3NVX_A 3NVQ_A 3OL2_A 1OLZ_B 3OKT_A 3AL9_B 3OKY_A 3AL8_B 3NVN_A 3OKW_A ....
Probab=99.96  E-value=2.6e-30  Score=206.40  Aligned_cols=99  Identities=66%  Similarity=1.131  Sum_probs=92.0

Q ss_pred             CCeeec-----CCccccccCccCCCCCceEEeeecC-------CEEEEEEeeeccccccCCceeeEEEeeeecCCCCCCc
Q psy5392           2 DPIIYR-----EPLQTEQYDSMSLNAPNFVSSLTQG-------DFVYFFFRETAVEFINCGKAVYSRVARVCKYDRGGPH   69 (100)
Q Consensus         2 ~~~i~R-----~~lrTe~~~~~wl~~p~FV~~~~~~-------dkvYffF~E~a~e~~~~~~~~~srVaRVCk~D~GG~~   69 (100)
                      +|+|+|     ..++|+.++++|+++|+||+++.++       ++|||||+|.+.+....++.++||||||||+|.||.+
T Consensus       141 ~~~i~R~~~~~~~l~~~~~~~~~~~~p~fv~~~~~~~v~~f~~~~vYF~f~e~~~~~~~~~~~~~srvaRvCk~D~g~~~  220 (433)
T PF01403_consen  141 SPIISRSLGSQPPLRTEQYDSKWLNEPSFVSSFEIGYVYGFSDDFVYFFFRERASEYDSCGKPYYSRVARVCKNDPGGYS  220 (433)
T ss_dssp             SEEEEEEETSSSTEESCCCCTTSSSSTEEEEEEEEEECEEEETTEEEEEEEEEESSSSTSSCCEEEEEEEEETTSSTBSS
T ss_pred             CcceeecccccccccccccccccccccccccccccccccccCCcEEEEEEEeeccccccccccceeeeeeccccCCcccc
Confidence            689999     3689999999999999999998877       9999999999999987889999999999999999998


Q ss_pred             ccccceeeeeeeeeccCCCC-CCCCcCccccC
Q psy5392          70 RFRNRWTSFLKSRLNCSVPG-DFPFYFDEIQV  100 (100)
Q Consensus        70 ~L~~kWtTFlKArL~Cs~p~-~~~~~fn~lq~  100 (100)
                      .++++||||+||||+|+.|+ ..|++||+||+
T Consensus       221 ~~e~~wttf~karL~C~~~~~~~~~~fn~lq~  252 (433)
T PF01403_consen  221 YLEPLWTTFLKARLNCSVPGDGSPFYFNELQA  252 (433)
T ss_dssp             SCCTBESSEEEEEEECEETTCSCTEECHEEEE
T ss_pred             chhhccccccccceeccccCcCCCchhhhhhh
Confidence            87799999999999999999 67899999985


No 4  
>COG2947 Uncharacterized conserved protein [Function unknown]
Probab=56.82  E-value=8  Score=28.13  Aligned_cols=62  Identities=27%  Similarity=0.607  Sum_probs=39.6

Q ss_pred             CCCCceEEeeecCCEEEEEEeeeccccccCCceeeEEEeeeecCCCCCCccc--------------ccceeeeeeeeecc
Q psy5392          20 LNAPNFVSSLTQGDFVYFFFRETAVEFINCGKAVYSRVARVCKYDRGGPHRF--------------RNRWTSFLKSRLNC   85 (100)
Q Consensus        20 l~~p~FV~~~~~~dkvYffF~E~a~e~~~~~~~~~srVaRVCk~D~GG~~~L--------------~~kWtTFlKArL~C   85 (100)
                      ...-+|+-...+||+++|.- -      .|...-+.-+++||..+.--.-..              ..+|.+ +.++.++
T Consensus        33 YqARNfmR~M~iGD~~fFYH-S------Nc~~pgIvGl~~V~~~a~pD~tq~d~~spYyDPka~~e~pRW~~-Vdv~~v~  104 (156)
T COG2947          33 YQARNFMRDMKIGDLGFFYH-S------NCKPPGIVGLAEVCALAHPDPTQFDPASPYYDPKATPEDPRWYC-VDVRFVR  104 (156)
T ss_pred             HHHHHHHHhcccCceEEEEe-c------CCCCCCceehhhhhhccCCCccccCCCCcccCcccccCCCCeeE-EeeHHHh
Confidence            34567888888999884433 2      233344577999997655432222              568988 7777777


