Query         psy5543
Match_columns 60
No_of_seqs    49 out of 51
Neff          3.2 
Searched_HMMs 46136
Date          Fri Aug 16 20:14:21 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5543.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5543hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG3988|consensus               99.9 1.6E-26 3.4E-31  174.4   2.8   53    7-59    273-327 (378)
  2 PF00685 Sulfotransfer_1:  Sulf  58.6     9.9 0.00022   24.3   2.3   35   24-58    232-267 (267)
  3 PF14261 DUF4351:  Domain of un  50.1      10 0.00022   21.9   1.2   21   30-50     14-34  (59)
  4 PF04736 Eclosion:  Eclosion ho  41.9      15 0.00032   22.5   1.0   26   30-57     36-62  (62)
  5 TIGR03495 phage_LysB phage lys  36.4      21 0.00047   24.0   1.3   17   29-45     91-108 (135)
  6 smart00833 CobW_C Cobalamin sy  31.5      12 0.00026   21.2  -0.5   20   24-43      9-28  (92)
  7 PF07683 CobW_C:  Cobalamin syn  30.9     8.7 0.00019   22.1  -1.2   22   23-44      8-29  (94)
  8 PF12490 BCAS3:  Breast carcino  30.1      26 0.00057   25.0   0.9   14    1-14    203-216 (251)
  9 KOG2182|consensus               28.1      12 0.00027   30.4  -1.1   30   29-58    182-212 (514)
 10 PF09921 DUF2153:  Uncharacteri  27.8      39 0.00084   23.0   1.4   21   29-49     46-72  (126)
 11 PF12460 MMS19_C:  RNAPII trans  26.4      25 0.00054   26.1   0.3   41   14-55    330-371 (415)
 12 COG4755 Uncharacterized protei  26.3      43 0.00093   23.5   1.4   21   29-49     64-90  (151)
 13 PF14549 P22_Cro:  DNA-binding   26.2      48   0.001   19.2   1.4   24   27-50     21-44  (60)
 14 PF09494 Slx4:  Slx4 endonuclea  22.5      40 0.00086   19.3   0.6   13   25-37     23-35  (64)
 15 PF01618 MotA_ExbB:  MotA/TolQ/  21.7      40 0.00086   21.4   0.5   18   41-58     55-72  (139)
 16 KOG4415|consensus               20.8      35 0.00077   25.4   0.2   10    1-10     47-56  (247)

No 1  
>KOG3988|consensus
Probab=99.92  E-value=1.6e-26  Score=174.38  Aligned_cols=53  Identities=64%  Similarity=0.881  Sum_probs=51.9

Q ss_pred             ccc--cCCCCCcccccchhccccchhhhhhhcCCCChHHHhchHhhhhHhhcCCC
Q psy5543           7 FKT--YTPPPRVERSSDQVIKPVNLEALTKWVGKIPEDVMKDMDEIAPMLASGNG   59 (60)
Q Consensus         7 i~~--~vsLSk~E~STdQVvkpvn~eaLskW~g~iP~dv~~dm~~iaPmL~~l~~   59 (60)
                      ||+  +|||||+|||||||+||||++||+||+|+||+||++||++|||||++||-
T Consensus       273 Igk~~gVsLskvErSsdQVikpVNl~AlskWvg~ip~dvvrdma~iAPmL~~LGY  327 (378)
T KOG3988|consen  273 IGKPGGVSLSKVERSSDQVIKPVNLEALSKWVGCIPEDVVRDMADIAPMLAILGY  327 (378)
T ss_pred             cCCCCCCChhhhhccHhhhhccccHHHHHHHhccCCHHHHHHHHHHHHHHHHhCC
Confidence            888  99999999999999999999999999999999999999999999999995


No 2  
>PF00685 Sulfotransfer_1:  Sulfotransferase domain;  InterPro: IPR000863 This family includes a range of sulphotransferase proteins including flavonyl 3-sulphotransferase, aryl sulphotransferase, alcohol sulphotransferase, oestrogen sulphotransferase and phenol-sulphating phenol sulphotransferase. These enzymes are responsible for the transfer of sulphate groups to specific compounds.; GO: 0008146 sulfotransferase activity; PDB: 3MGC_A 3MGB_A 3MG9_A 1G3M_B 1HY3_B 2QP4_A 3F3Y_C 1EFH_A 1OV4_A 1J99_A ....
Probab=58.55  E-value=9.9  Score=24.33  Aligned_cols=35  Identities=6%  Similarity=0.207  Sum_probs=28.9

