Query         psy5544
Match_columns 96
No_of_seqs    71 out of 73
Neff          4.1 
Searched_HMMs 46136
Date          Fri Aug 16 20:15:18 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5544.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5544hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG0912|consensus              100.0 4.8E-41   1E-45  271.3   7.7   91    1-94    169-259 (375)
  2 PF13848 Thioredoxin_6:  Thiore  99.0 5.9E-09 1.3E-13   72.1   9.1   79    4-87     40-119 (184)
  3 cd03072 PDI_b'_ERp44 PDIb' fam  98.8 9.5E-09 2.1E-13   70.2   4.1   48   47-94      1-48  (111)
  4 PTZ00102 disulphide isomerase;  98.4 1.2E-06 2.6E-11   69.6   7.6   79    6-90    199-277 (477)
  5 TIGR01130 ER_PDI_fam protein d  98.3 3.9E-06 8.5E-11   65.4   8.1   67    6-75    179-246 (462)
  6 cd03070 PDI_b_ERp44 PDIb famil  98.2 1.2E-06 2.5E-11   59.7   3.2   33    1-36     59-91  (91)
  7 cd03069 PDI_b_ERp57 PDIb famil  95.4   0.018 3.9E-07   38.3   3.2   37    5-42     65-103 (104)
  8 TIGR01130 ER_PDI_fam protein d  95.4     0.1 2.3E-06   40.8   7.7   75    8-87     79-154 (462)
  9 cd02981 PDI_b_family Protein D  93.5    0.12 2.6E-06   32.6   3.5   33    4-41     64-96  (97)
 10 PTZ00102 disulphide isomerase;  88.8     2.6 5.6E-05   33.7   7.4   72    8-86    110-182 (477)
 11 cd02996 PDI_a_ERp44 PDIa famil  88.5    0.42 9.1E-06   30.9   2.4   31   47-77      3-33  (108)
 12 cd02982 PDI_b'_family Protein   88.0     1.1 2.3E-05   28.3   3.9   36   51-89      4-41  (103)
 13 cd03068 PDI_b_ERp72 PDIb famil  84.7       1 2.2E-05   30.4   2.7   38    4-41     66-106 (107)
 14 cd02997 PDI_a_PDIR PDIa family  81.8     2.4 5.3E-05   26.3   3.4   33   47-79      2-34  (104)
 15 cd02995 PDI_a_PDI_a'_C PDIa fa  80.6     3.1 6.8E-05   25.7   3.6   32   47-78      2-34  (104)
 16 cd03003 PDI_a_ERdj5_N PDIa fam  80.4     1.8 3.9E-05   27.5   2.5   33   45-77      1-33  (101)
 17 cd03005 PDI_a_ERp46 PDIa famil  79.6     1.7 3.8E-05   27.0   2.2   31   47-78      2-32  (102)
 18 cd03002 PDI_a_MPD1_like PDI fa  75.1     3.2 6.9E-05   26.3   2.5   32   47-78      2-34  (109)
 19 KOG0190|consensus               74.6     6.4 0.00014   34.1   4.9   61   23-84    216-280 (493)
 20 cd02993 PDI_a_APS_reductase PD  74.0       3 6.4E-05   27.2   2.2   31   47-77      3-36  (109)
 21 cd03004 PDI_a_ERdj5_C PDIa fam  73.7     3.3 7.1E-05   26.3   2.3   33   45-77      1-34  (104)
 22 COG3892 Uncharacterized protei  73.6     4.1 8.9E-05   33.4   3.3   44   25-90    117-160 (310)
 23 cd03066 PDI_b_Calsequestrin_mi  73.6     6.4 0.00014   25.7   3.7   20   23-42     81-100 (102)
 24 cd03001 PDI_a_P5 PDIa family,   73.1     5.6 0.00012   24.7   3.3   32   47-78      2-34  (103)
 25 cd02961 PDI_a_family Protein D  71.9     6.8 0.00015   23.4   3.3   31   49-79      2-32  (101)
 26 PF00085 Thioredoxin:  Thioredo  68.7      20 0.00043   21.9   5.0   33   47-79      1-34  (103)
 27 cd03004 PDI_a_ERdj5_C PDIa fam  66.4       8 0.00017   24.4   2.9   28    8-39     77-104 (104)
 28 cd02998 PDI_a_ERp38 PDIa famil  64.9      23  0.0005   21.7   4.8   32   47-78      2-34  (105)
 29 PTZ00051 thioredoxin; Provisio  64.5      10 0.00022   23.5   3.1   35   46-80      1-36  (98)
 30 cd02957 Phd_like Phosducin (Ph  63.8     7.5 0.00016   25.5   2.5   32   47-78      6-40  (113)
 31 TIGR01126 pdi_dom protein disu  54.0      11 0.00024   23.0   1.9   28   52-79      3-30  (102)
 32 TIGR02263 benz_CoA_red_C benzo  52.5      21 0.00046   29.0   3.8   32   56-88    345-376 (380)
 33 cd02963 TRX_DnaJ TRX domain, D  52.1      11 0.00025   24.7   1.8   29   50-78      9-40  (111)
 34 smart00594 UAS UAS domain.      50.5      28 0.00062   23.4   3.6   34   45-78      9-43  (122)
 35 PRK10996 thioredoxin 2; Provis  50.3      13 0.00029   25.6   2.0   32   47-78     37-68  (139)
 36 COG3538 Uncharacterized conser  47.8      29 0.00064   29.8   4.0   52   34-89     25-95  (434)
 37 cd03006 PDI_a_EFP1_N PDIa fami  46.3      14 0.00031   25.1   1.6   32   47-78     11-45  (113)
 38 cd02953 DsbDgamma DsbD gamma f  45.0      18 0.00038   22.9   1.9   27   55-81      4-30  (104)
 39 PLN02309 5'-adenylylsulfate re  44.6      17 0.00037   30.9   2.2   40   45-84    345-390 (457)
 40 TIGR01068 thioredoxin thioredo  43.5      46 0.00099   20.0   3.5   21   58-78     10-30  (101)
 41 PF03354 Terminase_1:  Phage Te  42.7      49  0.0011   27.5   4.5   61   26-86    347-419 (477)
 42 cd02947 TRX_family TRX family;  42.5      66  0.0014   18.4   4.4   30   56-86      4-33  (93)
 43 PF06676 DUF1178:  Protein of u  39.2      13 0.00028   27.4   0.6   25   49-73    121-145 (148)
 44 KOG0191|consensus               37.6      59  0.0013   26.0   4.2   63    7-75    104-175 (383)
 45 PF13098 Thioredoxin_2:  Thiore  37.0      28  0.0006   22.0   1.8   19   60-78      3-21  (112)
 46 PF02677 DUF208:  Uncharacteriz  35.7      32  0.0007   26.0   2.3   27   55-82     15-41  (176)
 47 cd02992 PDI_a_QSOX PDIa family  34.3      40 0.00087   22.3   2.4   30   47-76      3-33  (114)
 48 cd03071 PDI_b'_NRX PDIb' famil  34.2      54  0.0012   23.7   3.1   35   49-85      3-37  (116)
 49 cd03073 PDI_b'_ERp72_ERp57 PDI  33.2   1E+02  0.0022   20.8   4.3   23   47-71      1-23  (111)
 50 cd02989 Phd_like_TxnDC9 Phosdu  32.8 1.3E+02  0.0029   19.9   4.7   32   47-78      6-38  (113)
 51 COG2411 Uncharacterized conser  31.3      14 0.00031   28.6  -0.3   23   39-61     55-85  (188)
 52 PF12045 DUF3528:  Protein of u  31.1      20 0.00043   26.7   0.5   10   44-53     29-38  (143)
 53 PRK09381 trxA thioredoxin; Pro  30.6      56  0.0012   20.7   2.5   32   47-78      5-37  (109)
 54 TIGR00424 APS_reduc 5'-adenyly  30.6      43 0.00093   28.6   2.4   32   46-77    352-386 (463)
 55 cd06232 Peptidase_M14-like_5 P  30.3      67  0.0014   25.6   3.3   26   65-90    170-195 (240)
 56 PF01216 Calsequestrin:  Calseq  30.1 1.7E+02  0.0037   25.0   5.8   69    6-86    114-189 (383)
 57 cd02948 TRX_NDPK TRX domain, T  30.0      38 0.00083   21.7   1.6   27   52-78      7-33  (102)
 58 PF13899 Thioredoxin_7:  Thiore  29.7      45 0.00099   20.5   1.9   22   56-77     11-32  (82)
 59 cd02949 TRX_NTR TRX domain, no  28.1      56  0.0012   20.5   2.2   24   55-78      6-29  (97)
 60 cd02956 ybbN ybbN protein fami  27.5      58  0.0013   20.0   2.1   22   57-78      6-28  (96)
 61 cd04395 RhoGAP_ARHGAP21 RhoGAP  27.2      31 0.00068   25.2   1.0   44   42-88     16-59  (196)
 62 TIGR02187 GlrX_arch Glutaredox  27.1 1.4E+02   0.003   21.9   4.4   63    8-75     81-146 (215)
 63 TIGR01295 PedC_BrcD bacterioci  26.7      54  0.0012   22.3   2.0   40   47-86      8-50  (122)
 64 cd02994 PDI_a_TMX PDIa family,  26.7      70  0.0015   19.9   2.4   29   47-77      3-31  (101)
 65 cd02958 UAS UAS family; UAS is  26.3 1.1E+02  0.0024   19.8   3.4   21   57-77     12-32  (114)
 66 smart00021 DAX Domain present   26.0      46   0.001   22.5   1.5   30   59-88     11-40  (83)
 67 PF09494 Slx4:  Slx4 endonuclea  25.6      58  0.0013   20.1   1.8   14   31-44     46-59  (64)
 68 KOG0086|consensus               25.4      35 0.00077   26.5   1.0   36   28-63     93-145 (214)
 69 PRK10377 PTS system glucitol/s  25.2      45 0.00097   23.6   1.4   21   53-75     14-36  (120)
 70 PF02844 GARS_N:  Phosphoribosy  24.6   1E+02  0.0022   21.2   3.1   25   23-47     42-66  (100)
 71 cd06402 PB1_p62 The PB1 domain  24.2      90  0.0019   21.0   2.7   21   27-48     24-44  (87)
 72 cd02965 HyaE HyaE family; HyaE  24.2      99  0.0021   21.5   3.0   25   49-73     14-38  (111)
 73 cd03066 PDI_b_Calsequestrin_mi  24.1 1.8E+02  0.0038   18.7   4.0   40   47-86      2-43  (102)
 74 cd02951 SoxW SoxW family; SoxW  23.5      67  0.0015   21.0   2.0   23   55-77      6-29  (125)
 75 PF14875 PIP49_N:  N-term cyste  23.3      52  0.0011   24.3   1.5   62   21-94     83-144 (158)
 76 cd07379 MPP_239FB Homo sapiens  22.9 2.4E+02  0.0051   18.7   4.9   50   23-73     23-78  (135)
 77 cd02960 AGR Anterior Gradient   22.9      55  0.0012   23.4   1.5   23   51-73     11-34  (130)
 78 PF11303 DUF3105:  Protein of u  22.8 1.2E+02  0.0025   21.7   3.2   34   52-87     40-74  (130)
 79 PTZ00443 Thioredoxin domain-co  22.8      70  0.0015   24.5   2.2   32   46-77     31-67  (224)
 80 COG4199 Uncharacterized protei  22.8      52  0.0011   25.8   1.4   15   28-42    184-198 (201)
 81 cd07244 FosA FosA, a Fosfomyci  22.3 1.1E+02  0.0024   19.5   2.8   36   30-75     68-103 (121)
 82 PF12652 CotJB:  CotJB protein;  21.8      97  0.0021   20.4   2.4   21   67-87     21-41  (78)
 83 COG3403 Uncharacterized conser  21.5      83  0.0018   25.4   2.4   57   23-91     56-117 (257)
 84 cd00405 PRAI Phosphoribosylant  20.9      89  0.0019   22.6   2.3   55   27-83    138-201 (203)
 85 cd02952 TRP14_like Human TRX-r  20.8      74  0.0016   22.1   1.8   17   55-71     12-30  (119)
 86 cd02991 UAS_ETEA UAS family, E  20.5      73  0.0016   21.7   1.7   18   57-74     12-29  (116)
 87 PRK06552 keto-hydroxyglutarate  20.3 1.6E+02  0.0035   22.3   3.7   53   32-84      4-61  (213)
 88 TIGR00849 gutA PTS system, glu  20.3      64  0.0014   22.9   1.4   21   53-75     14-36  (121)
 89 cd03000 PDI_a_TMX3 PDIa family  20.1      85  0.0018   19.8   1.9   25   53-78      7-31  (104)
 90 cd00894 PI3Kc_IB_gamma Phospho  20.0 1.5E+02  0.0032   24.8   3.7   41   39-81     76-116 (365)

No 1  
>KOG0912|consensus
Probab=100.00  E-value=4.8e-41  Score=271.29  Aligned_cols=91  Identities=55%  Similarity=0.966  Sum_probs=85.6

Q ss_pred             CCCCCCCeEEecCCCCCCCCcceeeecCCCCHHHHHHhhhhccccceeeeeccchhhhhhcCCceEEEeeCCCChhHHHH
Q psy5544           1 MHPPGEPIIVFRPDVTTPLEEHETYRGNLSAYDETKVWTADKCVPLVREITFENAEELTEEGLPFLILFYAPGDTETIKL   80 (96)
Q Consensus         1 ~~~~g~~~i~Fr~~~~~~~~~~~~f~G~~sn~~~l~~W~~~kCvPLVREITFeNaEELtEEgLPfLILF~~pdD~~s~k~   80 (96)
                      ++++|.++++|+|+.+..   .+.|+|||+||+++++||++|||||||||||||||||||||||||||||+|||++|+|.
T Consensus       169 ~~~~~~~~~~f~pd~~~~---~~~f~G~~~nf~el~~Wi~dKcvpLVREiTFeN~EELtEEGlPflILf~~kdD~~s~k~  245 (375)
T KOG0912|consen  169 HEPPGKNILVFDPDHSEP---NHEFLGSMTNFDELKQWIQDKCVPLVREITFENAEELTEEGLPFLILFRKKDDKESEKI  245 (375)
T ss_pred             CCCCCCceEEeCCCcCCc---CcccccccccHHHHHHHHHhcchhhhhhhhhccHHHHhhcCCceEEEEecCCcccHHHH
Confidence            478899999999987443   46999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHHhccccc
Q psy5544          81 FKSIVSEQLLGEKH   94 (96)
Q Consensus        81 F~~~V~~~L~~~k~   94 (96)
                      |+++|+|||.++++
T Consensus       246 F~~aI~ReL~~e~~  259 (375)
T KOG0912|consen  246 FKNAIARELDDETL  259 (375)
T ss_pred             HHHHHHHHhhhhhh
Confidence            99999999999886


No 2  
>PF13848 Thioredoxin_6:  Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A ....
Probab=98.97  E-value=5.9e-09  Score=72.12  Aligned_cols=79  Identities=29%  Similarity=0.398  Sum_probs=63.1

Q ss_pred             CCCCeEEecCCCCCCCCcceeeecCCCCHHHHHHhhhhccccceeeeeccchhhhhhcCCc-eEEEeeCCCChhHHHHHH
Q psy5544           4 PGEPIIVFRPDVTTPLEEHETYRGNLSAYDETKVWTADKCVPLVREITFENAEELTEEGLP-FLILFYAPGDTETIKLFK   82 (96)
Q Consensus         4 ~g~~~i~Fr~~~~~~~~~~~~f~G~~sn~~~l~~W~~~kCvPLVREITFeNaEELtEEgLP-fLILF~~pdD~~s~k~F~   82 (96)
                      +...+++||+...    ....|.|+..+.+.|..|+.....|+|.++|-+|+..+...++| .|+||.+++ .+..+.+.
T Consensus        40 ~~p~i~~~k~~~~----~~~~y~~~~~~~~~l~~fI~~~~~P~v~~~t~~n~~~~~~~~~~~~~~~~~~~~-~~~~~~~~  114 (184)
T PF13848_consen   40 KEPTIVVYKKFDE----KPVVYDGDKFTPEELKKFIKKNSFPLVPELTPENFEKLFSSPKPPVLILFDNKD-NESTEAFK  114 (184)
T ss_dssp             SSSEEEEEECTTT----SEEEESSSTTSHHHHHHHHHHHSSTSCEEESTTHHHHHHSTSSEEEEEEEETTT-HHHHHHHH
T ss_pred             CCCcEEEeccCCC----CceecccccCCHHHHHHHHHHhccccccccchhhHHHHhcCCCceEEEEEEcCC-chhHHHHH
Confidence            3456888998432    23789999669999999999999999999999999999999998 777775554 55667777


Q ss_pred             HHHHH
Q psy5544          83 SIVSE   87 (96)
Q Consensus        83 ~~V~~   87 (96)
                      +.+..
T Consensus       115 ~~l~~  119 (184)
T PF13848_consen  115 KELQD  119 (184)
T ss_dssp             HHHHH
T ss_pred             HHHHH
Confidence            65543


No 3  
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. Through the formation of reversible mixed disulfides, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. ERp44 also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol. Similar to PDI, the b' domain of ERp44 is likely involved in substrate recognition and may be the primary binding site.
Probab=98.76  E-value=9.5e-09  Score=70.19  Aligned_cols=48  Identities=69%  Similarity=0.962  Sum_probs=45.2

