Diaphorina citri psyllid: psy5542


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80------
MVADMKLSHKALPLLLYQFTSKFRDELRPKFGLMRSREFLMKDLYAFTASEVDANDVYNLVGKCYDDVFNTLGIKYRKVIVRHGAV
ccHHHHHcccccccHHHHHHcccccccccccccHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEccccc
*VADMKLSHKALPLLLYQFTSKFRDELRPKFGLMRSREFLMKDLYAFTASEVDANDVYNLVGKCYDDVFNTLGIKYRKVIVRHGA*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVADMKLSHKALPLLLYQFTSKFRDELRPKFGLMRSREFLMKDLYAFTASEVDANDVYNLVGKCYDDVFNTLGIKYRKVIVRHGAV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable proline--tRNA ligase, mitochondrial confidentQ8CFI5
Probable proline--tRNA ligase, mitochondrial confidentQ5M7W7
Proline--tRNA ligase Catalyzes the attachment of proline to tRNA(Pro) in a two-step reaction: proline is first activated by ATP to form Pro-AMP and then transferred to the acceptor end of tRNA(Pro). As ProRS can inadvertently accommodate and process non-cognate amino acids such as alanine and cysteine, to avoid such errors it has two additional distinct editing activities against alanine. One activity is designated as 'pretransfer' editing and involves the tRNA(Pro)-independent hydrolysis of activated Ala-AMP. The other activity is designated 'posttransfer' editing and involves deacylation of mischarged Ala-tRNA(Pro). The misacylated Cys-tRNA(Pro) is not edited by ProRS.confidentA8FDC1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044444 [CC]cytoplasmic partprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J3L, chain A
Confidence level:very confident
Coverage over the Query: 1-85
View the alignment between query and template
View the model in PyMOL