Diaphorina citri psyllid: psy5539


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650---
MLCIGYIAMYLTWILLNCGVLVMAQSEMKQPQGYCSQYNGKICKNYLNRTGRVWFNSSLESAGGDLNEQIVMALWKEMIAILANPCKQAAEKLLCTYAFPQCVTSNGIPMSLPLCYEDCIAVRYSFCYNDWAYIEENKARGIRFKSRGHFELPNCDTLPKYEVVNGKPTCSHAQLTEMKTDEITYDCIRGRGRFYQGTVNTTVGGLACQRWDAKEPHAHERPPPVFPELNNSENYCRNAGGEEPSPWCYTMDPNVRWQRCEIPTCADSMQDDVKSWGNKIKALLEQFLSQPYFIVLAVIFIPVASMLCLICVVCVIRLVKRNVDYAPAPSQDVNIDLSKLPCNASYHQTDARLNPKLEQLEFPRNDIIYVRDLGQGAFGRVFQAKAPGLLKHEEFTLVAVKMLKDEASEYLQTDFEREACLLAEFDHPNIVKLLGVCAVGKPMCLLFEYMGRGDLNDFLRICSPNNYINGTYSSMESSIHRVPQLSTCDLITIALQIASGMVYLSDRKFVHRDLATRNCLINDQMVVKIADFGLSRKMYLQDYYKGDENDAIPVRWMPLESILYNKYTVESDVWAFGVCLWEIFSFALQPYYGLTHEEVVKYIKEGNILQAPDNTPDALYDLMKLCWNMKPMNRPSFRTIYQTLWNIKRDLEN
ccEEEEEEHHHHHEEEcccEEEEcccccccccccccccccHHHHHHHccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccCECccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHEEEEccccccccccccccccccccccccccccccccccccccccccccccccEEEEcccccccccEEEEEEEcccccccccEEEEEEEccccccHHHHHHHHHHHHHHHccccccEEEEEEEECcccccEEEEEccccccHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccECcccEEEEcccccccccccccccccccccccccccccHHccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHccc
*LCIGYIAMYLTWILLNCGVLVMAQSEMKQPQGYCSQYNGKICKNYLNRTGRVWFNSSLESAGGDLNEQIVMALWKEMIAILANPCKQAAEKLLCTYAFPQCVTSNGIPMSLPLCYEDCIAVRYSFCYNDWAYIEENKARGIRFKSRGHFELPNCDTLPKYEVVNGKPTCSHAQLTEMKTDEITYDCIRGRGRFYQGTVNTTVGGLACQRWDAKEPHAHERPPPVFPELNNSENYCRNAGGEEPSPWCYTMDPNVRWQRCEIPTCADSMQDDVKSWGNKIKALLEQFLSQPYFIVLAVIFIPVASMLCLICVVCVIRLVKRNV*************LSKLPCNASYHQTDARLNPKLEQLEFPRNDIIYVRDLGQGAFGRVFQAKAPGLLKHEEFTLVAVKMLKDEASEYLQTDFEREACLLAEFDHPNIVKLLGVCAVGKPMCLLFEYMGRGDLNDFLRICSPN*****************PQLSTCDLITIALQIASGMVYLSDRKFVHRDLATRNCLINDQMVVKIADFGLSRKMYLQDYYKGDENDAIPVRWMPLESILYNKYTVESDVWAFGVCLWEIFSFALQPYYGLTHEEVVKYIKEGNILQAPDNTPDALYDLMKLCWNMKPMNRPSFRTIYQTLWNIKR****
xxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLCIGYIAMYLTWILLNCGVLVMAQSEMKQPQGYCSQYNGKICKNYLNRTGRVWFNSSLESAGGDLNEQIVMALWKEMIAILANPCKQAAEKLLCTYAFPQCVTSNGIPMSLPLCYEDCIAVRYSFCYNDWAYIEENKARGIRFKSRGHFELPNCDTLPKYEVVNGKPTCSHAQLTEMKTDEITYDCIRGRGRFYQGTVNTTVGGLACQRWDAKEPHAHERPPPVFPELNNSENYCRNAGGEEPSPWCYTMDPNVRWQRCEIPTCxxxxxxxxxxxxxxxxxxxxxFLSQPYFIVLAVIFIPVASMLCLICVVCVIRLVKRNVDYAPAPSQDVNIDLSKLPCNASYHQTDARLNPKLEQLEFPRNDIIYVRDLGQGAFGRVFQAKAPGLLKHEEFTLVAVKMLKDEASEYLQTDFEREACLLAEFDHPNIVKLLGVCAVGKPMCLLFEYMGRGDLNDFLRICSPNNYINGTYSSMESSIHRVPQLSTCDLITIALQIASGMVYLSDRKFVHRDLATRNCLINDQMVVKIADFGLSRKMYLQDYYKGDENDAIPVRWMPLESILYNKYTVESDVWAFGVCLWEIFSFALQPYYGLTHEEVVKYIKEGNILQAPDNTPDALYDLMKLCWNMKPMNRPSFRTIYQTLWNIKRDLEN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Tyrosine-protein kinase transmembrane receptor Ror2 Tyrosine-protein kinase receptor that functions during early stages of neuronal development.very confidentQ9V6K3
