Diaphorina citri psyllid: psy5431


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-
MEGTTWTQELVWLLGNNFDYDTAKQKLLLQRFPFLEAVSIINQNDLIQENGTLFGDTISFVQEQQSPRFIKSHLPVQLLPKDIWVKKPKIIYVTREPKDAAVSYFHHHRLWNGYEGSFDDFMKAFLEDKVVYSPFWSHVNSYKKLAKHMPNVLVNSYEDMQLNLPEVIKKTAKFLEKPISDKQLKKLTNHLSFDSMKNNPAINGEEFIKDVIVKYDMPRDDPELTFIRKGIMGSWKKEMSPELVKKFDEWTEMNGIEDDDQENKQRNHEMT
ccHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHccccccccccHHHHHccccccEEccccccccccccccccccEEEEEEcccccEEEEHHHHHcccccccccHHHHHHHHHccccccccHHHHHHHHHHHccccccEEEEEcHHHHccHHHHHHHHHHHccccccHHHHHHHHHccccHHHHccccccccHHHHHHHHcccccccccccccEEccccccccccccHHHHHHHHHHHHHHccccccccccccccccc
MEGTTWTQELVWLLGNNFDYDTAKQKLLLQRFPFLEAVSIINQNDLIQENGTLFGDTISFVQEQQSPRFIKSHLPVQLLPKDIWVKKPKIIYVTREPKDAAVSYFHHHRLWNGYEGSFDDFMKAFLEDKVVYSPFWSHVNSYKKLAKHMPNVLVNSYEDMQLNLPEVIKKTAKFLEKPISDKQLKKLTNHLSFDSMKNNPAINGEEFIKDVIVKYDMPRDDPELTFIRKGIMGSWKKEMSPELVKKFDEWTEMNGIEDDDQEN********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEGTTWTQELVWLLGNNFDYDTAKQKLLLQRFPFLEAVSIINQNDLIQENGTLFGDTISFVQEQQSPRFIKSHLPVQLLPKDIWVKKPKIIYVTREPKDAAVSYFHHHRLWNGYEGSFDDFMKAFLEDKVVYSPFWSHVNSYKKLAKHMPNVLVNSYEDMQLNLPEVIKKTAKFLEKPISDKQLKKLTNHLSFDSMKNNPAINGEEFIKDVIVKYDMPRDDPELTFIRKGIMGSWKKEMSPELVKKFDEWTEMNGIEDDDQENKQRNHEMT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Estrogen sulfotransferase Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of estradiol and estrone. May play a role in the regulation of estrogen receptor activity by metabolizing free estradiol. Maximally sulfates beta-estradiol and estrone at concentrations of 20 nM. Also sulfates dehydroepiandrosterone, pregnenolone, ethinylestradiol, equalenin, diethylstilbesterol and 1-naphthol, at significantly higher concentrations; however, cortisol, testosterone and dopamine are not sulfated.confidentP49888
Sulfotransferase 1 family member D1 Sulfotransferase with broad substrate specificity that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of catecholamines, such as dopamine, prostaglandins, leukotriene E4, drugs and xenobiotic compounds. Has sulfotransferase activity towards p-nitrophenol, 2-naphthylamine and minoxidil (in vitro). Sulfonation increases the water solubility of most compounds, and therefore their renal excretion, but it can also result in bioactivation to form active metabolites.confidentG3V9R3
Estrogen sulfotransferase, testis isoform Sulfotransferase that utilizes 3'-phospho-5'-adenylyl sulfate (PAPS) as sulfonate donor to catalyze the sulfate conjugation of estradiol and estrone. May play a role in the regulation of estrogen receptor activity by metabolizing free estradiol.confidentP49891

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006805 [BP]xenobiotic metabolic processprobableGO:0051716, GO:0008152, GO:0050896, GO:0009987, GO:0044763, GO:0009410, GO:0044237, GO:0071466, GO:0008150, GO:0070887, GO:0042221, GO:0044699
GO:0051923 [BP]sulfationprobableGO:0008150, GO:0009987, GO:0006790, GO:0008152, GO:0044237
GO:0004304 [MF]estrone sulfotransferase activityprobableGO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674
GO:0004027 [MF]alcohol sulfotransferase activityprobableGO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674
GO:0050294 [MF]steroid sulfotransferase activityprobableGO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674
GO:0050656 [MF]3'-phosphoadenosine 5'-phosphosulfate bindingprobableGO:1901681, GO:0043168, GO:0017076, GO:0030554, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0005488, GO:0032549, GO:0032555, GO:0003674, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0080118 [MF]brassinosteroid sulfotransferase activityprobableGO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674
GO:0008210 [BP]estrogen metabolic processprobableGO:0042445, GO:0044710, GO:0006629, GO:0044238, GO:0009987, GO:0044237, GO:0010817, GO:0071704, GO:0008150, GO:0008202, GO:0008152, GO:0065007, GO:0065008, GO:0034754, GO:1901360
GO:0004062 [MF]aryl sulfotransferase activityprobableGO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674
GO:0010033 [BP]response to organic substanceprobableGO:0042221, GO:0050896, GO:0008150
GO:0051704 [BP]multi-organism processprobableGO:0008150
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0009812 [BP]flavonoid metabolic processprobableGO:0071704, GO:0008150, GO:0008152
GO:0042403 [BP]thyroid hormone metabolic processprobableGO:0019752, GO:0006807, GO:0044281, GO:1901360, GO:0042445, GO:0044710, GO:0006520, GO:0071704, GO:0065007, GO:0065008, GO:0009987, GO:0006725, GO:0010817, GO:0008150, GO:0008152, GO:0043436, GO:0018958, GO:0044238, GO:1901564, GO:0006575, GO:0006082, GO:0044237, GO:1901615
GO:0050427 [BP]3'-phosphoadenosine 5'-phosphosulfate metabolic processprobableGO:0034641, GO:0006807, GO:0019693, GO:0072521, GO:0009259, GO:1901360, GO:0006139, GO:0044710, GO:0042278, GO:0033875, GO:0071704, GO:0055086, GO:0009987, GO:0006725, GO:0009150, GO:0009117, GO:0009116, GO:0008152, GO:0043436, GO:0034035, GO:0009119, GO:0046128, GO:0034032, GO:0046483, GO:0044238, GO:1901564, GO:0006082, GO:1901135, GO:0044237, GO:0033865, GO:0006163, GO:1901657, GO:0006796, GO:0006790, GO:0006793, GO:0019637, GO:0008150, GO:0006753, GO:0044281
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0047364 [MF]desulfoglucosinolate sulfotransferase activityprobableGO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0000103 [BP]sulfate assimilationprobableGO:0008150, GO:0009987, GO:0006790, GO:0008152, GO:0044237
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0047894 [MF]flavonol 3-sulfotransferase activityprobableGO:0003824, GO:0016740, GO:0016782, GO:0008146, GO:0003674

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1FMJ, chain A
Confidence level:very confident
Coverage over the Query: 1-262
View the alignment between query and template
View the model in PyMOL