Q ss_pred             eeeeeccchhhhhhcCCceEEEeeCCCChhHHHHHHHHHHHHhccccc
Q psy5544          47 VREITFENAEELTEEGLPFLILFYAPGDTETIKLFKSIVSEQLLGEKH   94 (96)
Q Consensus        47 VREITFeNaEELtEEgLPfLILF~~pdD~~s~k~F~~~V~~~L~~~k~   94 (96)
                      |||+|++|++.+.+.++|..+||++|++.++++.+...|.++|.+.||
T Consensus         1 ~~e~t~e~~~~~~~~~~~~~~l~f~~~~~~~~~~~~~~vAk~~~~~kg   48 (111)
T cd03072           1 VREITFENAEELTEEGLPFLILFHDKDDLESLKEFKQAVARQLISEKG   48 (111)
T ss_pred             CcccccccHHHHhcCCCCeEEEEecchHHHHHHHHHHHHHHHHHhcCc
Confidence            899999999999999999999999999999999999999999877765


No 4  
>PTZ00102 disulphide isomerase; Provisional
Probab=98.40  E-value=1.2e-06  Score=69.61  Aligned_cols=79  Identities=22%  Similarity=0.282  Sum_probs=61.8

Q ss_pred             CCeEEecCCCCCCCCcceeeecCCCCHHHHHHhhhhccccceeeeeccchhhhhhcCCceEEEeeCCCChhHHHHHHHHH
Q psy5544           6 EPIIVFRPDVTTPLEEHETYRGNLSAYDETKVWTADKCVPLVREITFENAEELTEEGLPFLILFYAPGDTETIKLFKSIV   85 (96)
Q Consensus         6 ~~~i~Fr~~~~~~~~~~~~f~G~~sn~~~l~~W~~~kCvPLVREITFeNaEELtEEgLPfLILF~~pdD~~s~k~F~~~V   85 (96)
                      .++.+||.+...    -..|.|+  +.+.|.+|+..++.|+|+++|.+|...+.+.++|+++++++++|.+.++..-..|
T Consensus       199 ~~~~~~~~~~~~----~~~~~~~--~~~~l~~fI~~~~~P~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  272 (477)
T PTZ00102        199 NKIYVLHKDEEG----VELFMGK--TKEELEEFVSTESFPLFAEINAENYRRYISSGKDLVWFCGTTEDYDKYKSVVRKV  272 (477)
T ss_pred             CcEEEEecCCCC----cccCCCC--CHHHHHHHHHHcCCCceeecCccchHHHhcCCccEEEEecCHHHHHHHHHHHHHH
Confidence            345677764322    2335554  8899999999999999999999999999999999998898888877766665666


Q ss_pred             HHHhc
Q psy5544          86 SEQLL   90 (96)
Q Consensus        86 ~~~L~   90 (96)
                      .+.+.
T Consensus       273 A~~~~  277 (477)
T PTZ00102        273 ARKLR  277 (477)
T ss_pred             HHhcc
Confidence            66553


No 5  
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic. Members of this family have at least two protein-disulfide domains, each similar to thioredoxin but with the redox-active disulfide in the motif PWCGHCK, and an ER retention signal at the extreme C-terminus (KDEL, HDEL, and similar motifs).
Probab=98.29  E-value=3.9e-06  Score=65.44  Aligned_cols=67  Identities=22%  Similarity=0.545  Sum_probs=54.1

Q ss_pred             CCeEEecCCCCCCCCcceeeecCCC-CHHHHHHhhhhccccceeeeeccchhhhhhcCCceEEEeeCCCCh
Q psy5544           6 EPIIVFRPDVTTPLEEHETYRGNLS-AYDETKVWTADKCVPLVREITFENAEELTEEGLPFLILFYAPGDT   75 (96)
Q Consensus         6 ~~~i~Fr~~~~~~~~~~~~f~G~~s-n~~~l~~W~~~kCvPLVREITFeNaEELtEEgLPfLILF~~pdD~   75 (96)
                      ..+++|++.....  ....|.|+.+ +.+.|..|+.+.+.|+|+++|.+|+..+.+.+ |+++||+..++.
T Consensus       179 ~~~~~~~~~~~~~--~~~~~~~~~~~~~~~l~~fi~~~~~p~v~~~~~~~~~~~~~~~-~~~~l~~~~~~~  246 (462)
T TIGR01130       179 DSVVLFKPKDEDE--KFSKVDGEMDTDVSDLEKFIRAESLPLVGEFTQETAAKYFESG-PLVVLYYNVDES  246 (462)
T ss_pred             CcEEEeccccccc--ccccccCcccCCHHHHHHHHHHcCCCceEeeCCcchhhHhCCC-CceeEEEEecCC
Confidence            3457788765332  2257889875 46899999999999999999999999999988 999999986643


No 6  
>cd03070 PDI_b_ERp44 PDIb family, ERp44 subfamily, first redox inactive TRX-like domain b; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. Through the formation of reversible mixed disulfides, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. ERp44 also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol. Similar to PDI, the b domain of ERp44 is likely involved in binding to substrates.
Probab=98.21  E-value=1.2e-06  Score=59.69  Aligned_cols=33  Identities=36%  Similarity=0.675  Sum_probs=27.5

Q ss_pred             CCCCCCCeEEecCCCCCCCCcceeeecCCCCHHHHH
Q psy5544           1 MHPPGEPIIVFRPDVTTPLEEHETYRGNLSAYDETK   36 (96)
Q Consensus         1 ~~~~g~~~i~Fr~~~~~~~~~~~~f~G~~sn~~~l~   36 (96)
                      ++++|.++|+|||++ .+  ++++|+||+|||++|+
T Consensus        59 ~~~~~~~~i~frp~~-~~--~~~~y~G~~tn~~~l~   91 (91)
T cd03070          59 ERPPGDNIIYFPPGH-NA--PDMVYLGSLTNFDLLK   91 (91)
T ss_pred             ccCCCCCeEEECCCC-CC--CceEEccCCCChhhhC
Confidence            367889999999985 33  5699999999999874


No 7  
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds. It also displays chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. ERp57 contains two redox-active TRX (a) domains and two redox inactive TRX-like (b) domains.  It shares the same domain arrangement of abb'a' as PDI, but lacks the C-terminal acid-rich region (c domain) that is present in PDI. ERp57 interacts with the lectin chaperones, calnexin and calreticulin, and specifically promotes the oxidative folding of glycoproteins. Similar to PDI, the b domain of ERp57 is likely involved in binding to substrates.
Probab=95.44  E-value=0.018  Score=38.29  Aligned_cols=37  Identities=22%  Similarity=0.477  Sum_probs=26.7

Q ss_pred             CCCeEEecCCC--CCCCCcceeeecCCCCHHHHHHhhhhc
Q psy5544           5 GEPIIVFRPDV--TTPLEEHETYRGNLSAYDETKVWTADK   42 (96)
Q Consensus         5 g~~~i~Fr~~~--~~~~~~~~~f~G~~sn~~~l~~W~~~k   42 (96)
                      +.++++|||+.  ..-++....|.|+++ .+.|..|+++.
T Consensus        65 ~~~ivl~~p~~~~~k~de~~~~y~g~~~-~~~l~~fi~~~  103 (104)
T cd03069          65 GEGVVLFRPPRLSNKFEDSSVKFDGDLD-SSKIKKFIREN  103 (104)
T ss_pred             CCceEEEechhhhcccCcccccccCcCC-HHHHHHHHHhh
Confidence            45689999974  111123467999986 89999999864


No 8  
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic. Members of this family have at least two protein-disulfide domains, each similar to thioredoxin but with the redox-active disulfide in the motif PWCGHCK, and an ER retention signal at the extreme C-terminus (KDEL, HDEL, and similar motifs).
Probab=95.35  E-value=0.1  Score=40.79  Aligned_cols=75  Identities=21%  Similarity=0.315  Sum_probs=56.9

Q ss_pred             eEEecCCCCCCCCcceeeecCCCCHHHHHHhhhhccccceeeee-ccchhhhhhcCCceEEEeeCCCChhHHHHHHHHHH
Q psy5544           8 IIVFRPDVTTPLEEHETYRGNLSAYDETKVWTADKCVPLVREIT-FENAEELTEEGLPFLILFYAPGDTETIKLFKSIVS   86 (96)
Q Consensus         8 ~i~Fr~~~~~~~~~~~~f~G~~sn~~~l~~W~~~kCvPLVREIT-FeNaEELtEEgLPfLILF~~pdD~~s~k~F~~~V~   86 (96)
                      +++|+.....    -..|.|.. +.+.+.+|+.+.--|-+.+|+ .++.+++.+..-+.+|+|....|....+.|.++..
T Consensus        79 ~~~~~~g~~~----~~~~~g~~-~~~~l~~~i~~~~~~~~~~i~~~~~~~~~~~~~~~~vi~~~~~~~~~~~~~~~~~a~  153 (462)
T TIGR01130        79 LKIFRNGEDS----VSDYNGPR-DADGIVKYMKKQSGPAVKEIETVADLEAFLADDDVVVIGFFKDLDSELNDTFLSVAE  153 (462)
T ss_pred             EEEEeCCccc----eeEecCCC-CHHHHHHHHHHhcCCCceeecCHHHHHHHHhcCCcEEEEEECCCCcHHHHHHHHHHH
Confidence            5677754321    26788986 679999999999999999996 88888877777777888777666677788877654


Q ss_pred             H
Q psy5544          87 E   87 (96)
Q Consensus        87 ~   87 (96)
                      .
T Consensus       154 ~  154 (462)
T TIGR01130       154 K  154 (462)
T ss_pred             H
Confidence            3


No 9  
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants. Members of this family include PDI, calsequestrin and other PDI-related proteins like ERp72, ERp57, ERp44 and PDIR. PDI, ERp57 (or ERp60), ERp72 and PDIR are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and one or more redox inactive TRX-like (b) domains. The molecular structure of PDI is abb'a'. Also included in this family is the PDI-related protein ERp27, which contai
Probab=93.51  E-value=0.12  Score=32.62  Aligned_cols=33  Identities=18%  Similarity=0.383  Sum_probs=25.3

Q ss_pred             CCCCeEEecCCCCCCCCcceeeecCCCCHHHHHHhhhh
Q psy5544           4 PGEPIIVFRPDVTTPLEEHETYRGNLSAYDETKVWTAD   41 (96)
Q Consensus         4 ~g~~~i~Fr~~~~~~~~~~~~f~G~~sn~~~l~~W~~~   41 (96)
                      .+.++++|||...    ....|.|+++ .+.|.+|+.+
T Consensus        64 ~~~~i~l~~~~~~----~~~~y~g~~~-~~~l~~fi~~   96 (97)
T cd02981          64 KPGSVVLFKPFEE----EPVEYDGEFT-EESLVEFIKD   96 (97)
T ss_pred             CCCceEEeCCccc----CCccCCCCCC-HHHHHHHHHh
Confidence            3456899999632    2367999987 8999999975


No 10 
>PTZ00102 disulphide isomerase; Provisional
Probab=88.76  E-value=2.6  Score=33.68  Aligned_cols=72  Identities=22%  Similarity=0.306  Sum_probs=50.2

Q ss_pred             eEEecCCCCCCCCcceeeecCCCCHHHHHHhhhhccccceeeeeccchhhhh-hcCCceEEEeeCCCChhHHHHHHHHHH
Q psy5544           8 IIVFRPDVTTPLEEHETYRGNLSAYDETKVWTADKCVPLVREITFENAEELT-EEGLPFLILFYAPGDTETIKLFKSIVS   86 (96)
Q Consensus         8 ~i~Fr~~~~~~~~~~~~f~G~~sn~~~l~~W~~~kCvPLVREITFeNaEELt-EEgLPfLILF~~pdD~~s~k~F~~~V~   86 (96)
                      +++|+..+  .    ..|.|.. +.+.+.+|+.+..-|-+++|+=....+.. ....+..+++....|....+.|.+++.
T Consensus       110 ~~~~~~g~--~----~~y~g~~-~~~~l~~~l~~~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~~~a~  182 (477)
T PTZ00102        110 IKFFNKGN--P----VNYSGGR-TADGIVSWIKKLTGPAVTEVESASEIKLIAKKIFVAFYGEYTSKDSELYKKFEEVAD  182 (477)
T ss_pred             EEEEECCc--e----EEecCCC-CHHHHHHHHHHhhCCCceeecCHHHHHHhhccCcEEEEEEeccCCcHHHHHHHHHHH
Confidence            67788643  2    3788985 78999999999999999999844332222 233345555555566788899987654


No 11 
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention. It contains an N-terminal TRX domain, similar to that of PDIa, with a CXFS motif followed by two redox inactive TRX-like domains, homologous to the b and b' domains of PDI. The CXFS motif in the N-terminal domain allows ERp44 to form stable reversible mixed disulfides with its substrates. Through this activity, ERp44 mediates the ER localization of Ero1alpha, a protein that oxidizes protein disulfide isomerases into their active form. ERp44 also prevents the secretion of unassembled cargo protein with unpaired cysteines. It also modulates the activity of inositol 1,4,5-triphosphate type I receptor (IP3R1), an intracellular channel protein that mediates calcium release from the ER to the cytosol.
Probab=88.55  E-value=0.42  Score=30.92  Aligned_cols=31  Identities=19%  Similarity=0.229  Sum_probs=27.1

Q ss_pred             eeeeeccchhhhhhcCCceEEEeeCCCChhH
Q psy5544          47 VREITFENAEELTEEGLPFLILFYAPGDTET   77 (96)
Q Consensus        47 VREITFeNaEELtEEgLPfLILF~~pdD~~s   77 (96)
                      |-|+|-+|-++...++.|.||.||.|--...
T Consensus         3 v~~l~~~~f~~~i~~~~~vlv~F~a~wC~~C   33 (108)
T cd02996           3 IVSLTSGNIDDILQSAELVLVNFYADWCRFS   33 (108)
T ss_pred             eEEcCHhhHHHHHhcCCEEEEEEECCCCHHH
Confidence            6689999999999999999999999876543


No 12 
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants. Members of this family include PDI, calsequestrin and other PDI-related proteins like ERp72, ERp57 (or ERp60), ERp44, P5 and PDIR. PDI, ERp57, ERp72, P5 and PDIR are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and one or more redox inactive TRX-like (b) domains. The molecular structure of PDI is abb'a'. Also included in this family is the PDI-related protein ERp27, w
Probab=87.99  E-value=1.1  Score=28.26  Aligned_cols=36  Identities=39%  Similarity=0.593  Sum_probs=23.1

Q ss_pred             eccchhhhhhcCCceEEEeeCCCC--hhHHHHHHHHHHHHh
Q psy5544          51 TFENAEELTEEGLPFLILFYAPGD--TETIKLFKSIVSEQL   89 (96)
Q Consensus        51 TFeNaEELtEEgLPfLILF~~pdD--~~s~k~F~~~V~~~L   89 (96)
                      ||.|.++.   |.|.+++|+.+++  .+..+..-+.|.+++
T Consensus         4 ~~~~~~~~---~~~~~~~f~~~~~~~~~~~~~~~~~vA~~~   41 (103)
T cd02982           4 TFFNYEES---GKPLLVLFYNKDDSESEELRERFKEVAKKF   41 (103)
T ss_pred             HHhhhhhc---CCCEEEEEEcCChhhHHHHHHHHHHHHHHh
Confidence            55665555   8999999999877  334443334455444


No 13 
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds. It also displays chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. ERp72 contains three redox-active TRX (a) domains and two redox inactive TRX-like (b) domains.  Its molecular structure is a"abb'a', compared to the abb'a' structure of PDI. ERp72 associates with several ER chaperones and folding factors to form complexes in the ER that bind nascent proteins. Similar to PDI, the b domain of ERp72 is likely involved in binding to substrates.
Probab=84.74  E-value=1  Score=30.38  Aligned_cols=38  Identities=16%  Similarity=0.259  Sum_probs=27.5

Q ss_pred             CCCCeEEecCCCCCC--CCcceeeecC-CCCHHHHHHhhhh
Q psy5544           4 PGEPIIVFRPDVTTP--LEEHETYRGN-LSAYDETKVWTAD   41 (96)
Q Consensus         4 ~g~~~i~Fr~~~~~~--~~~~~~f~G~-~sn~~~l~~W~~~   41 (96)
                      .+.++++|||+.-..  ++....|.|+ ++.=+.|..|+++
T Consensus        66 ~~~~vvl~rp~~~~~k~e~~~~~~~~~~~~~~~~~~~f~~~  106 (107)
T cd03068          66 SPGQLVVFQPEKFQSKYEPKSHVLNKKDSTSEDELKDFFKE  106 (107)
T ss_pred             CCCceEEECcHHHhhhcCcceeeeeccccchHHHHHHHHhc
Confidence            456789999996332  3355789988 6555669999976