Q ss_pred             ccccchhhhhhhcCCCChHHHhchHhhh-hHhhcCC
Q psy5543          24 IKPVNLEALTKWVGKIPEDVMKDMDEIA-PMLASGN   58 (60)
Q Consensus        24 vkpvn~eaLskW~g~iP~dv~~dm~~ia-PmL~~l~   58 (60)
                      -..+......+|...++++.++.+.++| +.|+.||
T Consensus       232 ~~~~~~~~~~~W~~~l~~e~~~~i~~~~~~~m~~~~  267 (267)
T PF00685_consen  232 SRFFRKGKSGRWKNELSPEQIDRIERICGDAMRELG  267 (267)
T ss_dssp             STSSEET-STGGGGTSBHHHHHHHHHHHHHHHTTSS
T ss_pred             ceeeeecccCcccccCCHHHHHHHHHHHHHHHccCC
Confidence            4677888889999999999999999887 6777776


No 3  
>PF14261 DUF4351:  Domain of unknown function (DUF4351)
Probab=50.14  E-value=10  Score=21.89  Aligned_cols=21  Identities=19%  Similarity=0.607  Sum_probs=17.4

Q ss_pred             hhhhhhcCCCChHHHhchHhh
Q psy5543          30 EALTKWVGKIPEDVMKDMDEI   50 (60)
Q Consensus        30 eaLskW~g~iP~dv~~dm~~i   50 (60)
                      --|.+.+|.+|+++...+..+
T Consensus        14 RlL~rrFG~lp~~~~~~I~~l   34 (59)
T PF14261_consen   14 RLLTRRFGELPPEIQERIQQL   34 (59)
T ss_pred             HHHHHHcCCCCHHHHHHHHcC
Confidence            457899999999998877665


No 4  
>PF04736 Eclosion:  Eclosion hormone;  InterPro: IPR006825 Eclosion hormone is an insect neuropeptide that triggers the performance of ecdysis behaviour, which causes shedding of the old cuticle at the end of a molt [, ].; GO: 0008255 ecdysis-triggering hormone activity, 0007218 neuropeptide signaling pathway, 0018990 ecdysis, chitin-based cuticle
Probab=41.92  E-value=15  Score=22.47  Aligned_cols=26  Identities=46%  Similarity=0.767  Sum_probs=18.8

Q ss_pred             hhhhhhcCC-CChHHHhchHhhhhHhhcC
Q psy5543          30 EALTKWVGK-IPEDVMKDMDEIAPMLASG   57 (60)
Q Consensus        30 eaLskW~g~-iP~dv~~dm~~iaPmL~~l   57 (60)
                      |+--|..|+ ||+  -+|.++|+|+|.+|
T Consensus        36 e~C~k~kGk~iPD--Ced~~SI~pFLnkl   62 (62)
T PF04736_consen   36 ESCVKFKGKLIPD--CEDIDSIAPFLNKL   62 (62)
T ss_pred             HHHHHhCCCcCCC--ccchhhHHHHHhcC
Confidence            344455666 565  47899999999986


No 5  
>TIGR03495 phage_LysB phage lysis regulatory protein, LysB family. Members of this protein family are phage lysis regulatory protein, including the well-studied protein LysB (lysis protein B) of Enterobacteria phage P2. For members of this family, genes are found in phage or in prophage regions of bacterial genomes, typically near a phage lysozyme or phage holin.
Probab=36.41  E-value=21  Score=24.02  Aligned_cols=17  Identities=35%  Similarity=0.935  Sum_probs=14.4

Q ss_pred             hhhhhhhcCC-CChHHHh
Q psy5543          29 LEALTKWVGK-IPEDVMK   45 (60)
Q Consensus        29 ~eaLskW~g~-iP~dv~~   45 (60)
                      -|.|.+|.+. +|++|++
T Consensus        91 Ne~lR~Wa~t~LPd~V~R  108 (135)
T TIGR03495        91 NEDLRRWADTPLPDDVIR  108 (135)
T ss_pred             CHHHHHHhcCCCcHHHHH
Confidence            4678999988 9999875