Q ss_pred             CCCC
Q psy5392          86 SVPG   89 (100)
Q Consensus        86 s~p~   89 (100)
                      ..+.
T Consensus       105 ~~~~  108 (156)
T COG2947         105 KLPR  108 (156)
T ss_pred             hcCC
Confidence            7664


No 5  
>COG3350 Uncharacterized conserved protein [Function unknown]
Probab=26.64  E-value=45  Score=20.16  Aligned_cols=22  Identities=32%  Similarity=0.489  Sum_probs=16.8

Q ss_pred             CceEEeeecCCEEEEEEeeecccc
Q psy5392          23 PNFVSSLTQGDFVYFFFRETAVEF   46 (100)
Q Consensus        23 p~FV~~~~~~dkvYffF~E~a~e~   46 (100)
                      ..|.++  .++|.|+|-+|...+.
T Consensus        17 a~~k~~--Y~GktYYFcse~~~~~   38 (53)
T COG3350          17 AEYKSS--YGGKTYYFCSEECKEK   38 (53)
T ss_pred             cceeEE--eCCEEEEEeCHHHHHH
Confidence            455555  6899999999998664


No 6  
>cd00559 Cyanase_C Cyanase C-terminal domain. Cyanase (Cyanate lyase) is responsible for the hydrolysis of cyanate.  It catalyzes the reaction of cyanate with bicarbonate to produce ammonia and carbon dioxide. This allows organisms that possess the enzyme to overcome the toxicity of environmental cyanate and to use cyanate as a source of nitrogen for growth. This enzyme is a homodecamer, formed by five dimers. Each monomer is composed of two domains, an N-terminal helix-turn-helix and this structurally unique C-terminal domain.
Probab=22.98  E-value=38  Score=21.55  Aligned_cols=8  Identities=63%  Similarity=1.128  Sum_probs=6.2

Q ss_pred             CCCeeecC
Q psy5392           1 MDPIIYRE    8 (100)
Q Consensus         1 ~~~~i~R~    8 (100)
                      +||+|||.
T Consensus         4 tDP~iYRl   11 (69)
T cd00559           4 TDPLIYRF   11 (69)
T ss_pred             CCceeeeh
Confidence            58888884


No 7  
>PF12996 DUF3880:  DUF based on E. rectale Gene description (DUF3880);  InterPro: IPR024542 This entry represents proteins of unknown function. The Eubacterium rectale gene appears to be upregulated in the presence of Bacteroides thetaiotaomicron compared to growth in pure culture [].
Probab=22.35  E-value=39  Score=21.03  Aligned_cols=28  Identities=21%  Similarity=0.157  Sum_probs=17.1

Q ss_pred             CCeeecCCccccccCccCCCCCceEEee
Q psy5392           2 DPIIYREPLQTEQYDSMSLNAPNFVSSL   29 (100)
Q Consensus         2 ~~~i~R~~lrTe~~~~~wl~~p~FV~~~   29 (100)
                      +|.++|...........+..|-.|||+.
T Consensus        49 ~~~~~~p~~~~~~~~~~~~~dIsFVG~~   76 (79)
T PF12996_consen   49 NPERFRPIPVDPEERKKYECDISFVGSL   76 (79)
T ss_pred             CHHHhCcccCCcccccccCCCEEEeCcC
Confidence            3445554444322345788999999974