Muscle, skeletal receptor tyrosine-protein kinase Receptor tyrosine kinase which plays a central role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between the motor neuron and the skeletal muscle. Recruitment of AGRIN by LRP4 to the MUSK signaling complex induces phosphorylation and activation of MUSK, the kinase of the complex. The activation of MUSK in myotubes regulates the formation of NMJs through the regulation of different processes including the specific expression of genes in subsynaptic nuclei, the reorganization of the actin cytoskeleton and the clustering of the acetylcholine receptors (AChR) in the postsynaptic membrane. May regulate AChR phosphorylation and clustering through activation of ABL1 and Src family kinases which in turn regulate MUSK. DVL1 and PAK1 that form a ternary complex with MUSK are also important for MUSK-dependent regulation of AChR clustering. May positively regulate Rho family GTPases through FNTA. Mediates the phosphorylation of FNTA which promotes prenylation, recruitment to membranes and ativation of RAC1 a regulator of the actin cytoskeleton and of gene expression. Other effectors of the MUSK signaling include DNAJA3 which functions downstream of MUSK. May also play a role within the central nervous system by mediating cholinergic responses, synaptic plasticity and memory formation.confidentQ61006
Muscle, skeletal receptor tyrosine protein kinase Receptor tyrosine kinase which plays a central role in the formation and the maintenance of the neuromuscular junction (NMJ), the synapse between the motor neuron and the skeletal muscle. Recruitment of AGRIN by LRP4 to the MUSK signaling complex induces phosphorylation and activation of MUSK, the kinase of the complex. The activation of MUSK in myotubes regulates the formation of NMJs through the regulation of different processes including the specific expression of genes in subsynaptic nuclei, the reorganization of the actin cytoskeleton and the clustering of the acetylcholine receptors (AChR) in the postsynaptic membrane. May also play a role within the central nervous system by mediating cholinergic responses, synaptic plasticity and memory formation.confidentQ8AXY6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0048638 [BP]regulation of developmental growthprobableGO:0050793, GO:0008150, GO:0040008, GO:0065007, GO:0050789
GO:0018108 [BP]peptidyl-tyrosine phosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0018212, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0018193, GO:0008152, GO:0006793, GO:0044237
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0050804 [BP]regulation of synaptic transmissionprobableGO:0044057, GO:0031644, GO:0050794, GO:0065007, GO:0051239, GO:0023051, GO:0008150, GO:0051969, GO:0010646, GO:0050789
GO:0045860 [BP]positive regulation of protein kinase activityprobableGO:0019220, GO:0009893, GO:0019222, GO:0033674, GO:0031325, GO:0031323, GO:0050789, GO:0043085, GO:0080090, GO:0051347, GO:0010604, GO:0010562, GO:0043549, GO:0051246, GO:0051247, GO:0032270, GO:0044093, GO:0031399, GO:0048518, GO:0065007, GO:0065009, GO:0050790, GO:0045937, GO:0060255, GO:0045859, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0031401, GO:0051338, GO:0001932, GO:0001934, GO:0048522
GO:0043410 [BP]positive regulation of MAPK cascadeprobableGO:0023051, GO:0010646, GO:0009966, GO:0010740, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0009967, GO:0048518, GO:0008150, GO:0010647, GO:0048522, GO:0010627, GO:0050789, GO:0043408