No 6  
>smart00833 CobW_C Cobalamin synthesis protein cobW C-terminal domain. CobW proteins are generally found proximal to the trimeric cobaltochelatase subunit CobN, which is essential for vitamin B12 (cobalamin) biosynthesis PUBMED:12869542. They contain a P-loop nucleotide-binding loop in the N-terminal domain and a histidine-rich region in the C-terminal portion suggesting a role in metal binding, possibly as an intermediary between the cobalt transport and chelation systems. CobW might be involved in cobalt reduction leading to cobalt(I) corrinoids. This entry represents the C-terminal domain found in CobW, as well as in P47K, a Pseudomonas chlororaphis protein needed for nitrile hydratase expression PUBMED:7765511.
Probab=31.53  E-value=12  Score=21.22  Aligned_cols=20  Identities=25%  Similarity=0.456  Sum_probs=16.4

Q ss_pred             ccccchhhhhhhcCCCChHH
Q psy5543          24 IKPVNLEALTKWVGKIPEDV   43 (60)
Q Consensus        24 vkpvn~eaLskW~g~iP~dv   43 (60)
                      -+|++.+.|.+|...+|..+
T Consensus         9 ~~~~~~~~l~~~l~~l~~~i   28 (92)
T smart00833        9 RRPFHPQRLLAALDELPEGV   28 (92)
T ss_pred             CCCCCHHHHHHHHHhccCCe
Confidence            37889999999999988543


No 7  
>PF07683 CobW_C:  Cobalamin synthesis protein cobW C-terminal domain;  InterPro: IPR011629 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase []. In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase [].  There are at least two distinct cobalamin biosynthetic pathways in bacteria []:  Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway []; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis []; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii subsp. shermanii.   Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) []. There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans. CobW proteins are generally found proximal to the trimeric cobaltochelatase subunit CobN, which is essential for vitamin B12 (cobalamin) biosynthesis []. They contain a P-loop nucleotide-binding loop in the N-terminal domain and a histidine-rich region in the C-terminal portion suggesting a role in metal binding, possibly as an intermediary between the cobalt transport and chelation systems. CobW might be involved in cobalt reduction leading to cobalt(I) corrinoids. This entry represents the C-terminal domain found in CobW, as well as in P47K (P31521 from SWISSPROT), a Pseudomonas chlororaphis protein needed for nitrile hydratase expression [].; PDB: 1NIJ_A.
Probab=30.90  E-value=8.7  Score=22.08  Aligned_cols=22  Identities=32%  Similarity=0.755  Sum_probs=15.7

Q ss_pred             hccccchhhhhhhcCCCChHHH
Q psy5543          23 VIKPVNLEALTKWVGKIPEDVM   44 (60)
Q Consensus        23 Vvkpvn~eaLskW~g~iP~dv~   44 (60)
                      .-+|++.+.|..|....+.+++
T Consensus         8 ~~~p~~~~~l~~~l~~~~~~vl   29 (94)
T PF07683_consen    8 FDRPFDPERLEAWLQELPGDVL   29 (94)
T ss_dssp             ESS-B-HHHHHHHHHHTTTTEE
T ss_pred             eCCCCCHHHHHHHHHhCCCCEE
Confidence            3479999999999988776654


No 8  
>PF12490 BCAS3:  Breast carcinoma amplified sequence 3 ;  InterPro: IPR022175  This domain family is found in eukaryotes, and is typically between 229 and 245 amino acids in length. The proteins in this family have been shown to be proto-oncogenes implicated in the development of breast cancer. 
Probab=30.08  E-value=26  Score=24.98  Aligned_cols=14  Identities=71%  Similarity=1.255  Sum_probs=11.6

Q ss_pred             CCCcccccccCCCC
Q psy5543           1 MGPQFSFKTYTPPP   14 (60)
Q Consensus         1 ~~~~~~i~~~vsLS   14 (60)
                      |||||+|++.-+.+
T Consensus       203 ~gpQf~F~~~~~~~  216 (251)
T PF12490_consen  203 MGPQFSFKTMSSPS  216 (251)
T ss_pred             cCCcEEEEEecCCC
Confidence            79999999886655


