Diaphorina citri psyllid: psy5397

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MAGFQAVLGKIHHEYVNNTPKKLKIIDAYLFYILLTGAFQFLYCCLVGTFPFNSFLSGFISCVSSFVLGVCLRLQVNPQNQKDFVGISPERGFADFIFAHVILHLVVMNFIG
cccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHEEEEEECcccccccccccccccHHHHHHHHHHHHHHHHHcccc
***FQAVLGKIHHEYVNNTPKKLKIIDAYLFYILLTGAFQFLYCCLVGTFPFNSFLSGFISCVSSFVLGVCLRLQVNPQNQKDFVGISPERGFADFIFAHVILHLVVMNFIG
xxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGFQAVLGKIHHEYVNNTPKKLKIIDAYLFYILLTGAFQFLYCCLVGTFPFNSFLSGFISCVSSFVLGVCLRLQVNPQNQKDFVGISPERGFADFIFAHVILHLVVMNFIG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains (By similarity). Possesses cell death-inhibiting activity.very confidentQ9VLM5
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). Loss of the DAD1 protein triggers apoptosis.very confidentO13113
Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 Component of the N-oligosaccharyl transferase enzyme which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. N-glycosylation occurs cotranslationally and the complex associates with the Sec61 complex at the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER) (By similarity). Loss of the DAD1 protein triggers apoptosis.very confidentQ29036

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0008250 [CC]oligosaccharyltransferase complexconfidentGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0009409 [BP]response to coldconfidentGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0009408 [BP]response to heatconfidentGO:0009628, GO:0006950, GO:0008150, GO:0050896, GO:0009266
GO:0043069 [BP]negative regulation of programmed cell deathconfidentGO:0060548, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0048519, GO:0010941, GO:0050789, GO:0048523
GO:0006464 [BP]cellular protein modification processconfidentGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0008152
GO:0004576 [MF]oligosaccharyl transferase activityconfidentGO:0016758, GO:0016740, GO:0003674, GO:0016757, GO:0003824
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0048477 [BP]oogenesisprobableGO:0044702, GO:0048609, GO:0032504, GO:0019953, GO:0007292, GO:0022414, GO:0032501, GO:0008150, GO:0044699, GO:0007276, GO:0000003
GO:0002119 [BP]nematode larval developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0009791, GO:0002164, GO:0008150, GO:0007275, GO:0044699
GO:0001824 [BP]blastocyst developmentprobableGO:0032502, GO:0001701, GO:0044707, GO:0032501, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0043009, GO:0007275, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0040010 [BP]positive regulation of growth rateprobableGO:0045927, GO:0040008, GO:0040009, GO:0065007, GO:0048518, GO:0008150, GO:0050789
GO:0043687 [BP]post-translational protein modificationprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0006898 [BP]receptor-mediated endocytosisprobableGO:0006897, GO:0016192, GO:0006810, GO:0008150, GO:0051234, GO:0051179
GO:0040007 [BP]growthprobableGO:0008150
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0007584 [BP]response to nutrientprobableGO:0009991, GO:0009605, GO:0050896, GO:0031667, GO:0008150, GO:0042221
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0004579 [MF]dolichyl-diphosphooligosaccharide-protein glycotransferase activityprobableGO:0003674, GO:0003824, GO:0016740, GO:0004576, GO:0016757, GO:0016758
GO:0044351 [BP]macropinocytosisprobableGO:0006897, GO:0016192, GO:0006907, GO:0006810, GO:0044765, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0006487 [BP]protein N-linked glycosylationprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.4.-.-Glycosyltransferases.probable
2.4.1.-Hexosyltransferases.probable
2.4.1.119Dolichyl-diphosphooligosaccharide--protein glycotransferase.probable

Spatial Structural Prediction

No confident structure templates for the query are predicted