No 14 
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related). PDIR is composed of three redox active TRX (a) domains and an N-terminal redox inactive TRX-like (b) domain. Similar to PDI, it is involved in oxidative protein folding in the endoplasmic reticulum (ER) through its isomerase and chaperone activities. These activities are lower compared to PDI, probably due to PDIR acting only on a subset of proteins. PDIR is preferentially expressed in cells actively secreting proteins and its expression is induced by stress. Similar to PDI, the isomerase and chaperone activities of PDIR are independent; CXXC mutants lacking isomerase activity retain chaperone activity.
Probab=81.82  E-value=2.4  Score=26.34  Aligned_cols=33  Identities=27%  Similarity=0.348  Sum_probs=27.9

Q ss_pred             eeeeeccchhhhhhcCCceEEEeeCCCChhHHH
Q psy5544          47 VREITFENAEELTEEGLPFLILFYAPGDTETIK   79 (96)
Q Consensus        47 VREITFeNaEELtEEgLPfLILF~~pdD~~s~k   79 (96)
                      |.++|-.|-+++...+-|.+|+|+.|......+
T Consensus         2 ~~~l~~~~~~~~~~~~~~~~v~f~a~wC~~C~~   34 (104)
T cd02997           2 VVHLTDEDFRKFLKKEKHVLVMFYAPWCGHCKK   34 (104)
T ss_pred             eEEechHhHHHHHhhCCCEEEEEECCCCHHHHH
Confidence            668888888999999999999999998775543


No 15 
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1. PDI, ERp72 and ERp57 are endoplasmic reticulum (ER)-resident eukaryotic proteins involved in oxidative protein folding. They are oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. PDI and ERp57 have the abb'a' domain structure (where a and a' are redox active TRX domains while b and b' are redox inactive TRX-like domains). PDI also contains an acidic region (c domain) after the a' domain that is absent in ERp57. ERp72 has an additional a domain at the N-terminus (a"abb'a' domain structure). ERp57 interacts with the lectin chaperones, calnexin and calreticu
Probab=80.64  E-value=3.1  Score=25.75  Aligned_cols=32  Identities=25%  Similarity=0.333  Sum_probs=26.5

Q ss_pred             eeeeeccchhhhh-hcCCceEEEeeCCCChhHH
Q psy5544          47 VREITFENAEELT-EEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        47 VREITFeNaEELt-EEgLPfLILF~~pdD~~s~   78 (96)
                      |.++|-+|-+.++ .+|.|.||+||.|......
T Consensus         2 v~~l~~~~f~~~i~~~~~~~~v~f~~~~C~~C~   34 (104)
T cd02995           2 VKVVVGKNFDEVVLDSDKDVLVEFYAPWCGHCK   34 (104)
T ss_pred             eEEEchhhhHHHHhCCCCcEEEEEECCCCHHHH
Confidence            6789999998865 5579999999999887554


No 16 
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is comprised of the first TRX domain of ERdj5 located after the DnaJ domain at the N-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation.
Probab=80.37  E-value=1.8  Score=27.48  Aligned_cols=33  Identities=15%  Similarity=0.352  Sum_probs=27.6

Q ss_pred             cceeeeeccchhhhhhcCCceEEEeeCCCChhH
Q psy5544          45 PLVREITFENAEELTEEGLPFLILFYAPGDTET   77 (96)
Q Consensus        45 PLVREITFeNaEELtEEgLPfLILF~~pdD~~s   77 (96)
                      |=|.++|-+|-++...++.|.||.||.|.-...
T Consensus         1 ~~~~~l~~~~f~~~v~~~~~~~v~f~a~wC~~C   33 (101)
T cd03003           1 PEIVTLDRGDFDAAVNSGEIWFVNFYSPRCSHC   33 (101)
T ss_pred             CCeEEcCHhhHHHHhcCCCeEEEEEECCCChHH
Confidence            346788888999999999999999999987643


No 17 
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains. Yeast complementation studies show that ERp46 can substitute for protein disulfide isomerase (PDI) function in vivo. It has been detected in many tissues, however, transcript and protein levels do not correlate in all tissues, suggesting regulation at a posttranscriptional level. An identical protein, named endoPDI, has been identified as an endothelial PDI that is highly expressed in the endothelium of tumors and hypoxic lesions. It has a protective effect on cells exposed to hypoxia.
Probab=79.58  E-value=1.7  Score=27.02  Aligned_cols=31  Identities=29%  Similarity=0.375  Sum_probs=25.8

Q ss_pred             eeeeeccchhhhhhcCCceEEEeeCCCChhHH
Q psy5544          47 VREITFENAEELTEEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        47 VREITFeNaEELtEEgLPfLILF~~pdD~~s~   78 (96)
                      |-++|.+|-++.+..| |.||.||.|--....
T Consensus         2 ~~~l~~~~f~~~~~~~-~~lv~f~a~wC~~C~   32 (102)
T cd03005           2 VLELTEDNFDHHIAEG-NHFVKFFAPWCGHCK   32 (102)
T ss_pred             eeECCHHHHHHHhhcC-CEEEEEECCCCHHHH
Confidence            5688999999999888 699999999776443


No 18 
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein. MPD1 has been shown to suppress the maturation defect of carboxypeptidase Y caused by deletion of the yeast PDI1 gene. Other characterized members of this subfamily include the Aspergillus niger prpA protein and Giardia PDI-1. PrpA is non-essential to strain viability, however, its transcript level is induced by heterologous protein expression suggesting a possible role in oxidative protein folding during high protein production. Giardia PDI-1 has the ability to refold scrambled RNase and exhibits transglutaminase activity.
Probab=75.13  E-value=3.2  Score=26.27  Aligned_cols=32  Identities=28%  Similarity=0.343  Sum_probs=25.7

Q ss_pred             eeeeeccchhhhh-hcCCceEEEeeCCCChhHH
Q psy5544          47 VREITFENAEELT-EEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        47 VREITFeNaEELt-EEgLPfLILF~~pdD~~s~   78 (96)
                      |.++|-+|.++.. +.|.|.|+.||.|.-....
T Consensus         2 v~~l~~~~~~~~i~~~~~~~lv~f~a~wC~~C~   34 (109)
T cd03002           2 VYELTPKNFDKVVHNTNYTTLVEFYAPWCGHCK   34 (109)
T ss_pred             eEEcchhhHHHHHhcCCCeEEEEEECCCCHHHH
Confidence            5688888888864 6699999999999876543


No 19 
>KOG0190|consensus
Probab=74.62  E-value=6.4  Score=34.11  Aligned_cols=61  Identities=21%  Similarity=0.352  Sum_probs=46.1

Q ss_pred             eeeecCCCCHHHHHHhhhhccccceeeeeccchhhhhhcCCceEEEeeC--C--CChhHHHHHHHH
Q psy5544          23 ETYRGNLSAYDETKVWTADKCVPLVREITFENAEELTEEGLPFLILFYA--P--GDTETIKLFKSI   84 (96)
Q Consensus        23 ~~f~G~~sn~~~l~~W~~~kCvPLVREITFeNaEELtEEgLPfLILF~~--p--dD~~s~k~F~~~   84 (96)
                      -.|.|++++ +.|..|++..-+|||-++|=+|+-.+...+++.=++|+.  +  +--...+.|.++
T Consensus       216 ~~~~~~~~~-~~l~~Fi~~~~~plv~~ft~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~v  280 (493)
T KOG0190|consen  216 VKYDGSFTP-ELLKKFIQENSLPLVTEFTVANNAKIYSSFVKLGLDFFVFFKCNRFEELRKKFEEV  280 (493)
T ss_pred             hhcccccCH-HHHHHHHHHhcccccceecccccceeeccccccceeEEeccccccHHHHHHHHHHH
Confidence            446788876 459999999999999999999999999998887666655  3  223444555443


No 20 
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases. APS reductase catalyzes the reduction of activated sulfate to sulfite, a key step in the biosynthesis of sulfur-containing metabolites. Sulfate is first activated by ATP sulfurylase, forming APS, which can be phosphorylated to 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Depending on the organism, either APS or PAPS can be used for sulfate reduction. Prokaryotes and fungi use PAPS, whereas plants use both APS and PAPS. Since plant-type APS reductase uses glutathione (GSH) as its electron donor, the C-terminal domain may function like glutaredoxin, a GSH-dependent member of the TRX superfamily. The flow of reducing equivalents goes from GSH - C-terminal TRX domain - N-terminal reductase domain - APS. Plant-type APS red
Probab=74.05  E-value=3  Score=27.24  Aligned_cols=31  Identities=23%  Similarity=0.286  Sum_probs=25.6

Q ss_pred             eeeeeccchhhhhh---cCCceEEEeeCCCChhH
Q psy5544          47 VREITFENAEELTE---EGLPFLILFYAPGDTET   77 (96)
Q Consensus        47 VREITFeNaEELtE---EgLPfLILF~~pdD~~s   77 (96)
                      |-|||=+|.++++.   .|.|.||.||.|.-...
T Consensus         3 v~~~~~~~~~~~~~~~~~~k~vlv~f~a~wC~~C   36 (109)
T cd02993           3 VVTLSRAEIEALAKGERRNQSTLVVLYAPWCPFC   36 (109)
T ss_pred             ceeccHHHHHHHHhhhhcCCCEEEEEECCCCHHH
Confidence            56788889999985   68999999999986544


No 21 
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as  JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is composed of the three TRX domains located at the C-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation. Also included in the alignment is the single complete TRX domain of an uncharacterized protein from Tetraodon nigroviridis, which also contains a DnaJ domain at its N-terminus.
Probab=73.66  E-value=3.3  Score=26.26  Aligned_cols=33  Identities=36%  Similarity=0.462  Sum_probs=26.2

Q ss_pred             cceeeeeccchhhhh-hcCCceEEEeeCCCChhH
Q psy5544          45 PLVREITFENAEELT-EEGLPFLILFYAPGDTET   77 (96)
Q Consensus        45 PLVREITFeNaEELt-EEgLPfLILF~~pdD~~s   77 (96)
                      |-|.+||-+|-+++. ..+-|.||.||.|.-...
T Consensus         1 ~~v~~l~~~~f~~~i~~~~~~v~v~f~a~wC~~C   34 (104)
T cd03004           1 PSVITLTPEDFPELVLNRKEPWLVDFYAPWCGPC   34 (104)
T ss_pred             CcceEcCHHHHHHHHhcCCCeEEEEEECCCCHHH
Confidence            457889988888864 557799999999877654


No 22 
>COG3892 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=73.59  E-value=4.1  Score=33.45  Aligned_cols=44  Identities=18%  Similarity=0.502  Sum_probs=34.7

Q ss_pred             eecCCCCHHHHHHhhhhccccceeeeeccchhhhhhcCCceEEEeeCCCChhHHHHHHHHHHHHhc
Q psy5544          25 YRGNLSAYDETKVWTADKCVPLVREITFENAEELTEEGLPFLILFYAPGDTETIKLFKSIVSEQLL   90 (96)
Q Consensus        25 f~G~~sn~~~l~~W~~~kCvPLVREITFeNaEELtEEgLPfLILF~~pdD~~s~k~F~~~V~~~L~   90 (96)
                      |+||+.+  .|..|=++.||-                    .+.||||||..+++.=++.--.+|.
T Consensus       117 ~~~diGs--~Lv~WP~ehvVK--------------------cL~FYHPdD~a~lr~~Qe~k~~~l~  160 (310)
T COG3892         117 FSGDIGS--QLVEWPVEHVVK--------------------CLVFYHPDDPAELRAEQEQKLLELF  160 (310)
T ss_pred             cccchhh--HHhcCcHhhhee--------------------eeeecCCCCHHHHHHHHHHHHHHHH
Confidence            7888876  899999999985                    4589999999999876655444443


No 23 
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle. It stores calcium ions in sufficient quantities (up to 20 mM) to allow repetitive contractions and is essential to maintain movement, respiration and heart beat. A missense mutation in human cardiac calsequestrin is associated with catecholamine-induced polymorphic ventricular tachycardia (CPVT), a rare disease characterized by seizures or sudden death in response to physiologic or emotional stress. Calsequestrin is a highly acidic protein with up to 50 calcium binding sites formed simply by the clustering of two or more acidic residues. The monomer contains three redox inactive TRX-fold domains. Calsequestrin is condensed as a linear polymer in the SR lumen and is membrane-anchored through binding with intra-membrane proteins triadin, junctin and ryanodine receptor (RyR) Ca
Probab=73.58  E-value=6.4  Score=25.69  Aligned_cols=20  Identities=10%  Similarity=0.026  Sum_probs=15.0

Q ss_pred             eeeecCCCCHHHHHHhhhhc
Q psy5544          23 ETYRGNLSAYDETKVWTADK   42 (96)
Q Consensus        23 ~~f~G~~sn~~~l~~W~~~k   42 (96)
                      ..|.|+..+.+.|.+|++..
T Consensus        81 ~~y~~g~~~~~~l~~fi~~~  100 (102)
T cd03066          81 VTIPDKPYSEEELVDFVEEH  100 (102)
T ss_pred             cccCCCCCCHHHHHHHHHHh
Confidence            56844456899999999753


No 24 
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain). Like PDI, P5 is located in the endoplasmic reticulum (ER) and displays both isomerase and chaperone activities, which are independent of each other. Compared to PDI, the isomerase and chaperone activities of P5 are lower. The first cysteine in the CXXC motif of both redox active domains in P5 is necessary for isomerase activity. The P5 gene was first isolated as an amplified gene from a hydroxyurea-resistant hamster cell line. The zebrafish P5 homolog has been implicated to play a critical role in establishing left/right asymmetries in the embryonic midline. Some members of this subfamily are P5-like proteins containing only one redox active TRX domain.
Probab=73.11  E-value=5.6  Score=24.70  Aligned_cols=32  Identities=28%  Similarity=0.282  Sum_probs=24.9

Q ss_pred             eeeeeccchhhhh-hcCCceEEEeeCCCChhHH
Q psy5544          47 VREITFENAEELT-EEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        47 VREITFeNaEELt-EEgLPfLILF~~pdD~~s~   78 (96)
                      |.|+|-+|-+++. +.+.|.|++||.|......
T Consensus         2 v~~l~~~~~~~~i~~~~~~vlv~f~a~~C~~C~   34 (103)
T cd03001           2 VVELTDSNFDKKVLNSDDVWLVEFYAPWCGHCK   34 (103)
T ss_pred             eEEcCHHhHHHHHhcCCCcEEEEEECCCCHHHH
Confidence            5688888888765 6677799999998776443


No 25 
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants. Members of this family include PDI and PDI-related proteins like ERp72, ERp57 (or ERp60), ERp44, P5, PDIR, ERp46 and the transmembrane PDIs. PDI, ERp57, ERp72, P5, PDIR and ERp46 are all oxidases, catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER. They also exhibit reductase activity in acting as isomerases to correct any non-native disulfide bonds, as well as chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. These proteins usually contain multiple copies of a redox active TRX (a) domain containing a CXXC motif, and may also contain one or more redox inactive TRX-like (b) domains. Only one a domain is required for the oxidase function but multiple copies 
Probab=71.93  E-value=6.8  Score=23.39  Aligned_cols=31  Identities=32%  Similarity=0.417  Sum_probs=24.7

Q ss_pred             eeeccchhhhhhcCCceEEEeeCCCChhHHH
Q psy5544          49 EITFENAEELTEEGLPFLILFYAPGDTETIK   79 (96)
Q Consensus        49 EITFeNaEELtEEgLPfLILF~~pdD~~s~k   79 (96)
                      +||-++-+.+..++-|.||+|+.+......+
T Consensus         2 ~l~~~~~~~~i~~~~~~~v~f~~~~C~~C~~   32 (101)
T cd02961           2 ELTDDNFDELVKDSKDVLVEFYAPWCGHCKA   32 (101)
T ss_pred             cccHHHHHHHHhCCCcEEEEEECCCCHHHHh
Confidence            4667788888888889999999998755443