No 9  
>KOG2182|consensus
Probab=28.07  E-value=12  Score=30.37  Aligned_cols=30  Identities=27%  Similarity=0.468  Sum_probs=25.8

Q ss_pred             hhhhhhhcCC-CChHHHhchHhhhhHhhcCC
Q psy5543          29 LEALTKWVGK-IPEDVMKDMDEIAPMLASGN   58 (60)
Q Consensus        29 ~eaLskW~g~-iP~dv~~dm~~iaPmL~~l~   58 (60)
                      --+|+.|+.. .|+-+..-.++.||.++.+.
T Consensus       182 sGsLsAW~R~~yPel~~GsvASSapv~A~~D  212 (514)
T KOG2182|consen  182 SGSLSAWFREKYPELTVGSVASSAPVLAKVD  212 (514)
T ss_pred             hhHHHHHHHHhCchhheeecccccceeEEec
Confidence            4569999976 99999999999999988753


No 10 
>PF09921 DUF2153:  Uncharacterized protein conserved in archaea (DUF2153);  InterPro: IPR014450 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=27.81  E-value=39  Score=23.03  Aligned_cols=21  Identities=29%  Similarity=0.819  Sum_probs=17.1

Q ss_pred             hhhhhhhc------CCCChHHHhchHh
Q psy5543          29 LEALTKWV------GKIPEDVMKDMDE   49 (60)
Q Consensus        29 ~eaLskW~------g~iP~dv~~dm~~   49 (60)
                      ++|.++|.      .++|+|++.+.+.
T Consensus        46 lKaFd~WLqdP~ItshMPreML~dv~~   72 (126)
T PF09921_consen   46 LKAFDQWLQDPMITSHMPREMLEDVWE   72 (126)
T ss_pred             HHHHHHHHcCchhHhcCCHHHHHHHHH
Confidence            57889997      5599999988764


No 11 
>PF12460 MMS19_C:  RNAPII transcription regulator C-terminal;  InterPro: IPR024687 This domain, approximately 60 amino acids in length, is found in the N-terminal region of MMS19 proteins. MMS19 is required for both nucleotide excision repair (NER) and RNA polymerase II (RNAP II) transcription [].
Probab=26.37  E-value=25  Score=26.06  Aligned_cols=41  Identities=24%  Similarity=0.512  Sum_probs=32.4

Q ss_pred             CCcccccchhccccchhhhhhhcCCCChHHH-hchHhhhhHhh
Q psy5543          14 PRVERSSDQVIKPVNLEALTKWVGKIPEDVM-KDMDEIAPMLA   55 (60)
Q Consensus        14 Sk~E~STdQVvkpvn~eaLskW~g~iP~dv~-~dm~~iaPmL~   55 (60)
                      ++++.+.+. +|+.++.||+.=..++|..++ .++..+-|+|-
T Consensus       330 ~~~~~~~~~-~k~~yL~ALs~ll~~vP~~vl~~~l~~LlPLLl  371 (415)
T PF12460_consen  330 EGFKEADDE-IKSNYLTALSHLLKNVPKSVLLPELPTLLPLLL  371 (415)
T ss_pred             HHHhhcChh-hHHHHHHHHHHHHhhCCHHHHHHHHHHHHHHHH
Confidence            344555555 799999999999999999876 56888888874


No 12 
>COG4755 Uncharacterized protein conserved in archaea [Function unknown]
Probab=26.31  E-value=43  Score=23.47  Aligned_cols=21  Identities=24%  Similarity=0.833  Sum_probs=17.5

Q ss_pred             hhhhhhhcC------CCChHHHhchHh
Q psy5543          29 LEALTKWVG------KIPEDVMKDMDE   49 (60)
Q Consensus        29 ~eaLskW~g------~iP~dv~~dm~~   49 (60)
                      +.|.++|..      ++|+++++|..+
T Consensus        64 LKaFd~WLqdP~v~s~mPremL~dv~~   90 (151)
T COG4755          64 LKAFDSWLQDPVVTSVMPREMLRDVES   90 (151)
T ss_pred             HHHHHHHHhCchHhhhCcHHHHHHHHH
Confidence            678999984      499999998765


