Diaphorina citri psyllid: psy5437


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
ITGATDGLGKAYAEGLAKLGIDVVLISRTKEKLDNLAKLGIDVVLISRTKEKLDNVAAEIRDKYKVDTKVIVADFTDPKIFAHVEKELTGIEAGILVNNVGYSYPYPERFLAVPEKETVYHNIMHCNVITLLSMCQIVMPHMVEQRKGVVVNISSTAALIPSPMLSVYGASKLFVSKFSTDLQSEYKKHGIIVQCVMPGYVATNMSKIKKSSWMVPSPATFVDSALKTIGIQNQTTGYYPHCFLEEMEYT
ccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHHcccEEEEEEEcccccHHHHHHHHHHcccccEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcccccccccccccccccccccHHHHHHHHHHHcccccccccccHHHHHHHHccc
ITGATDGLGKAYAEGLAKLGIDVVLISRTKEKLDNLAKLGIDVVLISRTKEKLDNVAAEIRDKYKVDTKVIVADFTDPKIFAHVEKELTGIEAGILVNNVGYSYPYPERFLAVPEKETVYHNIMHCNVITLLSMCQIVMPHMVEQRKGVVVNISSTAALIPSPMLSVYGASKLFVSKFSTDLQSEYKKHGIIVQCVMPGYVATNMSKIKKSSWMVPSPATFVDSALKTIGIQNQTTGYYPHCFLEEMEYT
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ITGATDGLGKAYAEGLAKLGIDVVLISRTKEKLDNLAKLGIDVVLISRTKEKLDNVAAEIRDKYKVDTKVIVADFTDPKIFAHVEKELTGIEAGILVNNVGYSYPYPERFLAVPEKETVYHNIMHCNVITLLSMCQIVMPHMVEQRKGVVVNISSTAALIPSPMLSVYGASKLFVSKFSTDLQSEYKKHGIIVQCVMPGYVATNMSKIKKSSWMVPSPATFVDSALKTIGIQNQTTGYYPHCFLEEMEYT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Estradiol 17-beta-dehydrogenase 12 Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation.confidentQ28IU1
Estradiol 17-beta-dehydrogenase 12 Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in women. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation.confidentQ53GQ0
Estradiol 17-beta-dehydrogenase 12 Catalyzes the transformation of estrone (E1) into estradiol (E2), suggesting a central role in estrogen formation. Its strong expression in ovary and mammary gland suggest that it may constitute the major enzyme responsible for the conversion of E1 to E2 in females. Also has 3-ketoacyl-CoA reductase activity, reducing both long chain 3-ketoacyl-CoAs and long chain fatty acyl-CoAs, suggesting a role in long fatty acid elongation.confidentO70503

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0047044 [MF]androstan-3-alpha,17-beta-diol dehydrogenase activityprobableGO:0016229, GO:0016614, GO:0016616, GO:0033764, GO:0003824, GO:0003674, GO:0016491
GO:0045137 [BP]development of primary sexual characteristicsprobableGO:0032502, GO:0007548, GO:0032501, GO:0000003, GO:0044707, GO:0022414, GO:0003006, GO:0008150, GO:0007275, GO:0044699
GO:0004090 [MF]carbonyl reductase (NADPH) activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0047045 [MF]testosterone 17-beta-dehydrogenase (NADP+) activityprobableGO:0016229, GO:0016614, GO:0016616, GO:0033764, GO:0003824, GO:0003674, GO:0016491
GO:0045179 [CC]apical cortexprobableGO:0005737, GO:0045177, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0071944, GO:0005938, GO:0044424, GO:0044448
GO:0048513 [BP]organ developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0045703 [MF]ketoreductase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016491
GO:0006702 [BP]androgen biosynthetic processprobableGO:0044249, GO:1901362, GO:1901360, GO:0042445, GO:0042446, GO:0071704, GO:0065007, GO:0065008, GO:0006629, GO:1901576, GO:0009987, GO:0044710, GO:0010817, GO:0009058, GO:0008150, GO:0008209, GO:0008152, GO:0034754, GO:0008202, GO:0008610, GO:0044238, GO:0044237, GO:0006694
GO:0006066 [BP]alcohol metabolic processprobableGO:0044710, GO:0071704, GO:0008150, GO:0044281, GO:0008152, GO:1901615
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0050327 [MF]testosterone 17-beta-dehydrogenase (NAD+) activityprobableGO:0016229, GO:0016614, GO:0016616, GO:0033764, GO:0003824, GO:0003674, GO:0016491
GO:0048608 [BP]reproductive structure developmentprobableGO:0032502, GO:0032501, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0003006, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0008201 [MF]heparin bindingprobableGO:0043168, GO:1901681, GO:0097367, GO:0043167, GO:0005539, GO:0003674, GO:0005488
GO:0005518 [MF]collagen bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0010811 [BP]positive regulation of cell-substrate adhesionprobableGO:0045785, GO:0010810, GO:0030155, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0005778 [CC]peroxisomal membraneprobableGO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0042759 [BP]long-chain fatty acid biosynthetic processprobableGO:0006633, GO:0006631, GO:0019752, GO:0044249, GO:0044281, GO:0044283, GO:0072330, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0006629, GO:0009987, GO:0032787, GO:0009058, GO:0008150, GO:0008152, GO:0001676, GO:0044255, GO:0008610, GO:0044238, GO:0006082, GO:0046394, GO:0016053, GO:0044237, GO:0043436
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0004303 [MF]estradiol 17-beta-dehydrogenase activityprobableGO:0016229, GO:0016614, GO:0016616, GO:0033764, GO:0003824, GO:0003674, GO:0016491
GO:0012505 [CC]endomembrane systemprobableGO:0005575, GO:0044464, GO:0005623
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0016655 [MF]oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptorprobableGO:0003824, GO:0003674, GO:0016651, GO:0016491
GO:0042180 [BP]cellular ketone metabolic processprobableGO:0044710, GO:0009987, GO:0044237, GO:0071704, GO:0008150, GO:0044281, GO:0008152
GO:0051262 [BP]protein tetramerizationprobableGO:0051259, GO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0000253 [MF]3-keto sterol reductase activityprobableGO:0003824, GO:0003674, GO:0016614, GO:0016616, GO:0016491
GO:0030198 [BP]extracellular matrix organizationprobableGO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0043062, GO:0008150, GO:0071840
GO:0050062 [MF]long-chain-fatty-acyl-CoA reductase activityprobableGO:0003824, GO:0016903, GO:0003674, GO:0016620, GO:0016491
GO:0001968 [MF]fibronectin bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005840 [CC]ribosomeprobableGO:0005737, GO:0032991, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0043228, GO:0044424, GO:0005622, GO:0043226
GO:0009790 [BP]embryo developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0008340 [BP]determination of adult lifespanprobableGO:0032502, GO:0032501, GO:0007568, GO:0044707, GO:0044767, GO:0010259, GO:0008150, GO:0007275, GO:0044699
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ET6, chain A
Confidence level:very confident
Coverage over the Query: 1-28,51-231
View the alignment between query and template
View the model in PyMOL
Template: 1SNY, chain A
Confidence level:very confident
Coverage over the Query: 1-34,55-249
View the alignment between query and template
View the model in PyMOL