GO:0071340 [BP]skeletal muscle acetylcholine-gated channel clusteringprobableGO:0050808, GO:0048869, GO:0030154, GO:0048468, GO:0061024, GO:0014706, GO:0008104, GO:0051146, GO:0061061, GO:0007275, GO:0044699, GO:0007517, GO:0070727, GO:0001941, GO:0007519, GO:0016043, GO:0048513, GO:0071840, GO:0033036, GO:0032502, GO:0055001, GO:0055002, GO:0034613, GO:0048741, GO:0032501, GO:0009987, GO:0009888, GO:0048747, GO:0048731, GO:0007528, GO:0044763, GO:0072657, GO:0060537, GO:0051179, GO:0051641, GO:0044767, GO:0044707, GO:0048856, GO:0016044, GO:0060538, GO:0008150, GO:0043113, GO:0042692
GO:0005911 [CC]cell-cell junctionprobableGO:0005575, GO:0030054
GO:0010629 [BP]negative regulation of gene expressionprobableGO:0009892, GO:0019222, GO:0060255, GO:0050789, GO:0008150, GO:0065007, GO:0048519, GO:0010605, GO:0010468
GO:0010628 [BP]positive regulation of gene expressionprobableGO:0009893, GO:0019222, GO:0060255, GO:0050789, GO:0065007, GO:0048518, GO:0008150, GO:0010468, GO:0010604
GO:0050731 [BP]positive regulation of peptidyl-tyrosine phosphorylationprobableGO:0019220, GO:0009893, GO:0019222, GO:0031325, GO:0031323, GO:0050789, GO:0080090, GO:0010604, GO:0010562, GO:0051246, GO:0051247, GO:0032270, GO:0031399, GO:0048518, GO:0065007, GO:0045937, GO:0060255, GO:0050794, GO:0051174, GO:0008150, GO:0042325, GO:0042327, GO:0032268, GO:0050730, GO:0031401, GO:0001932, GO:0001934, GO:0048522
GO:0042802 [MF]identical protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0051094 [BP]positive regulation of developmental processprobableGO:0050793, GO:0048518, GO:0065007, GO:0050789, GO:0008150
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0060548 [BP]negative regulation of cell deathprobableGO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0010941, GO:0050789, GO:0048523
GO:0009897 [CC]external side of plasma membraneprobableGO:0009986, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459
GO:0031175 [BP]neuron projection developmentprobableGO:0032502, GO:0030030, GO:0030154, GO:0048468, GO:0007275, GO:0071840, GO:0048869, GO:0016043, GO:0008150, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0045211 [CC]postsynaptic membraneprobableGO:0097060, GO:0044456, GO:0016020, GO:0005575, GO:0045202
GO:0007267 [BP]cell-cell signalingprobableGO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0044763, GO:0044699
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0019838 [MF]growth factor bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0051602 [BP]response to electrical stimulusprobableGO:0009628, GO:0050896, GO:0008150
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0004714 [MF]transmembrane receptor protein tyrosine kinase activityprobableGO:0038023, GO:0003824, GO:0016773, GO:0016772, GO:0016301, GO:0016740, GO:0060089, GO:0004888, GO:0003674, GO:0004713, GO:0004871, GO:0004672, GO:0019199, GO:0004872
GO:0009605 [BP]response to external stimulusprobableGO:0050896, GO:0008150
GO:0032318 [BP]regulation of Ras GTPase activityprobableGO:0009894, GO:0019220, GO:0080090, GO:0019222, GO:0048583, GO:0023051, GO:0010646, GO:0043087, GO:0050789, GO:0031329, GO:0009966, GO:0030811, GO:0065007, GO:0046578, GO:0065009, GO:0051056, GO:0033121, GO:0033124, GO:0019219, GO:0031323, GO:0050790, GO:0050794, GO:0051174, GO:0008150, GO:0051171, GO:0009118, GO:0051336, GO:1900542, GO:0006140