No 26 
>PF00085 Thioredoxin:  Thioredoxin;  InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms. Thioredoxin serves as a general protein disulphide oxidoreductase. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of two cysteine thiol groups to a disulphide, accompanied by the transfer of two electrons and two protons. The net result is the covalent interconversion of a disulphide and a dithiol. In the NADPH-dependent protein disulphide reduction, thioredoxin reductase (TR) catalyses the reduction of oxidised thioredoxin (trx) by NADPH using FAD and its redox-active disulphide; reduced thioredoxin then directly reduces the disulphide in the substrate protein [].  Thioredoxin is present in prokaryotes and eukaryotes and the sequence around the redox-active disulphide bond is well conserved. All thioredoxins contain a cis-proline located in a loop preceding beta-strand 4, which makes contact with the active site cysteines, and is important for stability and function []. Thioredoxin belongs to a structural family that includes glutaredoxin, glutathione peroxidase, bacterial protein disulphide isomerase DsbA, and the N-terminal domain of glutathione transferase []. Thioredoxins have a beta-alpha unit preceding the motif common to all these proteins.  A number of eukaryotic proteins contain domains evolutionary related to thioredoxin, most of them are protein disulphide isomerases (PDI). PDI (5.3.4.1 from EC) [, , ] is an endoplasmic reticulum multi-functional enzyme that catalyses the formation and rearrangement of disulphide bonds during protein folding []. All PDI contains two or three (ERp72) copies of the thioredoxin domain, each of which contributes to disulphide isomerase activity, but which are functionally non-equivalent []. Moreover, PDI exhibits chaperone-like activity towards proteins that contain no disulphide bonds, i.e. behaving independently of its disulphide isomerase activity []. The various forms of PDI which are currently known are:   PDI major isozyme; a multifunctional protein that also function as the beta subunit of prolyl 4-hydroxylase (1.14.11.2 from EC), as a component of oligosaccharyl transferase (2.4.1.119 from EC), as thyroxine deiodinase (3.8.1.4 from EC), as glutathione-insulin transhydrogenase (1.8.4.2 from EC) and as a thyroid hormone-binding protein ERp60 (ER-60; 58 Kd microsomal protein). ERp60 was originally thought to be a phosphoinositide-specific phospholipase C isozyme and later to be a protease. ERp72. ERp5.    Bacterial proteins that act as thiol:disulphide interchange proteins that allows disulphide bond formation in some periplasmic proteins also contain a thioredoxin domain. These proteins include:    Escherichia coli DsbA (or PrfA) and its orthologs in Vibrio cholerae (TtcpG) and Haemophilus influenzae (Por). E. coli DsbC (or XpRA) and its orthologues in Erwinia chrysanthemi and H. influenzae. E. coli DsbD (or DipZ) and its H. influenzae orthologue. E. coli DsbE (or CcmG) and orthologues in H. influenzae.  Rhodobacter capsulatus (Rhodopseudomonas capsulata) (HelX), Rhiziobiacae (CycY and TlpA).   This entry represents the thioredoxin domain.; GO: 0045454 cell redox homeostasis; PDB: 3ED3_B 1EP7_A 1EP8_B 1TOF_A 2OE3_B 2OE1_B 2OE0_B 1V98_A 3H79_A 3CXG_A ....
Probab=68.74  E-value=20  Score=21.85  Aligned_cols=33  Identities=33%  Similarity=0.410  Sum_probs=27.2

Q ss_pred             eeeeeccchhhhhhc-CCceEEEeeCCCChhHHH
Q psy5544          47 VREITFENAEELTEE-GLPFLILFYAPGDTETIK   79 (96)
Q Consensus        47 VREITFeNaEELtEE-gLPfLILF~~pdD~~s~k   79 (96)
                      |-++|=+|-++...+ +-|.||+||.|.......
T Consensus         1 v~~lt~~~f~~~i~~~~~~vvv~f~~~~C~~C~~   34 (103)
T PF00085_consen    1 VIVLTDENFEKFINESDKPVVVYFYAPWCPPCKA   34 (103)
T ss_dssp             SEEESTTTHHHHHTTTSSEEEEEEESTTSHHHHH
T ss_pred             CEECCHHHHHHHHHccCCCEEEEEeCCCCCcccc
Confidence            567888888888887 999999999998766554


No 27 
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as  JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains. This subfamily is composed of the three TRX domains located at the C-terminal half of the protein. ERdj5 is a ubiquitous protein localized in the endoplasmic reticulum (ER) and is abundant in secretory cells. It's transcription is induced during ER stress. It interacts with BiP through its DnaJ domain in an ATP-dependent manner. BiP, an ER-resident member of the Hsp70 chaperone family, functions in ER-associated degradation and protein translocation. Also included in the alignment is the single complete TRX domain of an uncharacterized protein from Tetraodon nigroviridis, which also contains a DnaJ domain at its N-terminus.
Probab=66.41  E-value=8  Score=24.43  Aligned_cols=28  Identities=14%  Similarity=0.233  Sum_probs=20.9

Q ss_pred             eEEecCCCCCCCCcceeeecCCCCHHHHHHhh
Q psy5544           8 IIVFRPDVTTPLEEHETYRGNLSAYDETKVWT   39 (96)
Q Consensus         8 ~i~Fr~~~~~~~~~~~~f~G~~sn~~~l~~W~   39 (96)
                      +++|++.+..    -..|.|..++.++|.+|+
T Consensus        77 ~~~~~~g~~~----~~~~~G~~~~~~~l~~~i  104 (104)
T cd03004          77 IRLYPGNASK----YHSYNGWHRDADSILEFI  104 (104)
T ss_pred             EEEEcCCCCC----ceEccCCCCCHHHHHhhC
Confidence            6778775333    367999887789999996


No 28 
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5. The cDNA clone of this protein (named G1) was isolated from an alfalfa cDNA library by screening with human protein disulfide isomerase (PDI) cDNA. The G1 protein is constitutively expressed in all major organs of the plant and its expression is induced by treatment with tunicamycin, indicating that it may be a glucose-regulated protein. The G1 homolog in the eukaryotic social amoeba Dictyostelium discoideum is also described as a P5-like protein, which is located in the endoplasmic reticulum (ER) despite the absence of an ER-retrieval signal. G1 homologs from Aspergillus niger and Neurospora crassa have also been characterized, and are named TIGA and ER
Probab=64.89  E-value=23  Score=21.72  Aligned_cols=32  Identities=28%  Similarity=0.313  Sum_probs=24.3

Q ss_pred             eeeeeccchhhhhh-cCCceEEEeeCCCChhHH
Q psy5544          47 VREITFENAEELTE-EGLPFLILFYAPGDTETI   78 (96)
Q Consensus        47 VREITFeNaEELtE-EgLPfLILF~~pdD~~s~   78 (96)
                      |-+||-+|-++++. .|.|.+++|+.+-.....
T Consensus         2 ~~~l~~~~~~~~~~~~~~~~~v~f~a~~C~~C~   34 (105)
T cd02998           2 VVELTDSNFDKVVGDDKKDVLVEFYAPWCGHCK   34 (105)
T ss_pred             eEEcchhcHHHHhcCCCCcEEEEEECCCCHHHH
Confidence            34677777777776 566999999998887554


No 29 
>PTZ00051 thioredoxin; Provisional
Probab=64.51  E-value=10  Score=23.50  Aligned_cols=35  Identities=17%  Similarity=0.161  Sum_probs=26.6

Q ss_pred             ceeeeec-cchhhhhhcCCceEEEeeCCCChhHHHH
Q psy5544          46 LVREITF-ENAEELTEEGLPFLILFYAPGDTETIKL   80 (96)
Q Consensus        46 LVREITF-eNaEELtEEgLPfLILF~~pdD~~s~k~   80 (96)
                      +|+||+= ++.+++.+++-|.||.||.+......+.
T Consensus         1 ~v~~i~~~~~~~~~~~~~~~vli~f~~~~C~~C~~~   36 (98)
T PTZ00051          1 MVHIVTSQAEFESTLSQNELVIVDFYAEWCGPCKRI   36 (98)
T ss_pred             CeEEecCHHHHHHHHhcCCeEEEEEECCCCHHHHHH
Confidence            4666663 4667788899999999999988766543


No 30 
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions. Phd and PhLPs specifically bind G protein betagamma (Gbg)-subunits with high affinity, resulting in the solubilization of Gbg from the plasma membrane and impeding G protein-mediated signal transduction by inhibiting the formation of a functional G protein trimer (G protein alphabetagamma). Phd also inhibits the GTPase activity of G protein alpha. Phd can be phosphorylated by protein kinase A and G protein-coupled receptor kinase 2, leading to its inactivation. Phd was originally isolated from the retina, where it is highly expressed and has been implicated to play an important role in light adaptation. It is also found in the pineal gland, liver, spleen, striated muscle and the brain. The C-terminal domain of Phd adopts a thioredoxin fold, but it does not contain a CXXC motif. Phd interacts with G protein beta mostly through the N-te
Probab=63.84  E-value=7.5  Score=25.54  Aligned_cols=32  Identities=28%  Similarity=0.388  Sum_probs=23.7

Q ss_pred             eeeeeccchhhhhhcC---CceEEEeeCCCChhHH
Q psy5544          47 VREITFENAEELTEEG---LPFLILFYAPGDTETI   78 (96)
Q Consensus        47 VREITFeNaEELtEEg---LPfLILF~~pdD~~s~   78 (96)
                      |++||=+|-.+.+.+.   .|.++.||.|......
T Consensus         6 v~~i~~~~f~~~i~~~~~~~~vvv~F~a~~c~~C~   40 (113)
T cd02957           6 VREISSKEFLEEVTKASKGTRVVVHFYEPGFPRCK   40 (113)
T ss_pred             EEEEcHHHHHHHHHccCCCCEEEEEEeCCCCCcHH
Confidence            6778777776665544   8999999999885443


No 31 
>TIGR01126 pdi_dom protein disulfide-isomerase domain. This model describes a domain of eukaryotic protein disulfide isomerases, generally found in two copies. The high cutoff for total score reflects the expectation of finding both copies. The domain is similar to thioredoxin but the redox-active disulfide region motif is APWCGHCK.
Probab=54.01  E-value=11  Score=23.04  Aligned_cols=28  Identities=21%  Similarity=0.265  Sum_probs=21.4

Q ss_pred             ccchhhhhhcCCceEEEeeCCCChhHHH
Q psy5544          52 FENAEELTEEGLPFLILFYAPGDTETIK   79 (96)
Q Consensus        52 FeNaEELtEEgLPfLILF~~pdD~~s~k   79 (96)
                      -+|-+++...|.|.+|+|+.+.-...-+
T Consensus         3 ~~~~~~~~~~~~~~~i~f~~~~C~~c~~   30 (102)
T TIGR01126         3 ASNFDDIVLSNKDVLVEFYAPWCGHCKN   30 (102)
T ss_pred             hhhHHHHhccCCcEEEEEECCCCHHHHh
Confidence            3455566668999999999998877643


No 32 
>TIGR02263 benz_CoA_red_C benzoyl-CoA reductase, subunit C. This model describes C subunit of benzoyl-CoA reductase, a 4-subunit enzyme. Many aromatic compounds are metabolized by way of benzoyl-CoA. This enzyme acts under anaerobic conditions.
Probab=52.51  E-value=21  Score=28.96  Aligned_cols=32  Identities=16%  Similarity=0.337  Sum_probs=27.2

Q ss_pred             hhhhhcCCceEEEeeCCCChhHHHHHHHHHHHH
Q psy5544          56 EELTEEGLPFLILFYAPGDTETIKLFKSIVSEQ   88 (96)
Q Consensus        56 EELtEEgLPfLILF~~pdD~~s~k~F~~~V~~~   88 (96)
                      +.|.|.|+|+|.|=|.. |...+++++..|++=
T Consensus       345 ~~l~e~GIP~L~id~~~-~~~~~~q~~t~~~~f  376 (380)
T TIGR02263       345 ARCKEHGIPQIAFKYAE-NSGQMQPIREQAGTF  376 (380)
T ss_pred             HHHHHCCCCEEEEEecC-ccchHHHHHHHHHHH
Confidence            56788999999997775 999999999888763


No 33 
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain. DnaJ is a member of the 40 kDa heat-shock protein (Hsp40) family of molecular chaperones, which regulate the activity of Hsp70s. TRX is involved in the redox regulation of many protein substrates through the reduction of disulfide bonds. TRX has been implicated to catalyse the reduction of Hsp33, a chaperone holdase that binds to unfolded protein intermediates. The presence of DnaJ and TRX domains in members of this family suggests that they could be involved in a redox-regulated chaperone network.
Probab=52.09  E-value=11  Score=24.72  Aligned_cols=29  Identities=24%  Similarity=0.267  Sum_probs=20.8

Q ss_pred             eeccchhh-hhh--cCCceEEEeeCCCChhHH
Q psy5544          50 ITFENAEE-LTE--EGLPFLILFYAPGDTETI   78 (96)
Q Consensus        50 ITFeNaEE-LtE--EgLPfLILF~~pdD~~s~   78 (96)
                      +|.++-++ +.+  .|.|.||.||.|.-....
T Consensus         9 ~~~~~~~~~~~~~~~~~~vlV~F~a~wC~~C~   40 (111)
T cd02963           9 LTFSQYENEIVPKSFKKPYLIKITSDWCFSCI   40 (111)
T ss_pred             eeHHHHHHhhccccCCCeEEEEEECCccHhHH
Confidence            45666654 333  689999999999876554


No 34 
>smart00594 UAS UAS domain.
Probab=50.48  E-value=28  Score=23.35  Aligned_cols=34  Identities=15%  Similarity=0.259  Sum_probs=25.2

Q ss_pred             cceeeeeccch-hhhhhcCCceEEEeeCCCChhHH
Q psy5544          45 PLVREITFENA-EELTEEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        45 PLVREITFeNa-EELtEEgLPfLILF~~pdD~~s~   78 (96)
                      |+.-.-+|+.| ++-..+|.+.+|.||.++...+.
T Consensus         9 ~~f~~gs~~~a~~~Ak~~~K~~lv~~~~~~c~~c~   43 (122)
T smart00594        9 PLFYQGSLEAAKQEASRQRRLLWLYLHSQDSPDSQ   43 (122)
T ss_pred             CceeeCCHHHHHHHHHhhcCCEEEEEeCCCCchHH
Confidence            55556677777 56678899999999998765443


No 35 
>PRK10996 thioredoxin 2; Provisional
Probab=50.30  E-value=13  Score=25.60  Aligned_cols=32  Identities=31%  Similarity=0.369  Sum_probs=26.9

Q ss_pred             eeeeeccchhhhhhcCCceEEEeeCCCChhHH
Q psy5544          47 VREITFENAEELTEEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        47 VREITFeNaEELtEEgLPfLILF~~pdD~~s~   78 (96)
                      |-++|-+|.+++..+|.|.+|.||.+......
T Consensus        37 ~i~~~~~~~~~~i~~~k~vvv~F~a~wC~~C~   68 (139)
T PRK10996         37 VINATGETLDKLLQDDLPVVIDFWAPWCGPCR   68 (139)
T ss_pred             CEEcCHHHHHHHHhCCCeEEEEEECCCCHHHH
Confidence            44678888888999999999999999877654


No 36 
>COG3538 Uncharacterized conserved protein [Function unknown]
Probab=47.80  E-value=29  Score=29.79  Aligned_cols=52  Identities=27%  Similarity=0.397  Sum_probs=41.0

Q ss_pred             HHHHhhhhccccceeeeeccchhhhhhcCCceEE-------------------EeeCCCChhHHHHHHHHHHHHh
Q psy5544          34 ETKVWTADKCVPLVREITFENAEELTEEGLPFLI-------------------LFYAPGDTETIKLFKSIVSEQL   89 (96)
Q Consensus        34 ~l~~W~~~kCvPLVREITFeNaEELtEEgLPfLI-------------------LF~~pdD~~s~k~F~~~V~~~L   89 (96)
                      .=.+|+.++|.|=.-+-|-.    .+|+|+||+|                   |.-.++|-+.-+.+.-.|++|.
T Consensus        25 ~ela~~Fe~c~~NTldTTi~----~~e~g~~FvlTGDIPAmWLRDStaQvrPYL~lAkeD~~l~~li~GlvkrQ~   95 (434)
T COG3538          25 PELARLFENCFTNTLDTTIR----TTEDGTPFVLTGDIPAMWLRDSTAQVRPYLPLAKEDEELRRLIAGLVKRQA   95 (434)
T ss_pred             HHHHHHHHHhcccchhheee----eccCCCeEEEecCchHHHHhcchhhhccceeecccCHHHHHHHHHHHHHHH
Confidence            34578999999976555554    3999999997                   6777888888888888888874


No 37 
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox. ThOX proteins are responsible for the generation of hydrogen peroxide, a crucial substrate of thyroperoxidase, which functions to iodinate thyroglobulin and synthesize thyroid hormones. EFP1 was isolated through a yeast two-hybrid method using the EF-hand fragment of dog Duox1 as a bait. It could be one of the partners in the assembly of a multiprotein complex constituting the thyroid hydrogen peroxide generating system. EFP1 contains two TRX domains related to the redox active TRX domains of protein disulfide isomerase (PDI). This subfamily is composed of the N-terminal TRX domain of EFP1, which contains a CXXS sequence in place of the typical CXXC motif, similar to ERp44. The CXXS motif allows the formation of stable mixed disulfides, crucial for the ER-retention function of ERp44.
Probab=46.26  E-value=14  Score=25.12  Aligned_cols=32  Identities=22%  Similarity=0.348  Sum_probs=22.6

Q ss_pred             eeeeeccchhh---hhhcCCceEEEeeCCCChhHH
Q psy5544          47 VREITFENAEE---LTEEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        47 VREITFeNaEE---LtEEgLPfLILF~~pdD~~s~   78 (96)
                      |-++|=+|-++   ...++.+.|+.||.|-.-.+-
T Consensus        11 v~~l~~~~f~~~~~v~~~~~~vlV~FyA~WC~~Ck   45 (113)
T cd03006          11 VLDFYKGQLDYAEELRTDAEVSLVMYYAPWDAQSQ   45 (113)
T ss_pred             eEEechhhhHHHHhcccCCCEEEEEEECCCCHHHH
Confidence            33555455444   468999999999999776553


No 38 
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD. It contains a CXXC motif in a TRX fold and shuttles the reducing potential from the membrane domain (DsbD beta) to the N-terminal periplasmic domain (DsbD alpha).  DsbD beta, a transmembrane domain comprising of eight helices, acquires its reducing potential from the cytoplasmic thioredoxin. DsbD alpha transfers the acquired reducing potential from DsbD gamma to target proteins such as the periplasmic protein disulphide isomerases, DsbC and DsbG. This flow of reducing potential from the cytoplasm through DsbD allows DsbC and DsbG to act as isomerases in the oxidizing environment of the bacterial periplasm. DsbD also transfers reducing potential from the cytoplasm to specific reductases in the periplasm which are involved in the maturation of cytochromes.
Probab=44.99  E-value=18  Score=22.94  Aligned_cols=27  Identities=15%  Similarity=0.018  Sum_probs=21.4