No 8  
>PF00045 Hemopexin:  Hemopexin;  InterPro: IPR018487 Hemopexin (3.2.1.35 from EC) is a serum glycoprotein that binds haem and transports it to the liver for breakdown and iron recovery, after which the free hemopexin returns to the circulation []. Hemopexin prevents haem-mediated oxidative stress. Structurally hemopexin consists of two similar halves of approximately two hundred amino acid residues connected by a histidine-rich hinge region. Each half is itself formed by the repetition of a basic unit of some 35 to 45 residues. Hemopexin-like domains have been found in two other types of proteins, vitronectin [], a cell adhesion and spreading factor found in plasma and tissues, and matrixins MMP-1, MMP-2, MMP-3, MMP-9, MMP-10, MMP-11, MMP-12, MMP-14, MMP-15 and MMP-16, members of the matrix metalloproteinase family that cleave extracellular matrix constituents []. These zinc endopeptidases, which belong to MEROPS peptidase subfamily M10A, have a single hemopexin-like domain in their C-terminal section. It is suggested that the hemopexin domain facilitates binding to a variety of molecules and proteins, for example the HX repeats of some matrixins bind tissue inhibitor of metallopeptidases (TIMPs). This entry represents the repeat found in hempoxein and related domains.; PDB: 1SU3_B 2CLT_B 3V6N_B 3C7X_A 1GXD_A 1RTG_A 1CK7_A 1GEN_A 1ITV_A 2JXY_A ....
Probab=22.12  E-value=93  Score=16.90  Aligned_cols=11  Identities=36%  Similarity=0.775  Sum_probs=6.1

Q ss_pred             eeecC-CEEEEE
Q psy5392          28 SLTQG-DFVYFF   38 (100)
Q Consensus        28 ~~~~~-dkvYff   38 (100)
                      ++..+ +++|||
T Consensus         4 a~~~~~g~~yfF   15 (45)
T PF00045_consen    4 AFQWGNGKTYFF   15 (45)
T ss_dssp             EEEETTTEEEEE
T ss_pred             EEEeCCCcEEEE
Confidence            34444 677665


No 9  
>PHA02658 hypothetical protein; Provisional
Probab=21.76  E-value=47  Score=21.54  Aligned_cols=9  Identities=56%  Similarity=0.922  Sum_probs=6.8

Q ss_pred             eeecCCCCC
Q psy5392          59 RVCKYDRGG   67 (100)
Q Consensus        59 RVCk~D~GG   67 (100)
                      -|||||.-|
T Consensus        43 yvckndttg   51 (92)
T PHA02658         43 YVCKNDTTG   51 (92)
T ss_pred             eeccCCCCC
Confidence            479999655


No 10 
>PF13964 Kelch_6:  Kelch motif
Probab=21.53  E-value=88  Score=17.07  Aligned_cols=17  Identities=24%  Similarity=0.311  Sum_probs=11.4

Q ss_pred             EeeecCCEEEEEEeeec
Q psy5392          27 SSLTQGDFVYFFFRETA   43 (100)
Q Consensus        27 ~~~~~~dkvYffF~E~a   43 (100)
                      ++...+++||+|=-..+
T Consensus         6 s~v~~~~~iyv~GG~~~   22 (50)
T PF13964_consen    6 SAVVVGGKIYVFGGYDN   22 (50)
T ss_pred             EEEEECCEEEEECCCCC
Confidence            45557889998754443