GO:0051345 [BP]positive regulation of hydrolase activityprobableGO:0051336, GO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789, GO:0043085
GO:0043068 [BP]positive regulation of programmed cell deathprobableGO:0050794, GO:0048518, GO:0043067, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0050789, GO:0048522
GO:0019901 [MF]protein kinase bindingprobableGO:0019900, GO:0003674, GO:0005515, GO:0019899, GO:0005488
GO:0007613 [BP]memoryprobableGO:0032501, GO:0044707, GO:0044708, GO:0050896, GO:0050890, GO:0007610, GO:0007611, GO:0008150, GO:0050877, GO:0044699, GO:0003008
GO:0048009 [BP]insulin-like growth factor receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0008150, GO:0050896, GO:0009987, GO:0050794, GO:0023052, GO:0007154, GO:0065007, GO:0044763, GO:0007165, GO:0007166, GO:0007167, GO:0007169, GO:0050789, GO:0044699
GO:1901214 [BP]regulation of neuron deathprobableGO:0008150, GO:0010941, GO:0065007, GO:0050789, GO:0050794
GO:0022603 [BP]regulation of anatomical structure morphogenesisprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789
GO:0042981 [BP]regulation of apoptotic processprobableGO:0050794, GO:0043067, GO:0008150, GO:0065007, GO:0010941, GO:0050789
GO:0006950 [BP]response to stressprobableGO:0050896, GO:0008150
GO:0051259 [BP]protein oligomerizationprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0071840
GO:0030335 [BP]positive regulation of cell migrationprobableGO:0051272, GO:0030334, GO:0040017, GO:0040012, GO:0008150, GO:0051270, GO:2000145, GO:2000147, GO:0048518, GO:0065007, GO:0032879, GO:0050794, GO:0050789, GO:0048522
GO:0071417 [BP]cellular response to organic nitrogenprobableGO:0071495, GO:0009719, GO:0051716, GO:0009987, GO:0050896, GO:1901698, GO:1901699, GO:0010033, GO:0008150, GO:0071310, GO:0044763, GO:0070887, GO:0042221, GO:0010243, GO:0044699
GO:0030425 [CC]dendriteprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0010975 [BP]regulation of neuron projection developmentprobableGO:0030154, GO:0051128, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0065007, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0044763, GO:0051239, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0008150
GO:0051130 [BP]positive regulation of cellular component organizationprobableGO:0051128, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0043168 [MF]anion bindingprobableGO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.10.-Protein-tyrosine kinases.probable
2.7.10.1Transferred entry: 2.7.10.1 and 2.7.10.2.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4DUR, chain A
Confidence level:very confident
Coverage over the Query: 101-127,151-162,182-266
View the alignment between query and template
View the model in PyMOL
Template: 1LUF, chain A
Confidence level:very confident
Coverage over the Query: 361-464,483-649
View the alignment between query and template
View the model in PyMOL
Template: 3HKL, chain A
Confidence level:very confident
Coverage over the Query: 32-177
View the alignment between query and template
View the model in PyMOL