Q ss_pred             hhhhhhcCCceEEEeeCCCChhHHHHH
Q psy5544          55 AEELTEEGLPFLILFYAPGDTETIKLF   81 (96)
Q Consensus        55 aEELtEEgLPfLILF~~pdD~~s~k~F   81 (96)
                      .++...+|.|.||.|+.+.-....+.-
T Consensus         4 ~~~~~~~~k~vlv~f~a~wC~~C~~~~   30 (104)
T cd02953           4 LAQALAQGKPVFVDFTADWCVTCKVNE   30 (104)
T ss_pred             HHHHHHcCCeEEEEEEcchhHHHHHHH
Confidence            456678999999999999887776543


No 39 
>PLN02309 5'-adenylylsulfate reductase
Probab=44.59  E-value=17  Score=30.93  Aligned_cols=40  Identities=20%  Similarity=0.301  Sum_probs=29.8

Q ss_pred             cceeeeeccchhhhh---hcCCceEEEeeCCCChhH---HHHHHHH
Q psy5544          45 PLVREITFENAEELT---EEGLPFLILFYAPGDTET---IKLFKSI   84 (96)
Q Consensus        45 PLVREITFeNaEELt---EEgLPfLILF~~pdD~~s---~k~F~~~   84 (96)
                      +-|.++|.+|-+++.   ..|.|.||.||.|--...   ...|.++
T Consensus       345 ~~Vv~Lt~~nfe~ll~~~~~~k~vlV~FyApWC~~Cq~m~p~~e~L  390 (457)
T PLN02309        345 QNVVALSRAGIENLLKLENRKEPWLVVLYAPWCPFCQAMEASYEEL  390 (457)
T ss_pred             CCcEECCHHHHHHHHHhhcCCCeEEEEEECCCChHHHHHHHHHHHH
Confidence            357788899988886   589999999999976544   3355443


No 40 
>TIGR01068 thioredoxin thioredoxin. Several proteins, such as protein disulfide isomerase, have two or more copies of a domain closely related to thioredoxin. This model is designed to recognize authentic thioredoxin, a small protein that should be hit exactly once by this model.
Probab=43.52  E-value=46  Score=20.02  Aligned_cols=21  Identities=24%  Similarity=0.355  Sum_probs=15.9

Q ss_pred             hhhcCCceEEEeeCCCChhHH
Q psy5544          58 LTEEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        58 LtEEgLPfLILF~~pdD~~s~   78 (96)
                      +.+++.|.+|.||.+......
T Consensus        10 ~~~~~~~vvi~f~~~~C~~C~   30 (101)
T TIGR01068        10 IASSDKPVLVDFWAPWCGPCK   30 (101)
T ss_pred             HhhcCCcEEEEEECCCCHHHH
Confidence            445577999999999875443


No 41 
>PF03354 Terminase_1:  Phage Terminase ;  InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase). The characteristics of the protein distribution suggest prophage matches in addition to the phage matches.
Probab=42.65  E-value=49  Score=27.45  Aligned_cols=61  Identities=26%  Similarity=0.425  Sum_probs=44.1

Q ss_pred             ecCCCCHHHHHHhhhhcccc---ceeeeeccc------hhhhhhcCC--ceEEEeeC-CCChhHHHHHHHHHH
Q psy5544          26 RGNLSAYDETKVWTADKCVP---LVREITFEN------AEELTEEGL--PFLILFYA-PGDTETIKLFKSIVS   86 (96)
Q Consensus        26 ~G~~sn~~~l~~W~~~kCvP---LVREITFeN------aEELtEEgL--PfLILF~~-pdD~~s~k~F~~~V~   86 (96)
                      .|+..||+.+..|+.+-|-=   -|++|-|+.      +++|.++|.  |++-.--. ..=..++|.|.+.|.
T Consensus       347 ~g~~iD~~~v~~~i~~~~~~~~~~v~~i~yD~~~a~~~~~~l~~~g~~~~~~~v~Q~~~~ls~~~k~le~~~~  419 (477)
T PF03354_consen  347 PGNVIDYDEVEEWIIELIDKYGFDVQEIGYDPWNATQFVQRLEEEGFDYPMVEVRQGFKTLSPPTKELERLVL  419 (477)
T ss_pred             CCCcccHHHHHHHHHHHHHhcCcCccEEEEehhhhHHHHHHHHhccCcceEEEecccccccCchHHHHHHhhh
Confidence            49999999999999987764   799999986      578899998  44433333 233456666665554


No 42 
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains. Group I TRX is a small ancient protein that alter the redox state of target proteins via the reversible oxidation of an active site dithiol, present in a CXXC motif, partially exposed at the protein's surface. TRX reduces protein disulfide bonds, resulting in a disulfide bond at its active site. Oxidized TRX is converted to the active form by TRX reductase, using reducing equivalents derived from either NADPH or ferredoxins. By altering their redox state, TRX regulates the functions of at least 30 target proteins, some of which are enzymes and transcription factors. It also plays an important role in the defense against oxidative stress by directly reducing hydrogen peroxide and certain radicals, and by serving as a reductant for peroxiredoxins. At least two major types of functio
Probab=42.54  E-value=66  Score=18.39  Aligned_cols=30  Identities=23%  Similarity=0.375  Sum_probs=20.0

Q ss_pred             hhhhhcCCceEEEeeCCCChhHHHHHHHHHH
Q psy5544          56 EELTEEGLPFLILFYAPGDTETIKLFKSIVS   86 (96)
Q Consensus        56 EELtEEgLPfLILF~~pdD~~s~k~F~~~V~   86 (96)
                      +....++.|+|++|+.+...... .+...+.
T Consensus         4 ~~~~~~~~~~ll~~~~~~C~~C~-~~~~~~~   33 (93)
T cd02947           4 EELIKSAKPVVVDFWAPWCGPCK-AIAPVLE   33 (93)
T ss_pred             HHHHhcCCcEEEEEECCCChhHH-HhhHHHH
Confidence            34445558999999999877664 4434443


No 43 
>PF06676 DUF1178:  Protein of unknown function (DUF1178);  InterPro: IPR009562 This family consists of several hypothetical bacterial proteins of around 150 residues in length. The function of this family is unknown.
Probab=39.22  E-value=13  Score=27.44  Aligned_cols=25  Identities=48%  Similarity=0.620  Sum_probs=19.6

Q ss_pred             eeeccchhhhhhcCCceEEEeeCCC
Q psy5544          49 EITFENAEELTEEGLPFLILFYAPG   73 (96)
Q Consensus        49 EITFeNaEELtEEgLPfLILF~~pd   73 (96)
                      +-|-+-+++|.|||.|++-|=--|+
T Consensus       121 ~at~eE~~~L~eEGI~v~pLP~~~~  145 (148)
T PF06676_consen  121 EATPEEAKELIEEGIEVLPLPWPPD  145 (148)
T ss_pred             cCCHHHHHHHHHcCCeEeecCCCCc
Confidence            5578889999999999998843333


No 44 
>KOG0191|consensus
Probab=37.55  E-value=59  Score=25.97  Aligned_cols=63  Identities=25%  Similarity=0.411  Sum_probs=45.9

Q ss_pred             CeEEecCCCCCCCCcceeeecCCCCHHHHHHhhhhccccceeeeeccchhhhhhcCCc---------eEEEeeCCCCh
Q psy5544           7 PIIVFRPDVTTPLEEHETYRGNLSAYDETKVWTADKCVPLVREITFENAEELTEEGLP---------FLILFYAPGDT   75 (96)
Q Consensus         7 ~~i~Fr~~~~~~~~~~~~f~G~~sn~~~l~~W~~~kCvPLVREITFeNaEELtEEgLP---------fLILF~~pdD~   75 (96)
                      .+.+|+++ .    .-..|.| ..|.+.+..|...+--+.|+.....+..+|+.....         .|+-||.|-=.
T Consensus       104 tl~~f~~~-~----~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~v~~l~~~~~~~~~~~~~~~~lv~f~aPwc~  175 (383)
T KOG0191|consen  104 TLKVFRPG-K----KPIDYSG-PRNAESLAEFLIKELEPSVKKLVEGEVFELTKDNFDETVKDSDADWLVEFYAPWCG  175 (383)
T ss_pred             EEEEEcCC-C----ceeeccC-cccHHHHHHHHHHhhccccccccCCceEEccccchhhhhhccCcceEEEEeccccH
Confidence            36788887 2    2367888 689999999998887777777777755555555553         68889988554


No 45 
>PF13098 Thioredoxin_2:  Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A ....
Probab=36.97  E-value=28  Score=22.04  Aligned_cols=19  Identities=21%  Similarity=0.350  Sum_probs=13.3

Q ss_pred             hcCCceEEEeeCCCChhHH
Q psy5544          60 EEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        60 EEgLPfLILF~~pdD~~s~   78 (96)
                      .+|.|.+++|++|+=--=.
T Consensus         3 ~~~k~~v~~F~~~~C~~C~   21 (112)
T PF13098_consen    3 GNGKPIVVVFTDPWCPYCK   21 (112)
T ss_dssp             TTSSEEEEEEE-TT-HHHH
T ss_pred             CCCCEEEEEEECCCCHHHH
Confidence            5799999999998854433


No 46 
>PF02677 DUF208:  Uncharacterized BCR, COG1636;  InterPro: IPR003828 This entry describes proteins of unknown function.
Probab=35.67  E-value=32  Score=26.01  Aligned_cols=27  Identities=30%  Similarity=0.524  Sum_probs=20.6

Q ss_pred             hhhhhhcCCceEEEeeCCCChhHHHHHH
Q psy5544          55 AEELTEEGLPFLILFYAPGDTETIKLFK   82 (96)
Q Consensus        55 aEELtEEgLPfLILF~~pdD~~s~k~F~   82 (96)
                      .+.|.++|--..++||||+ ..+...|.
T Consensus        15 ~~~L~~~g~~vt~~fyNPN-IhP~~Ey~   41 (176)
T PF02677_consen   15 LERLREEGFDVTGYFYNPN-IHPYEEYE   41 (176)
T ss_pred             HHHHHHCCCCeEEEEeCCC-CCcHHHHH
Confidence            3689999999999999997 34444443


No 47 
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein. QSOX oxidizes thiol groups to disulfides like PDI, however, unlike PDI, this oxidation is accompanied by the reduction of oxygen to hydrogen peroxide. QSOX is localized in high concentrations in cells with heavy secretory load and prefers peptides and proteins as substrates, not monothiols like glutathione. Inside the cell, QSOX is found in the endoplasmic reticulum and Golgi. The flow of reducing equivalents in a QSOX-catalyzed reaction goes from the dithiol substrate - dithiol of the QSOX TRX domain - dithiols of the QSOX ERV1p domain - FAD - oxygen.
Probab=34.30  E-value=40  Score=22.34  Aligned_cols=30  Identities=17%  Similarity=0.084  Sum_probs=22.0

Q ss_pred             eeeeeccchhhhhhc-CCceEEEeeCCCChh
Q psy5544          47 VREITFENAEELTEE-GLPFLILFYAPGDTE   76 (96)
Q Consensus        47 VREITFeNaEELtEE-gLPfLILF~~pdD~~   76 (96)
                      |-+++-+|-++.+.+ +.|.+|.||.|-...
T Consensus         3 v~~l~~~~f~~~i~~~~~~vvV~f~a~wC~~   33 (114)
T cd02992           3 VIVLDAASFNSALLGSPSAWLVEFYASWCGH   33 (114)
T ss_pred             eEECCHHhHHHHHhcCCCeEEEEEECCCCHH
Confidence            456777777777555 469999999997653


No 48 
>cd03071 PDI_b'_NRX PDIb' family, NRX subgroup, redox inactive TRX-like domain b'; composed of vertebrate nucleoredoxins (NRX). NRX is a 400-amino acid nuclear protein with one redox active TRX domain followed by one redox inactive TRX-like domain homologous to the b' domain of PDI. In vitro studies show that NRX has thiol oxidoreductase activity and that it may be involved in the redox regulation of transcription, in a manner different from that of TRX or glutaredoxin. NRX enhances the activation of NF-kB by TNFalpha, as well as PMA-1 induced AP-1 and FK-induced CREB activation. Mouse NRX transcripts are expressed in all adult tissues but is restricted to the nervous system and limb buds in embryos. The mouse NRX gene is implicated in streptozotocin-induced diabetes. Similar to PDI, the b' domain of NRX is likely involved in substrate recognition.
Probab=34.17  E-value=54  Score=23.68  Aligned_cols=35  Identities=31%  Similarity=0.472  Sum_probs=23.7

Q ss_pred             eeeccchhhhhhcCCceEEEeeCCCChhHHHHHHHHH
Q psy5544          49 EITFENAEELTEEGLPFLILFYAPGDTETIKLFKSIV   85 (96)
Q Consensus        49 EITFeNaEELtEEgLPfLILF~~pdD~~s~k~F~~~V   85 (96)
                      ++|=.||-.|.++  |+||||-+.+|...++.=++.+
T Consensus         3 ~Lse~~a~~Ln~~--p~lvlf~D~Edeg~l~~A~~ll   37 (116)
T cd03071           3 ELSESNAVQLNEG--PCLVLFVDSEDEGESEAAKQLI   37 (116)
T ss_pred             cccHHHHHhhcCC--ceEEEEecccchhhHHHHHHHH
Confidence            3444566666665  8999999999986555444433


No 49 
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI. They exhibit both disulfide oxidase and reductase functions, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides and acting as isomerases to correct any non-native disulfide bonds. They also display chaperone activity to prevent protein aggregation and facilitate the folding of newly synthesized proteins. ERp57 contains two redox-active TRX (a) domains and two redox inactive TRX-like (b) domains.  It shares the same domain arrangement of abb'a' as PDI, but lacks the C-terminal acid-rich region (c domain) that is present in PDI. ERp72 contains one additional redox-active TRX (a) domain at the N-terminus with a molecular structure of a"abb'a'. ERp57 interacts with the lectin chaperones, calnexin and calreticulin, and specifically promotes the oxidative folding of glycoprotei
Probab=33.18  E-value=1e+02  Score=20.79  Aligned_cols=23  Identities=26%  Similarity=0.499  Sum_probs=16.9

Q ss_pred             eeeeeccchhhhhhcCCceEEEeeC
Q psy5544          47 VREITFENAEELTEEGLPFLILFYA   71 (96)
Q Consensus        47 VREITFeNaEELtEEgLPfLILF~~   71 (96)
                      |-|+|=+|+.-.+  ..|++++|++
T Consensus         1 v~~~~~en~~~~~--~~~l~~~~~~   23 (111)
T cd03073           1 VGHRTKDNRAQFT--KKPLVVAYYN   23 (111)
T ss_pred             CCeeccchHHHhc--cCCeEEEEEe
Confidence            4478889999997  5566777763


No 50 
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif. The gene name for the human protein is TxnDC9. The two characterized members are described as Phd-like proteins, PLP1 of Saccharomyces cerevisiae and PhLP3 of Dictyostelium discoideum. Gene disruption experiments show that both PLP1 and PhLP3 are non-essential proteins. Unlike Phd and most Phd-like proteins, members of this group do not contain the Phd N-terminal helical domain which is implicated in binding to the G protein betagamma subunit.
Probab=32.81  E-value=1.3e+02  Score=19.86  Aligned_cols=32  Identities=19%  Similarity=0.195  Sum_probs=21.9

Q ss_pred             eeeeec-cchhhhhhcCCceEEEeeCCCChhHH
Q psy5544          47 VREITF-ENAEELTEEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        47 VREITF-eNaEELtEEgLPfLILF~~pdD~~s~   78 (96)
                      |.+|+= ++.++...++-|.++.||.|..-...
T Consensus         6 v~~i~~~~~~~~~i~~~~~vvV~f~a~~c~~C~   38 (113)
T cd02989           6 YREVSDEKEFFEIVKSSERVVCHFYHPEFFRCK   38 (113)
T ss_pred             eEEeCCHHHHHHHHhCCCcEEEEEECCCCccHH
Confidence            344444 45556666677999999998876543


No 51 
>COG2411 Uncharacterized conserved protein [Function unknown]
Probab=31.28  E-value=14  Score=28.56  Aligned_cols=23  Identities=39%  Similarity=0.433  Sum_probs=17.0

Q ss_pred             hhhccccceeeee--------ccchhhhhhc
Q psy5544          39 TADKCVPLVREIT--------FENAEELTEE   61 (96)
Q Consensus        39 ~~~kCvPLVREIT--------FeNaEELtEE   61 (96)
                      |++--+-=|+|+|        |.|+|||.++
T Consensus        55 Ik~V~~KrV~ELTdEDAr~DGF~sreELi~~   85 (188)
T COG2411          55 IKKVKTKRVSELTDEDARLDGFRSREELIEE   85 (188)
T ss_pred             EEEEEEeeHhhhhHHHHHhcccccHHHHHHH
Confidence            3444445688888        8999999986