No 11 
>PF04146 YTH:  YT521-B-like domain;  InterPro: IPR007275 A protein of the YTH family has been shown to selectively remove transcripts of meiosis-specific genes expressed in mitotic cells []. It has been speculated that in higher eukaryotic YTH-family members may be involved in similar mechanaisms to suppress gene regulation during gametogenesis or general silencing. The rat protein YT521-B, Q9QY02 from SWISSPROT, is a tyrosine-phosphorylated nuclear protein, that interacts with the nuclear transcriptosomal component scaffold attachment factor B, and the 68kDa Src substrate associated during mitosis, Sam68. In vivo splicing assays demonstrated that YT521-B modulates alternative splice site selection in a concentration-dependent manner []. The domain is predicted to have four alpha helices and six beta strands [].  In plant cells environmental stimuli, which light, pathogens, hormones, and abiotic stresses, elicit changes in the cytosolic Ca levels but little is known of the cytosolic-nuclear Ca-signaling pathway; where gene regulation occurs to respond appropriately to the stress. It has been demonstrated that two novel Arabidopsis thaliana (Mouse-ear cress) proteins, (ECT1 and ECT2), specifically associated with Calcineurin B-Like-Interacting Protein Kinase1 (CIPK1), a member of Ser/Thr protein kinases that interact with the calcineurin B-like Ca-binding proteins. These two proteins contain a very similar C-terminal region (180 amino acids in length, 81% similarity), which is required and sufficient for both interaction with CIPK1 and translocation to the nucleus. This domain, the YTH-domain, is conserved across all eukaryotes and suggests that the conserved C-terminal region plays a critical role in relaying the cytosolic Ca-signals to the nucleus, thereby regulating gene expression [].; PDB: 2YUD_A 2YU6_A.
Probab=21.13  E-value=33  Score=23.85  Aligned_cols=56  Identities=16%  Similarity=0.341  Sum_probs=29.8

Q ss_pred             CCceEEeeecCCEEEEEEeeeccccccCCceeeEEEeeeecC-CCCCCcc------cccceeeeeeeeec
Q psy5392          22 APNFVSSLTQGDFVYFFFRETAVEFINCGKAVYSRVARVCKY-DRGGPHR------FRNRWTSFLKSRLN   84 (100)
Q Consensus        22 ~p~FV~~~~~~dkvYffF~E~a~e~~~~~~~~~srVaRVCk~-D~GG~~~------L~~kWtTFlKArL~   84 (100)
                      ++..-.||...+.||+||+.+....       +--+|||+.. |.+....      ...+|....+.+=+
T Consensus        31 ~~~L~~Af~~~~~V~L~FSvn~S~~-------F~G~A~M~s~~~~~~~~~~w~~~~~~~~~~g~F~v~Wl   93 (140)
T PF04146_consen   31 EKKLNEAFKESRNVYLFFSVNGSGH-------FQGYARMTSPIDPDSPKPFWQQDSSSSKWGGPFRVEWL   93 (140)
T ss_dssp             HHHHHHHHHHSS-EEEEEEETTTSE-------EEEEEEEECECCSSS------SS-SGCGG-SEEEEEEE
T ss_pred             hHHHHHHHHhCCCEEEEEeecCcce-------EEEEEEEccCCCCcccCccccccccccccCCceEEEEE
Confidence            3444456666779999999876443       2447777642 2221111      23577776666533


No 12 
>TIGR02616 tnaC_leader tryptophanase leader peptide. Members of this family are the apparent leader peptides of tryptophanase operons in Esherichia coli, Vibrio cholerae, Photobacterium profundum, Haemophilus influenzae type b, and related species. All members of the seed alignment are examples ORFs upstream of tryptophanase, with a start codon, a conserved single Trp residue, and several other conserved residues. It is suggested (Konan KV and Yanofsky C) that the nascent peptide interacts with the ribosome once (if) the ribosome reaches the stop codon. Note that this model describes a much broader set (and shorter protein region) than Pfam model pfam08053.
Probab=20.69  E-value=40  Score=17.57  Aligned_cols=18  Identities=28%  Similarity=0.266  Sum_probs=11.4

Q ss_pred             ccCccCCCCCceEEeeecCCEEEEEEe
Q psy5392          14 QYDSMSLNAPNFVSSLTQGDFVYFFFR   40 (100)
Q Consensus        14 ~~~~~wl~~p~FV~~~~~~dkvYffF~   40 (100)
                      .-.++|.|         +|.++-|||-
T Consensus         5 ~~~s~Wfn---------iD~rIsf~FP   22 (26)
T TIGR02616         5 CVLSKWFN---------IDNRISFFFP   22 (26)
T ss_pred             ccCCceEE---------cchhheeccc
Confidence            34567877         6667766663


Done!