Diaphorina citri psyllid: psy5392


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100
MDPIIYREPLQTEQYDSMSLNAPNFVSSLTQGDFVYFFFRETAVEFINCGKAVYSRVARVCKYDRGGPHRFRNRWTSFLKSRLNCSVPGDFPFYFDEIQV
ccccccccccccccccccccccccCEEccccccEEEEEEEEccccccccccEEEEEEEEEEECcccccccccccccEEEEEEECcccccccccccccccc
MDPIIYREPLQTEQYDSMSLNAPNFVSSLTQGDFVYFFFRETAVEFINCGKAVYSRVARVCKYDRGGPHRFRNRWTSFLKSRLNCSVPGDFPFYFDEIQV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDPIIYREPLQTEQYDSMSLNAPNFVSSLTQGDFVYFFFRETAVEFINCGKAVYSRVARVCKYDRGGPHRFRNRWTSFLKSRLNCSVPGDFPFYFDEIQV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Semaphorin-1A Plays a role in growth cones guidance.very confidentQ24322
Semaphorin-5A May act as positive axonal guidance cues.confidentQ13591
Semaphorin-5A Bifunctional axonal guidance cue regulated by sulfated proteoglycans; attractive effects result from interactions with heparan sulfate proteoglycans (HSPGs), while the inhibitory effects depend on interactions with chondroitin sulfate proteoglycans (CSPGs). Ligand for receptor PLXNB3. In glioma cells, SEMA5A stimulation of PLXNB3 results in the disassembly of F-actin stress fibers, disruption of focal adhesions and cellular collapse as well as inhibition of cell migration and invasion through ARHGDIA-mediated inactivation of RAC1. May promote angiogenesis by increasing endothelial cell proliferation and migration and inhibiting apoptosis.confidentD3ZTD8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0048813 [BP]dendrite morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0016358, GO:0031175, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0048812, GO:0044763
GO:2000305 [BP]semaphorin-plexin signaling pathway involved in regulation of photoreceptor cell axon guidanceprobableGO:0022604, GO:0048856, GO:0051239, GO:0032101, GO:0030154, GO:0048583, GO:0051128, GO:0050920, GO:0007165, GO:0007166, GO:0050789, GO:0044699, GO:0050767, GO:0051716, GO:0048869, GO:0022603, GO:0060284, GO:0031344, GO:0008150, GO:0045664, GO:0010769, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050795, GO:0050794, GO:0045595, GO:0044763, GO:0010975, GO:0048731, GO:0007154, GO:0022008, GO:0044707, GO:0044700, GO:0048699, GO:0040012, GO:0050770, GO:0007399, GO:2000289, GO:0050896, GO:0071526, GO:0051960, GO:2000026, GO:0007275, GO:0023052
GO:0048854 [BP]brain morphogenesisprobableGO:0032502, GO:0009887, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699, GO:0007417
GO:0007416 [BP]synapse assemblyprobableGO:0032502, GO:0050808, GO:0044707, GO:0007399, GO:0032501, GO:0009987, GO:0048856, GO:0016043, GO:0008150, GO:0022607, GO:0044763, GO:0071840, GO:0048731, GO:0007275, GO:0044699, GO:0044085
GO:0008039 [BP]synaptic target recognitionprobableGO:0048666, GO:0008037, GO:0048699, GO:0032501, GO:0030182, GO:0044707, GO:0048869, GO:0030154, GO:0048468, GO:0007399, GO:0008038, GO:0044767, GO:0044763, GO:0048731, GO:0007275, GO:0008150, GO:0009987, GO:0032502, GO:0022008, GO:0044699, GO:0048856
GO:0045792 [BP]negative regulation of cell sizeprobableGO:0071840, GO:0009987, GO:0016043, GO:0090066, GO:0008361, GO:0065007, GO:0044763, GO:0044699, GO:0008150, GO:0065008, GO:0032535
GO:0016199 [BP]axon midline choice point recognitionprobableGO:0008037, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0008038, GO:0044767, GO:0044763, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0032990, GO:0048858, GO:0040011, GO:0048699, GO:0009605, GO:0044707, GO:0050896, GO:0048856, GO:0007399, GO:0016198, GO:0032502, GO:0048812, GO:0008150
GO:0031987 [BP]locomotion involved in locomotory behaviorprobableGO:0040011, GO:0007626, GO:0044708, GO:0050896, GO:0007610, GO:0008150
GO:0030215 [MF]semaphorin receptor bindingprobableGO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0001964 [BP]startle responseprobableGO:0032501, GO:0044707, GO:0009605, GO:0050877, GO:0050896, GO:0008150, GO:0050905, GO:0044699, GO:0003008
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0008046 [MF]axon guidance receptor activityprobableGO:0038023, GO:0060089, GO:0004888, GO:0003674, GO:0004872, GO:0004871
GO:0061138 [BP]morphogenesis of a branching epitheliumprobableGO:0032502, GO:0002009, GO:0048856, GO:0044707, GO:0032501, GO:0060429, GO:0009888, GO:0044767, GO:0001763, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0045499 [MF]chemorepellent activityprobableGO:0003674
GO:0006928 [BP]cellular component movementprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0030334 [BP]regulation of cell migrationprobableGO:0051270, GO:0050794, GO:0008150, GO:0040012, GO:2000145, GO:0065007, GO:0032879, GO:0050789
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q47, chain A
Confidence level:very confident
Coverage over the Query: 2-100
View the alignment between query and template
View the model in PyMOL