No 52 
>PF12045 DUF3528:  Protein of unknown function (DUF3528);  InterPro: IPR021918  This domain of unknown function is found at the N terminus of some Homeobox proteins belonging to the ABD-B family. It is found in association with PF00046 from PFAM. 
Probab=31.08  E-value=20  Score=26.70  Aligned_cols=10  Identities=50%  Similarity=0.790  Sum_probs=8.9

Q ss_pred             ccceeeeecc
Q psy5544          44 VPLVREITFE   53 (96)
Q Consensus        44 vPLVREITFe   53 (96)
                      |+-|||++|-
T Consensus        29 VqpVREVaFR   38 (143)
T PF12045_consen   29 VQPVREVAFR   38 (143)
T ss_pred             cCccceecch
Confidence            7899999994


No 53 
>PRK09381 trxA thioredoxin; Provisional
Probab=30.62  E-value=56  Score=20.68  Aligned_cols=32  Identities=13%  Similarity=0.127  Sum_probs=21.4

Q ss_pred             eeeeeccchh-hhhhcCCceEEEeeCCCChhHH
Q psy5544          47 VREITFENAE-ELTEEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        47 VREITFeNaE-ELtEEgLPfLILF~~pdD~~s~   78 (96)
                      |.+|+=++-+ ++++.+-|.+|.|+.|......
T Consensus         5 v~~~~~~~~~~~v~~~~~~vvv~f~~~~C~~C~   37 (109)
T PRK09381          5 IIHLTDDSFDTDVLKADGAILVDFWAEWCGPCK   37 (109)
T ss_pred             ceeeChhhHHHHHhcCCCeEEEEEECCCCHHHH
Confidence            4455544544 3566688999999999765443


No 54 
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent. This enzyme, involved in the assimilation of inorganic sulfate, is closely related to the thioredoxin-dependent PAPS reductase of Bacteria (CysH) and Saccharomyces cerevisiae. However, it has its own C-terminal thioredoxin-like domain and is not thioredoxin-dependent. Also, it has a substrate preference for 5'-adenylylsulfate (APS) over 3'-phosphoadenylylsulfate (PAPS) so the pathway does not require an APS kinase (CysC) to convert APS to PAPS. Arabidopsis thaliana appears to have three isozymes, all able to complement E. coli CysH mutants (even in backgrounds lacking thioredoxin or APS kinase) but likely localized to different compartments in Arabidopsis.
Probab=30.58  E-value=43  Score=28.64  Aligned_cols=32  Identities=22%  Similarity=0.260  Sum_probs=28.0

Q ss_pred             ceeeeeccchhhhhh---cCCceEEEeeCCCChhH
Q psy5544          46 LVREITFENAEELTE---EGLPFLILFYAPGDTET   77 (96)
Q Consensus        46 LVREITFeNaEELtE---EgLPfLILF~~pdD~~s   77 (96)
                      -|-++|-+|.+.+..   .+.|.||.||.|--...
T Consensus       352 ~Vv~L~~~nf~~~v~~~~~~k~VLV~FyApWC~~C  386 (463)
T TIGR00424       352 NVVSLSRPGIENLLKLEERKEAWLVVLYAPWCPFC  386 (463)
T ss_pred             CeEECCHHHHHHHHhhhcCCCeEEEEEECCCChHH
Confidence            688999999999886   89999999999987554


No 55 
>cd06232 Peptidase_M14-like_5 Peptidase M14-like domain of a functionally uncharacterized subgroup of the M14 family of metallocarboxypeptidases (MCPs). The M14 family are zinc-binding carboxypeptidases (CPs) which hydrolyze single, C-terminal amino acids from polypeptide chains, and have a recognition site for the free C-terminal carboxyl group, which is a key determinant of specificity. Two major subfamilies of the M14 family, defined based on sequence and structural homology, are the A/B and N/E subfamilies. Enzymes belonging to the A/B subfamily are normally synthesized as inactive precursors containing preceding signal peptide, followed by an N-terminal pro-region linked to the enzyme; these proenzymes are called procarboxypeptidases. The A/B enzymes can be further divided based on their substrate specificity; Carboxypeptidase A-like (CPA-like) enzymes favor hydrophobic residues while carboxypeptidase B-like (CPB-like) enzymes only cleave the basic residues lysine or arginine. The 
Probab=30.34  E-value=67  Score=25.63  Aligned_cols=26  Identities=31%  Similarity=0.385  Sum_probs=23.3

Q ss_pred             eEEEeeCCCChhHHHHHHHHHHHHhc
Q psy5544          65 FLILFYAPGDTETIKLFKSIVSEQLL   90 (96)
Q Consensus        65 fLILF~~pdD~~s~k~F~~~V~~~L~   90 (96)
                      ||+|.|++|.......|.+.|...+.
T Consensus       170 ~lvl~~~~d~~~p~~~~q~av~~~v~  195 (240)
T cd06232         170 FLILRHHAGWDEQARRLLELVTARLA  195 (240)
T ss_pred             EEEEecCCCCcChHHHHHHHHHHHHH
Confidence            89999999999999999999877664


No 56 
>PF01216 Calsequestrin:  Calsequestrin;  InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle []. It is a highly acidic protein that is able to bind over 40 calcium ions and acts as an internal calcium store in muscle. Sequence analysis has suggested that calcium is not bound in distinct pockets via EF-hand motifs, but rather via presentation of a charged protein surface. Two forms of calsequestrin have been identified. The cardiac form is present in cardiac and slow skeletal muscle and the fast skeletal form is found in fast skeletal muscle. The release of calsequestrin-bound calcium (through a a calcium release channel) triggers muscle contraction. The active protein is not highly structured, more than 50% of it adopting a random coil conformation []. When calcium binds there is a structural change whereby the alpha-helical content of the protein increases from 3 to 11% []. Both forms of calsequestrin are phosphorylated by casein kinase II, but the cardiac form is phosphorylated more rapidly and to a higher degree [].; GO: 0005509 calcium ion binding; PDB: 1SJI_B 2VAF_A 3UOM_C 1A8Y_A 3TRQ_A 3TRP_A 3US3_A.
Probab=30.06  E-value=1.7e+02  Score=25.00  Aligned_cols=69  Identities=26%  Similarity=0.289  Sum_probs=47.8

Q ss_pred             CCeEEecCCCCCCCCcceeeecCCCCHHHHHHhhhhccccceeeee-------ccchhhhhhcCCceEEEeeCCCChhHH
Q psy5544           6 EPIIVFRPDVTTPLEEHETYRGNLSAYDETKVWTADKCVPLVREIT-------FENAEELTEEGLPFLILFYAPGDTETI   78 (96)
Q Consensus         6 ~~~i~Fr~~~~~~~~~~~~f~G~~sn~~~l~~W~~~kCvPLVREIT-------FeNaEELtEEgLPfLILF~~pdD~~s~   78 (96)
                      .+|-||+.+.      -..|.|-+ +-+-|-.|+.+--=.-|-.|+       |+|+|+     -+=||-|-++++-+.-
T Consensus       114 ~SiyVfkd~~------~IEydG~~-saDtLVeFl~dl~edPVeiIn~~~e~~~Fe~ied-----~~klIGyFk~~~s~~y  181 (383)
T PF01216_consen  114 GSIYVFKDGE------VIEYDGER-SADTLVEFLLDLLEDPVEIINNKHELKAFERIED-----DIKLIGYFKSEDSEHY  181 (383)
T ss_dssp             TEEEEEETTE------EEEE-S---SHHHHHHHHHHHHSSSEEEE-SHHHHHHHHH--S-----S-EEEEE-SSTTSHHH
T ss_pred             CcEEEEECCc------EEEecCcc-CHHHHHHHHHHhcccchhhhcChhhhhhhhhccc-----ceeEEEEeCCCCcHHH
Confidence            3466777742      37799987 568999999998888887776       555554     3789999999999999


Q ss_pred             HHHHHHHH
Q psy5544          79 KLFKSIVS   86 (96)
Q Consensus        79 k~F~~~V~   86 (96)
                      |.|.++.+
T Consensus       182 k~FeeAAe  189 (383)
T PF01216_consen  182 KEFEEAAE  189 (383)
T ss_dssp             HHHHHHHH
T ss_pred             HHHHHHHH
Confidence            99987654


No 57 
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein. Dyneins are molecular motors that generate force against microtubules to produce cellular movement, and are divided into two classes: axonemal and cytoplasmic. They are supramolecular complexes consisting of three protein groups classified according to size: dynein heavy, intermediate and light chains. Axonemal dyneins form two structures, the inner and outer arms, which are attached to doublet microtubules throughout the cilia and flagella. The human homolog is the sperm-specific Sptrx-2, presumed to be a  component of the human sperm axoneme architecture. Included in this group is another human protein, TRX-like protein 2, a smaller fusion protein containing one TRX and one NDPK domain, which 
Probab=30.03  E-value=38  Score=21.69  Aligned_cols=27  Identities=19%  Similarity=-0.047  Sum_probs=20.5

Q ss_pred             ccchhhhhhcCCceEEEeeCCCChhHH
Q psy5544          52 FENAEELTEEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        52 FeNaEELtEEgLPfLILF~~pdD~~s~   78 (96)
                      -++-+.+...|.|.+|.||.+--...-
T Consensus         7 ~~~~~~~i~~~~~vvv~F~a~wC~~Ck   33 (102)
T cd02948           7 QEEWEELLSNKGLTVVDVYQEWCGPCK   33 (102)
T ss_pred             HHHHHHHHccCCeEEEEEECCcCHhHH
Confidence            344556777899999999999876554


No 58 
>PF13899 Thioredoxin_7:  Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A ....
Probab=29.70  E-value=45  Score=20.52  Aligned_cols=22  Identities=32%  Similarity=0.292  Sum_probs=16.3

Q ss_pred             hhhhhcCCceEEEeeCCCChhH
Q psy5544          56 EELTEEGLPFLILFYAPGDTET   77 (96)
Q Consensus        56 EELtEEgLPfLILF~~pdD~~s   77 (96)
                      ++-.++|.|.||.|+...=...
T Consensus        11 ~~A~~~~kpvlv~f~a~wC~~C   32 (82)
T PF13899_consen   11 AEAKKEGKPVLVDFGADWCPPC   32 (82)
T ss_dssp             HHHHHHTSEEEEEEETTTTHHH
T ss_pred             HHHHHcCCCEEEEEECCCCHhH
Confidence            3567899999999986654433


No 59 
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains. The TRX domain functions as a protein disulfide reductase via the reversible oxidation of an active center dithiol present in a CXXC motif, while the NTR domain functions as a reductant to oxidized TRX. The fusion protein is  bifunctional, showing both TRX and NTR activities, but it is not an independent NTR/TRX system. In plants, the protein is found exclusively in shoots and mature leaves and is localized in the chloroplast. It is involved in plant protection against oxidative stress.
Probab=28.08  E-value=56  Score=20.50  Aligned_cols=24  Identities=17%  Similarity=0.170  Sum_probs=19.6

Q ss_pred             hhhhhhcCCceEEEeeCCCChhHH
Q psy5544          55 AEELTEEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        55 aEELtEEgLPfLILF~~pdD~~s~   78 (96)
                      ..+|.+.+.|.+++|+.+.-....
T Consensus         6 ~~~~~~~~~~vlv~f~a~~C~~C~   29 (97)
T cd02949           6 RKLYHESDRLILVLYTSPTCGPCR   29 (97)
T ss_pred             HHHHHhCCCeEEEEEECCCChhHH
Confidence            357889999999999998876543


No 60 
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain. Its gene has been sequenced from several gammaproteobacteria and actinobacteria.
Probab=27.49  E-value=58  Score=19.98  Aligned_cols=22  Identities=27%  Similarity=0.529  Sum_probs=16.6

Q ss_pred             hhhhc-CCceEEEeeCCCChhHH
Q psy5544          57 ELTEE-GLPFLILFYAPGDTETI   78 (96)
Q Consensus        57 ELtEE-gLPfLILF~~pdD~~s~   78 (96)
                      ++.+. |.|.||.||.|.-....
T Consensus         6 ~i~~~~~~~vlv~f~a~wC~~C~   28 (96)
T cd02956           6 VLQESTQVPVVVDFWAPRSPPSK   28 (96)
T ss_pred             HHHhcCCCeEEEEEECCCChHHH
Confidence            45455 88999999999866554


No 61 
>cd04395 RhoGAP_ARHGAP21 RhoGAP_ARHGAP21: RhoGAP (GTPase-activator protein [GAP] for Rho-like small GTPases) domain of ArhGAP21-like proteins. ArhGAP21 is a multi-domain protein, containing RhoGAP, PH and PDZ domains, and is believed to play a role in the organization of the cell-cell junction complex. It has been shown to function as a GAP of Cdc42 and RhoA, and to interact with alpha-catenin and Arf6. Small GTPases cluster into distinct families, and all act as molecular switches, active in their GTP-bound form but inactive when GDP-bound. The Rho family of GTPases activates effectors involved in a wide variety of developmental processes, including regulation of cytoskeleton formation, cell proliferation and the JNK signaling pathway. GTPases generally have a low intrinsic GTPase hydrolytic activity but there are family-specific groups of GAPs that enhance the rate of GTP hydrolysis by several orders of magnitude.
Probab=27.22  E-value=31  Score=25.16  Aligned_cols=44  Identities=23%  Similarity=0.437  Sum_probs=30.5

Q ss_pred             ccccceeeeeccchhhhhhcCCceEEEeeCCCChhHHHHHHHHHHHH
Q psy5544          42 KCVPLVREITFENAEELTEEGLPFLILFYAPGDTETIKLFKSIVSEQ   88 (96)
Q Consensus        42 kCvPLVREITFeNaEELtEEgLPfLILF~~pdD~~s~k~F~~~V~~~   88 (96)
                      +.||.+-+..++--|   +.|+-.-=+||.|++...+++.++.+.+.
T Consensus        16 ~~vP~iv~~~~~~l~---~~g~~~eGIFR~~g~~~~i~~l~~~l~~~   59 (196)
T cd04395          16 PYVPLIVEVCCNIVE---ARGLETVGIYRVPGNNAAISALQEELNRG   59 (196)
T ss_pred             CCCChHHHHHHHHHH---HcCCCCccceeCCCcHHHHHHHHHHHhcC
Confidence            678887666555333   33333344799999999999998887753


No 62 
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein. This family of archaeal proteins contains a C-terminal domain with homology to bacterial and eukaryotic glutaredoxins, including a CPYC motif. There is an N-terminal domain which has even more distant homology to glutaredoxins. The name "glutaredoxin" may be inappropriate in the sense of working in tandem with glutathione and glutathione reductase which may not be present in the archaea. The overall domain structure appears to be related to bacterial alkylhydroperoxide reductases, but the homology may be distant enough that the function of this family is wholly different.
Probab=27.13  E-value=1.4e+02  Score=21.87  Aligned_cols=63  Identities=19%  Similarity=0.097  Sum_probs=38.4

Q ss_pred             eEEecCCCCCCCCcceeeecCCCCHHHHHHhhhhcc--ccceeeeeccchhhhhhcCCceEEE-eeCCCCh
Q psy5544           8 IIVFRPDVTTPLEEHETYRGNLSAYDETKVWTADKC--VPLVREITFENAEELTEEGLPFLIL-FYAPGDT   75 (96)
Q Consensus         8 ~i~Fr~~~~~~~~~~~~f~G~~sn~~~l~~W~~~kC--vPLVREITFeNaEELtEEgLPfLIL-F~~pdD~   75 (96)
                      +++|+... .   ....|.|-. +-+++..|+...=  -+-..++.=++.+.|.+..-|..|+ |+.|.-.
T Consensus        81 ~~~f~~g~-~---~~~~~~G~~-~~~~l~~~i~~~~~~~~~~~~L~~~~~~~l~~~~~pv~I~~F~a~~C~  146 (215)
T TIGR02187        81 TIILEEGK-D---GGIRYTGIP-AGYEFAALIEDIVRVSQGEPGLSEKTVELLQSLDEPVRIEVFVTPTCP  146 (215)
T ss_pred             EEEEeCCe-e---eEEEEeecC-CHHHHHHHHHHHHHhcCCCCCCCHHHHHHHHhcCCCcEEEEEECCCCC
Confidence            46666532 1   124688854 4478888987661  1122345555567777767787666 8887554


No 63 
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative. This model describes a small family of proteins believed to aid in the export of various class II bacteriocins, which are ribosomally-synthesized, non-lantibiotic bacterial peptide antibiotics. Members of this family are found in operons for pediocin PA-1 from Pediococcus acidilactici and brochocin-C from Brochothrix campestris.
Probab=26.73  E-value=54  Score=22.32  Aligned_cols=40  Identities=10%  Similarity=-0.022  Sum_probs=29.5

Q ss_pred             eeeeeccchhhhhhcCCceEEEeeCCCC---hhHHHHHHHHHH
Q psy5544          47 VREITFENAEELTEEGLPFLILFYAPGD---TETIKLFKSIVS   86 (96)
Q Consensus        47 VREITFeNaEELtEEgLPfLILF~~pdD---~~s~k~F~~~V~   86 (96)
                      .-+||-+...++...|-++++.|+.|.=   ..-...+.+++.
T Consensus         8 ~~~it~~~~~~~i~~~~~~iv~f~~~~Cp~C~~~~P~l~~~~~   50 (122)
T TIGR01295         8 LEVTTVVRALEALDKKETATFFIGRKTCPYCRKFSGTLSGVVA   50 (122)
T ss_pred             ceecCHHHHHHHHHcCCcEEEEEECCCChhHHHHhHHHHHHHH
Confidence            3578999999999999999999998643   444445554444