No 13 
>PF14549 P22_Cro:  DNA-binding transcriptional regulator Cro; PDB: 1RZS_A 3BD1_A 3QWS_A 2HIN_B.
Probab=26.19  E-value=48  Score=19.24  Aligned_cols=24  Identities=21%  Similarity=0.602  Sum_probs=15.3

Q ss_pred             cchhhhhhhcCCCChHHHhchHhh
Q psy5543          27 VNLEALTKWVGKIPEDVMKDMDEI   50 (60)
Q Consensus        27 vn~eaLskW~g~iP~dv~~dm~~i   50 (60)
                      |...|++.|.+.||.+-.-.+..+
T Consensus        21 Vs~~aVs~W~~~IP~~ra~~Ie~~   44 (60)
T PF14549_consen   21 VSPQAVSQWGERIPAERAYQIEKL   44 (60)
T ss_dssp             S-HHHHHHHHTS--HHHHHHHHHH
T ss_pred             CCHHHHHHhcCccCHHHHHHHHHH
Confidence            455688999888999876665554


No 14 
>PF09494 Slx4:  Slx4 endonuclease;  InterPro: IPR018574  The Slx4 protein is a heteromeric structure-specific endonuclease found in fungi. Slx4 with Slx1 acts as a nuclease on branched DNA substrates, particularly simple-Y, 5'-flap, or replication fork structures by cleaving the strand bearing the 5' non-homologous arm at the branch junction and thus generating ligatable nicked products from 5'-flap or replication fork substrates []. 
Probab=22.52  E-value=40  Score=19.28  Aligned_cols=13  Identities=46%  Similarity=1.063  Sum_probs=11.8

Q ss_pred             cccchhhhhhhcC
Q psy5543          25 KPVNLEALTKWVG   37 (60)
Q Consensus        25 kpvn~eaLskW~g   37 (60)
                      .||+++.|.+|..
T Consensus        23 ePI~L~el~~~L~   35 (64)
T PF09494_consen   23 EPINLEELHAWLK   35 (64)
T ss_pred             CCccHHHHHHHHH
Confidence            5999999999986


No 15 
>PF01618 MotA_ExbB:  MotA/TolQ/ExbB proton channel family MotA family only;  InterPro: IPR002898 This family groups together integral membrane proteins that appear to be involved in translocation of proteins across a membrane. These proteins are probably proton channels. MotA is an essential component of the flagellar motor that uses a proton gradient to generate rotational motion in the flagellar []. ExbB is part of the TonB-dependent transduction complex. The TonB complex uses the proton gradient across the inner bacterial membrane to transport large molecules across the outer bacterial membrane.; GO: 0008565 protein transporter activity, 0006810 transport, 0016020 membrane
Probab=21.66  E-value=40  Score=21.36  Aligned_cols=18  Identities=22%  Similarity=0.444  Sum_probs=14.0

Q ss_pred             hHHHhchHhhhhHhhcCC
Q psy5543          41 EDVMKDMDEIAPMLASGN   58 (60)
Q Consensus        41 ~dv~~dm~~iaPmL~~l~   58 (60)
                      -.++..+..+||||.-||
T Consensus        55 ~~~l~~i~~~aP~lGLlG   72 (139)
T PF01618_consen   55 LSILRTIASIAPLLGLLG   72 (139)
T ss_pred             hHHHHHHHHHHHHHHHHH
Confidence            456778888999988776


No 16 
>KOG4415|consensus
Probab=20.85  E-value=35  Score=25.43  Aligned_cols=10  Identities=60%  Similarity=1.042  Sum_probs=7.8

Q ss_pred             CCCccccccc
Q psy5543           1 MGPQFSFKTY   10 (60)
Q Consensus         1 ~~~~~~i~~~   10 (60)
                      |||||.+.+.
T Consensus        47 mGPQFef~ei   56 (247)
T KOG4415|consen   47 MGPQFEFFEI   56 (247)
T ss_pred             ecCceeEEEe
Confidence            7999988653


Done!