No 64 
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX. TMX is a type I integral membrane protein; the N-terminal redox active TRX domain is present in the endoplasmic reticulum (ER) lumen while the C-terminus is oriented towards the cytoplasm. It is expressed in many cell types and its active site motif (CPAC) is unique. In vitro, TMX reduces interchain disulfides of insulin and renatures inactive RNase containing incorrect disulfide bonds. The C. elegans homolog, DPY-11, is expressed only in the hypodermis and resides in the cytoplasm. It is required for body and sensory organ morphogeneis. Another uncharacterized TRX-related transmembrane protein, human TMX4, is included in the alignment. The active site sequence of TMX4 is CPSC.
Probab=26.67  E-value=70  Score=19.89  Aligned_cols=29  Identities=38%  Similarity=0.415  Sum_probs=21.1

Q ss_pred             eeeeeccchhhhhhcCCceEEEeeCCCChhH
Q psy5544          47 VREITFENAEELTEEGLPFLILFYAPGDTET   77 (96)
Q Consensus        47 VREITFeNaEELtEEgLPfLILF~~pdD~~s   77 (96)
                      |-+||=+|-+++.+ |. .||.||.|--...
T Consensus         3 v~~l~~~~f~~~~~-~~-~lv~f~a~wC~~C   31 (101)
T cd02994           3 VVELTDSNWTLVLE-GE-WMIEFYAPWCPAC   31 (101)
T ss_pred             eEEcChhhHHHHhC-CC-EEEEEECCCCHHH
Confidence            56777777788875 54 6799999876544


No 65 
>cd02958 UAS UAS family; UAS is a domain of unknown function. Most members of this family are uncharacterized proteins with similarity to FAS-associated factor 1 (FAF1) and ETEA because of the presence of a UAS domain N-terminal to a ubiquitin-associated UBX domain. FAF1 is a longer protein, compared to the other members of this family, having additional N-terminal domains, a ubiquitin-associated UBA domain and a nuclear targeting domain. FAF1 is an apoptotic signaling molecule that acts downstream in the Fas signal transduction pathway. It interacts with the cytoplasmic domain of Fas, but not to a Fas mutant that is deficient in signal transduction. ETEA is the protein product of a highly expressed gene in T-cells and eosinophils of atopic dermatitis patients. The presence of the ubiquitin-associated UBX domain in the proteins of this family suggests the possibility of their involvement in ubiquitination. Recently, FAF1 has been shown to interact with valosin-containing protein (VCP), 
Probab=26.25  E-value=1.1e+02  Score=19.84  Aligned_cols=21  Identities=14%  Similarity=0.207  Sum_probs=16.4

Q ss_pred             hhhhcCCceEEEeeCCCChhH
Q psy5544          57 ELTEEGLPFLILFYAPGDTET   77 (96)
Q Consensus        57 ELtEEgLPfLILF~~pdD~~s   77 (96)
                      +-..++.|+||.||.++...+
T Consensus        12 ~Ak~~~K~llv~~~~~~c~~c   32 (114)
T cd02958          12 EAKSEKKWLLVYLQSEDEFDS   32 (114)
T ss_pred             HHHhhCceEEEEEecCCcchH
Confidence            345679999999999888544


No 66 
>smart00021 DAX Domain present in Dishevelled and axin. Domain of unknown function.
Probab=26.03  E-value=46  Score=22.53  Aligned_cols=30  Identities=23%  Similarity=0.527  Sum_probs=26.7

Q ss_pred             hhcCCceEEEeeCCCChhHHHHHHHHHHHH
Q psy5544          59 TEEGLPFLILFYAPGDTETIKLFKSIVSEQ   88 (96)
Q Consensus        59 tEEgLPfLILF~~pdD~~s~k~F~~~V~~~   88 (96)
                      -.|-.|.++.-+.|.+.-.+.+||+.+.+.
T Consensus        11 d~e~~PY~~~i~~~~~~iTLgdFK~~l~k~   40 (83)
T smart00021       11 DDEETPYLVKVPVPAERVTLGDFKEVLTKK   40 (83)
T ss_pred             CCCCCceeEecCCCcCceEHHHHHHhhccC
Confidence            467889999999999999999999988764


No 67 
>PF09494 Slx4:  Slx4 endonuclease;  InterPro: IPR018574  The Slx4 protein is a heteromeric structure-specific endonuclease found in fungi. Slx4 with Slx1 acts as a nuclease on branched DNA substrates, particularly simple-Y, 5'-flap, or replication fork structures by cleaving the strand bearing the 5' non-homologous arm at the branch junction and thus generating ligatable nicked products from 5'-flap or replication fork substrates []. 
Probab=25.57  E-value=58  Score=20.12  Aligned_cols=14  Identities=14%  Similarity=0.335  Sum_probs=7.3

Q ss_pred             CHHHHHHhhhhccc
Q psy5544          31 AYDETKVWTADKCV   44 (96)
Q Consensus        31 n~~~l~~W~~~kCv   44 (96)
                      +-..|.+|...+||
T Consensus        46 ~~~~l~~~lD~~gI   59 (64)
T PF09494_consen   46 DPSKLKEWLDSQGI   59 (64)
T ss_pred             CHHHHHHHHHHCCc
Confidence            44555555555554


No 68 
>KOG0086|consensus
Probab=25.36  E-value=35  Score=26.53  Aligned_cols=36  Identities=28%  Similarity=0.504  Sum_probs=27.7

Q ss_pred             CCCCHHHHHHhhhhc--------cccce---------eeeeccchhhhhhcCC
Q psy5544          28 NLSAYDETKVWTADK--------CVPLV---------REITFENAEELTEEGL   63 (96)
Q Consensus        28 ~~sn~~~l~~W~~~k--------CvPLV---------REITFeNaEELtEEgL   63 (96)
                      +-.+|++|.+|+.|-        ||-|+         ||+||.-|-+...|.-
T Consensus        93 srdsfnaLtnWL~DaR~lAs~nIvviL~GnKkDL~~~R~VtflEAs~FaqEne  145 (214)
T KOG0086|consen   93 SRDSFNALTNWLTDARTLASPNIVVILCGNKKDLDPEREVTFLEASRFAQENE  145 (214)
T ss_pred             chhhHHHHHHHHHHHHhhCCCcEEEEEeCChhhcChhhhhhHHHHHhhhcccc
Confidence            345699999999874        55554         8999999988877764


No 69 
>PRK10377 PTS system glucitol/sorbitol-specific transporter subunit IIA; Provisional
Probab=25.16  E-value=45  Score=23.63  Aligned_cols=21  Identities=29%  Similarity=0.506  Sum_probs=14.8

Q ss_pred             cchhhhhhcCCceEEEeeC--CCCh
Q psy5544          53 ENAEELTEEGLPFLILFYA--PGDT   75 (96)
Q Consensus        53 eNaEELtEEgLPfLILF~~--pdD~   75 (96)
                      ++|++.-++  ++||||..  |+|+
T Consensus        14 ~~a~~f~~e--~mlIlF~e~Ap~~L   36 (120)
T PRK10377         14 ASATDALSD--QMLITFREGAPADI   36 (120)
T ss_pred             hhHHhhccC--CEEEEeCCCCChHH
Confidence            457776666  69999987  4444


No 70 
>PF02844 GARS_N:  Phosphoribosylglycinamide synthetase, N domain;  InterPro: IPR020562 Phosphoribosylglycinamide synthetase (6.3.4.13 from EC) (GARS) (phosphoribosylamine glycine ligase) [] catalyses the second step in the de novo biosynthesis of purine. The reaction catalysed by phosphoribosylglycinamide synthetase is the ATP-dependent addition of 5-phosphoribosylamine to glycine to form 5'phosphoribosylglycinamide:  ATP + 5-phosphoribosylamine + glycine = ADP + Pi + 5'-phosphoribosylglycinamide  In bacteria, GARS is a monofunctional enzyme (encoded by the purD gene). In yeast, GARS is part of a bifunctional enzyme (encoded by the ADE5/7 gene) in conjunction with phosphoribosylformylglycinamidine cyclo-ligase (AIRS) (IPR000728 from INTERPRO). In higher eukaryotes, GARS is part of a trifunctional enzyme in conjunction with AIRS (IPR000728 from INTERPRO) and with phosphoribosylglycinamide formyltransferase (GART) (), forming GARS-AIRS-GART. This entry represents the N-domain, which is related to the N-terminal domain of biotin carboxylase/carbamoyl phosphate synthetase (IPR005481 from INTERPRO).; GO: 0004637 phosphoribosylamine-glycine ligase activity, 0009113 purine base biosynthetic process; PDB: 3MJF_A 2XD4_A 2XCL_A 2IP4_A 2YW2_B 2YYA_A 3LP8_A 1VKZ_A 2YS6_A 2YRX_A ....
Probab=24.63  E-value=1e+02  Score=21.17  Aligned_cols=25  Identities=12%  Similarity=0.193  Sum_probs=19.1

Q ss_pred             eeeecCCCCHHHHHHhhhhccccce
Q psy5544          23 ETYRGNLSAYDETKVWTADKCVPLV   47 (96)
Q Consensus        23 ~~f~G~~sn~~~l~~W~~~kCvPLV   47 (96)
                      ..+.-+.+|++.+..|++++-+-||
T Consensus        42 ~~~~~~~~d~~~l~~~a~~~~idlv   66 (100)
T PF02844_consen   42 KNVPIDITDPEELADFAKENKIDLV   66 (100)
T ss_dssp             EEE-S-TT-HHHHHHHHHHTTESEE
T ss_pred             eecCCCCCCHHHHHHHHHHcCCCEE
Confidence            4456699999999999999998877


No 71 
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover. The PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=24.16  E-value=90  Score=21.04  Aligned_cols=21  Identities=19%  Similarity=0.151  Sum_probs=17.2

Q ss_pred             cCCCCHHHHHHhhhhcccccee
Q psy5544          27 GNLSAYDETKVWTADKCVPLVR   48 (96)
Q Consensus        27 G~~sn~~~l~~W~~~kCvPLVR   48 (96)
                      +..++|+.|.+=+++.| |..+
T Consensus        24 ~~~~s~~~L~~~V~~~f-~~l~   44 (87)
T cd06402          24 DVSTSYEYLVEKVAAVF-PSLR   44 (87)
T ss_pred             CCCcCHHHHHHHHHHHc-cccC
Confidence            44478999999999999 6665


No 72 
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO. They are proteins serving a critical role in the assembly of multimeric [NiFe] hydrogenases, the enzymes that catalyze the oxidation of molecular hydrogen to enable microorganisms to utilize hydrogen as the sole energy source. The E. coli HyaE protein is a chaperone that specifically interacts with the twin-arginine translocation (Tat) signal peptide of the [NiFe] hydrogenase-1 beta subunit precursor. Tat signal peptides target precursor proteins to the Tat protein export system, which facilitates the transport of fully folded proteins across the inner membrane. HyaE may be involved in regulating the traffic of [NiFe] hydrogenase-1 on the Tat transport pathway.
Probab=24.15  E-value=99  Score=21.46  Aligned_cols=25  Identities=8%  Similarity=0.189  Sum_probs=20.1

Q ss_pred             eeeccchhhhhhcCCceEEEeeCCC
Q psy5544          49 EITFENAEELTEEGLPFLILFYAPG   73 (96)
Q Consensus        49 EITFeNaEELtEEgLPfLILF~~pd   73 (96)
                      ++|=.|-+|.++.|-+.+++||..-
T Consensus        14 ~~~~~~~~~~~~~~~~~v~~f~~~~   38 (111)
T cd02965          14 RVDAATLDDWLAAGGDLVLLLAGDP   38 (111)
T ss_pred             ccccccHHHHHhCCCCEEEEecCCc
Confidence            4556666688899999999999874


No 73 
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle. It stores calcium ions in sufficient quantities (up to 20 mM) to allow repetitive contractions and is essential to maintain movement, respiration and heart beat. A missense mutation in human cardiac calsequestrin is associated with catecholamine-induced polymorphic ventricular tachycardia (CPVT), a rare disease characterized by seizures or sudden death in response to physiologic or emotional stress. Calsequestrin is a highly acidic protein with up to 50 calcium binding sites formed simply by the clustering of two or more acidic residues. The monomer contains three redox inactive TRX-fold domains. Calsequestrin is condensed as a linear polymer in the SR lumen and is membrane-anchored through binding with intra-membrane proteins triadin, junctin and ryanodine receptor (RyR) Ca
Probab=24.09  E-value=1.8e+02  Score=18.74  Aligned_cols=40  Identities=23%  Similarity=0.275  Sum_probs=24.9

Q ss_pred             eeee-eccchhhhhh-cCCceEEEeeCCCChhHHHHHHHHHH
Q psy5544          47 VREI-TFENAEELTE-EGLPFLILFYAPGDTETIKLFKSIVS   86 (96)
Q Consensus        47 VREI-TFeNaEELtE-EgLPfLILF~~pdD~~s~k~F~~~V~   86 (96)
                      |++| |=+.+|.+.+ +.-..+|-|-...+-...+.|.++..
T Consensus         2 v~~i~~~~~~e~~~~~~~~~~Vvg~f~~~~~~~~~~F~~vA~   43 (102)
T cd03066           2 VEIINSERELQAFENIEDDIKLIGYFKSEDSEHYKAFEEAAE   43 (102)
T ss_pred             ceEcCCHHHHHHHhcccCCeEEEEEECCCCCHHHHHHHHHHH
Confidence            5666 5566888887 55444444444444477888977443


No 74 
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation. Sulfur bacteria oxidize sulfur compounds to provide reducing equivalents for carbon dioxide fixation during autotrophic growth and the respiratory electron transport chain. It is unclear what the role of SoxW is, since it has been found to be dispensable in the oxidation of thiosulfate to sulfate. SoxW is specifically kept in the reduced state by SoxV, which is essential in thiosulfate oxidation.
Probab=23.54  E-value=67  Score=20.96  Aligned_cols=23  Identities=35%  Similarity=0.612  Sum_probs=18.5

Q ss_pred             hhhhhhcC-CceEEEeeCCCChhH
Q psy5544          55 AEELTEEG-LPFLILFYAPGDTET   77 (96)
Q Consensus        55 aEELtEEg-LPfLILF~~pdD~~s   77 (96)
                      .++..++| .|.||.|+.+.-.-.
T Consensus         6 ~~~a~~~~~k~vlv~f~a~wC~~C   29 (125)
T cd02951           6 LAEAAADGKKPLLLLFSQPGCPYC   29 (125)
T ss_pred             HHHHHHcCCCcEEEEEeCCCCHHH
Confidence            45677899 999999999876543


No 75 
>PF14875 PIP49_N:  N-term cysteine-rich ER, FAM69
Probab=23.26  E-value=52  Score=24.29  Aligned_cols=62  Identities=23%  Similarity=0.295  Sum_probs=35.3

Q ss_pred             cceeeecCCCCHHHHHHhhhhccccceeeeeccchhhhhhcCCceEEEeeCCCChhHHHHHHHHHHHHhccccc
Q psy5544          21 EHETYRGNLSAYDETKVWTADKCVPLVREITFENAEELTEEGLPFLILFYAPGDTETIKLFKSIVSEQLLGEKH   94 (96)
Q Consensus        21 ~~~~f~G~~sn~~~l~~W~~~kCvPLVREITFeNaEELtEEgLPfLILF~~pdD~~s~k~F~~~V~~~L~~~k~   94 (96)
                      ..++|.|...+-.-     .=||-  .-|.-..|.+.+.+-+- =..+|+.|    |+++|+..|..+|.+..|
T Consensus        83 ~~~Vy~g~W~~~~v-----viK~~--~~~~~~~~~~~~~~~~~-e~~~~~~P----s~~ef~eMV~~~lk~~lG  144 (158)
T PF14875_consen   83 GKQVYSGSWKGRPV-----VIKCK--MEEALSYDFEPLSWPRS-ELVLFDKP----SMEEFREMVKSFLKNKLG  144 (158)
T ss_pred             CceEEEEEECCcEE-----EEEec--ccccccccccccccccc-ccccCCCC----CHHHHHHHHHHHHHHHhC
Confidence            45778887665221     11111  12344444444433332 12367777    999999999999877554


No 76 
>cd07379 MPP_239FB Homo sapiens 239FB and related proteins, metallophosphatase domain. 239FB (Fetal brain protein 239) is thought to play a role in central nervous system development, but its specific role in unknown.  239FB is expressed predominantly in human fetal brain from a gene located in the chromosome 11p13 region associated with the mental retardation component of the WAGR (Wilms tumor, Aniridia, Genitourinary anomalies, Mental retardation) syndrome. Orthologous brp-like (brain protein 239-like) proteins have been identified in the invertebrate amphioxus group and in vertebrates.  239FB belongs to the metallophosphatase (MPP) superfamily.  MPPs are functionally diverse, but all share a conserved domain with an active site consisting of two metal ions (usually manganese, iron, or zinc) coordinated with octahedral geometry by a cage of histidine, aspartate, and asparagine residues. The MPP superfamily includes: Mre11/SbcD-like exonucleases, Dbr1-like RNA lariat debranching enzyme
Probab=22.90  E-value=2.4e+02  Score=18.69  Aligned_cols=50  Identities=12%  Similarity=0.074  Sum_probs=33.4

Q ss_pred             eeeecCCCCH------HHHHHhhhhccccceeeeeccchhhhhhcCCceEEEeeCCC
Q psy5544          23 ETYRGNLSAY------DETKVWTADKCVPLVREITFENAEELTEEGLPFLILFYAPG   73 (96)
Q Consensus        23 ~~f~G~~sn~------~~l~~W~~~kCvPLVREITFeNaEELtEEgLPfLILF~~pd   73 (96)
                      ....||+++.      +.+..|+.+...|.+. +...|=|....-+-+-+++.|.|-
T Consensus        23 vi~~GD~~~~~~~~~~~~~~~~l~~~~~~~~~-~v~GNHD~~~~~~~~~ilv~H~~p   78 (135)
T cd07379          23 LIHAGDLTERGTLEELQKFLDWLKSLPHPHKI-VIAGNHDLTLDPEDTDILVTHGPP   78 (135)
T ss_pred             EEECCCCCCCCCHHHHHHHHHHHHhCCCCeEE-EEECCCCCcCCCCCCEEEEECCCC
Confidence            5567998763      4578888876555432 678887765554556667777753


No 77 
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus. They are implicated in the formation of the cement gland and the induction of forebrain fate. The human homologs, hAG-2 and hAG-3, are secreted proteins associated with estrogen-positive breast tumors. Yeast two-hybrid studies identified the metastasis-associated C4.4a protein and dystroglycan as binding partners, indicating possible roles in the development and progression of breast cancer. hAG-2 has also been implicated in prostate cancer. Its gene was cloned as an androgen-inducible gene and it was shown to be overexpressed in prostate cancer cells at the mRNA and protein levels. AGR proteins contain one conserved cysteine corresponding to the first cysteine in the CXXC motif of TRX. They show high sequence similarity to ERp19.
Probab=22.90  E-value=55  Score=23.37  Aligned_cols=23  Identities=13%  Similarity=0.351  Sum_probs=17.6

Q ss_pred             eccch-hhhhhcCCceEEEeeCCC
Q psy5544          51 TFENA-EELTEEGLPFLILFYAPG   73 (96)
Q Consensus        51 TFeNa-EELtEEgLPfLILF~~pd   73 (96)
                      +|+.| ++..++|.|.||.||...
T Consensus        11 ~~eeal~~Ak~~~Kpvmv~f~sdw   34 (130)
T cd02960          11 TYEEGLYKAKKSNKPLMVIHHLED   34 (130)
T ss_pred             hHHHHHHHHHHCCCeEEEEEeCCc
Confidence            66666 556788999999988743


No 78 
>PF11303 DUF3105:  Protein of unknown function (DUF3105);  InterPro: IPR021454  Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently no function is known. 
Probab=22.84  E-value=1.2e+02  Score=21.70  Aligned_cols=34  Identities=21%  Similarity=0.315  Sum_probs=25.1

Q ss_pred             ccchhhhhhcCCceEEEeeCCC-ChhHHHHHHHHHHH
Q psy5544          52 FENAEELTEEGLPFLILFYAPG-DTETIKLFKSIVSE   87 (96)
Q Consensus        52 FeNaEELtEEgLPfLILF~~pd-D~~s~k~F~~~V~~   87 (96)
                      =||+==--|.|-  ++++|+|+ +.+.+++.++++.+
T Consensus        40 ~e~~VH~LEHGa--V~i~Y~p~~~~~~v~~L~~l~~~   74 (130)
T PF11303_consen   40 PERAVHNLEHGA--VWITYDPCLPPDQVAKLKALAKS   74 (130)
T ss_pred             hHHHHHhhhcCc--EEEEECCCCCHHHHHHHHHHHhc
Confidence            344445568885  77788888 88889998888775


No 79 
>PTZ00443 Thioredoxin domain-containing protein; Provisional
Probab=22.84  E-value=70  Score=24.53  Aligned_cols=32  Identities=28%  Similarity=0.397  Sum_probs=26.0

Q ss_pred             ceeeeeccchhhhhhc-----CCceEEEeeCCCChhH
Q psy5544          46 LVREITFENAEELTEE-----GLPFLILFYAPGDTET   77 (96)
Q Consensus        46 LVREITFeNaEELtEE-----gLPfLILF~~pdD~~s   77 (96)
                      -|-++|-+|-++++..     +-|.||.||.|-....
T Consensus        31 ~Vv~Lt~~nF~~~v~~~~~~~~~~vlV~FyApWC~~C   67 (224)
T PTZ00443         31 ALVLLNDKNFEKLTQASTGATTGPWFVKFYAPWCSHC   67 (224)
T ss_pred             CcEECCHHHHHHHHhhhcccCCCCEEEEEECCCChHH
Confidence            4788999999988753     5799999999987654


No 80 
>COG4199 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=22.83  E-value=52  Score=25.77  Aligned_cols=15  Identities=40%  Similarity=0.749  Sum_probs=12.6

Q ss_pred             CCCCHHHHHHhhhhc
Q psy5544          28 NLSAYDETKVWTADK   42 (96)
Q Consensus        28 ~~sn~~~l~~W~~~k   42 (96)
                      ..++|.++++|+.++
T Consensus       184 ~yss~~El~~wl~~~  198 (201)
T COG4199         184 AYSSYEELKQWLKSK  198 (201)
T ss_pred             hcCCHHHHHHHHHHH
Confidence            357999999999875


No 81 
>cd07244 FosA FosA, a Fosfomycin resistance protein, catalyzes the addition of glutathione to the antibiotic fosfomycin, making it inactive. This subfamily family contains FosA, a fosfomycin resistant protein. Fosfomycin inhibits the enzyme UDP-N-acetylglucosamine-3-enolpyruvyltransferase (MurA), which catalyzes the first committed step in bacterial cell wall biosynthesis. FosA, catalyzes the addition of glutathione to the antibiotic fosfomycin, (1R,2S)-epoxypropylphosphonic acid, making it inactive. FosA is a Mn(II) dependent enzyme. It is evolutionarily related to glyoxalase I and type I extradiol dioxygenases.
Probab=22.25  E-value=1.1e+02  Score=19.46  Aligned_cols=36  Identities=22%  Similarity=0.163  Sum_probs=27.3

Q ss_pred             CCHHHHHHhhhhccccceeeeeccchhhhhhcCCceEEEeeCCCCh
Q psy5544          30 SAYDETKVWTADKCVPLVREITFENAEELTEEGLPFLILFYAPGDT   75 (96)
Q Consensus        30 sn~~~l~~W~~~kCvPLVREITFeNaEELtEEgLPfLILF~~pdD~   75 (96)
                      .+.+++.+++.++.++.+.+..-        .|  --+.|++||-.
T Consensus        68 ~dl~~~~~~l~~~G~~~~~~~~~--------~~--~~~~f~DPdG~  103 (121)
T cd07244          68 EDFASLKEKLRQAGVKEWKENTS--------EG--DSFYFLDPDGH  103 (121)
T ss_pred             HHHHHHHHHHHHcCCcccCCCCC--------Cc--cEEEEECCCCC
Confidence            58999999999999998765321        12  46789999864


No 82 
>PF12652 CotJB:  CotJB protein;  InterPro: IPR024207 The cotJ operon proteins affect spore coat composition, and is controlled by sigma E. The genes, which include CotJB, are either required for the normal formation of the inner layers of the coat or are themselves structural components of the coat []. CotJB has been identified as a spore coat protein [].
Probab=21.80  E-value=97  Score=20.44  Aligned_cols=21  Identities=19%  Similarity=0.365  Sum_probs=16.6

Q ss_pred             EEeeCCCChhHHHHHHHHHHH
Q psy5544          67 ILFYAPGDTETIKLFKSIVSE   87 (96)
Q Consensus        67 ILF~~pdD~~s~k~F~~~V~~   87 (96)
                      -|=-||+|.+.+..|...+.+
T Consensus        21 yLDTHP~d~~Al~~y~~~~~~   41 (78)
T PF12652_consen   21 YLDTHPDDQEALEYYNEYSKQ   41 (78)
T ss_pred             HhcCCCCcHHHHHHHHHHHHH
Confidence            344689999999999877654


No 83 
>COG3403 Uncharacterized conserved protein [Function unknown]
Probab=21.47  E-value=83  Score=25.43  Aligned_cols=57  Identities=23%  Similarity=0.188  Sum_probs=40.9

Q ss_pred             eeeecCCCCHHHHHHhhhhccccceeeeeccchhhhhhcC-----CceEEEeeCCCChhHHHHHHHHHHHHhcc
Q psy5544          23 ETYRGNLSAYDETKVWTADKCVPLVREITFENAEELTEEG-----LPFLILFYAPGDTETIKLFKSIVSEQLLG   91 (96)
Q Consensus        23 ~~f~G~~sn~~~l~~W~~~kCvPLVREITFeNaEELtEEg-----LPfLILF~~pdD~~s~k~F~~~V~~~L~~   91 (96)
                      -.+.|++.|-+.+..-.-     +.       ||-+|+.|     .-|+.+|+.|+|+-++++|.+..=.+|.+
T Consensus        56 iavvgdl~~p~aa~gla~-----~L-------aey~t~~~D~g~~aSfv~~fdtPEdl~~e~dyee~lwq~l~~  117 (257)
T COG3403          56 IAVVGDLRSPSAAXGLAP-----LL-------AEYGTISRDTGKYASFVVTFDTPEDLFTEPDYEERLWQQLRA  117 (257)
T ss_pred             EEeccCCCCchhhhhhHH-----HH-------HHHhhhccccCcceEEEEEecChhhhhhhhhHHHHHHHHHHH
Confidence            557799988877765442     22       34444443     46899999999999999999887766643


No 84 
>cd00405 PRAI Phosphoribosylanthranilate isomerase (PRAI) catalyzes the fourth step of the tryptophan biosynthesis, the conversion of N-(5'- phosphoribosyl)-anthranilate (PRA) to 1-(o-carboxyphenylamino)- 1-deoxyribulose 5-phosphate (CdRP). Most PRAIs are monomeric, monofunctional and thermolabile, but in some thermophile organisms PRAI is dimeric for reasons of stability and in others it is fused to other components of the tryptophan biosynthesis pathway to form multifunctional enzymes.
Probab=20.88  E-value=89  Score=22.61  Aligned_cols=55  Identities=22%  Similarity=0.308  Sum_probs=37.0

Q ss_pred             cCCCCHHHHHHhhhhccccce--eeeeccchhhhhhcCCceEEE-----eeCCC--ChhHHHHHHH
Q psy5544          27 GNLSAYDETKVWTADKCVPLV--REITFENAEELTEEGLPFLIL-----FYAPG--DTETIKLFKS   83 (96)
Q Consensus        27 G~~sn~~~l~~W~~~kCvPLV--REITFeNaEELtEEgLPfLIL-----F~~pd--D~~s~k~F~~   83 (96)
                      |...+.+.+..|..+  +|++  ==||-+|+.++...|.|..|=     ...|+  |.+.++.|.+
T Consensus       138 g~~~~~~~l~~~~~~--~PvilaGGI~~~Nv~~~i~~~~~~gvdv~S~ie~~pg~kd~~ki~~~~~  201 (203)
T cd00405         138 GKTFDWSLLRGLASR--KPVILAGGLTPDNVAEAIRLVRPYGVDVSSGVETSPGIKDPEKIRAFIE  201 (203)
T ss_pred             cceEChHHhhccccC--CCEEEECCCChHHHHHHHHhcCCCEEEcCCcccCCCCCcCHHHHHHHHH
Confidence            556677788777622  4544  468999999999999776552     33444  6666666654


No 85 
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1. TRP14 catalyzes the reduction of small disulfide-containing peptides but does not reduce disulfides of ribonucleotide reductase, peroxiredoxin and methionine sulfoxide reductase, which are TRX1 substrates. TRP14 also plays a role in tumor necrosis factor (TNF)-alpha signaling pathways, distinct from that of TRX1. Its depletion promoted TNF-alpha induced activation of c-Jun N-terminal kinase and mitogen-activated protein kinases.
Probab=20.77  E-value=74  Score=22.11  Aligned_cols=17  Identities=41%  Similarity=0.757  Sum_probs=12.5

Q ss_pred             hhhhhhc--CCceEEEeeC
Q psy5544          55 AEELTEE--GLPFLILFYA   71 (96)
Q Consensus        55 aEELtEE--gLPfLILF~~   71 (96)
                      .+++.++  |.|.+|.|+.
T Consensus        12 f~~~i~~~~~~~vvV~F~A   30 (119)
T cd02952          12 FLKLLKSHEGKPIFILFYG   30 (119)
T ss_pred             HHHHHHhcCCCeEEEEEEc
Confidence            3444444  8999999999


No 86 
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals. ETEA shows homology to Fas-associated factor 1 (FAF1); both containing UAS and UBX (ubiquitin-associated) domains. Compared to FAF1, however, ETEA lacks the ubiquitin-associated UBA domain and a nuclear targeting domain. The function of ETEA is still unknown. A yeast two-hybrid assay showed that it can interact with Fas. Because of its homology to FAF1, it is postulated that ETEA could be involved in modulating Fas-mediated apoptosis of T-cells and eosinophils of atopic dermatitis patients, making them more resistant to apoptosis.
Probab=20.49  E-value=73  Score=21.74  Aligned_cols=18  Identities=11%  Similarity=0.108  Sum_probs=14.4

Q ss_pred             hhhhcCCceEEEeeCCCC
Q psy5544          57 ELTEEGLPFLILFYAPGD   74 (96)
Q Consensus        57 ELtEEgLPfLILF~~pdD   74 (96)
                      .-..+++++||.+|.|+.
T Consensus        12 ~ak~e~K~llVylhs~~~   29 (116)
T cd02991          12 DAKQELRFLLVYLHGDDH   29 (116)
T ss_pred             HHHhhCCEEEEEEeCCCC
Confidence            346789999999999853


No 87 
>PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional
Probab=20.30  E-value=1.6e+02  Score=22.28  Aligned_cols=53  Identities=21%  Similarity=0.260  Sum_probs=42.2

Q ss_pred             HHHHHHhhhhccccceeeeeccch----hhhhhcCCceE-EEeeCCCChhHHHHHHHH
Q psy5544          32 YDETKVWTADKCVPLVREITFENA----EELTEEGLPFL-ILFYAPGDTETIKLFKSI   84 (96)
Q Consensus        32 ~~~l~~W~~~kCvPLVREITFeNa----EELtEEgLPfL-ILF~~pdD~~s~k~F~~~   84 (96)
                      .+-+....+.+-+|.+|=.+-+.|    |-|.+.|++.+ |=|+.|+-.+.+++.++.
T Consensus         4 ~~~~~~l~~~~vi~vir~~~~~~a~~~~~al~~~Gi~~iEit~~~~~a~~~i~~l~~~   61 (213)
T PRK06552          4 SEILTKLKANGVVAVVRGESKEEALKISLAVIKGGIKAIEVTYTNPFASEVIKELVEL   61 (213)
T ss_pred             hHHHHHHHHCCEEEEEECCCHHHHHHHHHHHHHCCCCEEEEECCCccHHHHHHHHHHH
Confidence            344577788999999999998886    55778999988 778889888888877543


No 88 
>TIGR00849 gutA PTS system, glucitol/sorbitol-specific IIA component. Bacterial PTS transporters transport and concomitantly phosphorylate their sugar substrates, and typically consist of multiple subunits or protein domains. This family consists only of glucitol-specific transporters, and occur both in Gram-negative and Gram-positive bacteria.The system in E.Coli consists of a IIA protein, and a IIBC protein. This family is specific for the IIA component.
Probab=20.28  E-value=64  Score=22.89  Aligned_cols=21  Identities=33%  Similarity=0.426  Sum_probs=14.6

Q ss_pred             cchhhhhhcCCceEEEeeC--CCCh
Q psy5544          53 ENAEELTEEGLPFLILFYA--PGDT   75 (96)
Q Consensus        53 eNaEELtEEgLPfLILF~~--pdD~   75 (96)
                      .+|++.-++  ++||||..  |+|+
T Consensus        14 ~~a~~f~~e--~mlIlFge~Ap~~L   36 (121)
T TIGR00849        14 DLAITFLEE--GMIITFGEGAPDDL   36 (121)
T ss_pred             hhHHhhccC--CEEEEeCCCCChHH
Confidence            356776666  58999987  4444


No 89 
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus. The TMX3 transcript is found in a variety of tissues with the highest levels detected in skeletal muscle and the heart. In vitro, TMX3 showed oxidase activity albeit slightly lower than that of protein disulfide isomerase.
Probab=20.07  E-value=85  Score=19.85  Aligned_cols=25  Identities=24%  Similarity=0.402  Sum_probs=18.1

Q ss_pred             cchhhhhhcCCceEEEeeCCCChhHH
Q psy5544          53 ENAEELTEEGLPFLILFYAPGDTETI   78 (96)
Q Consensus        53 eNaEELtEEgLPfLILF~~pdD~~s~   78 (96)
                      +|-||+++.| |.||.|+.|.-....
T Consensus         7 ~~~~~~~~~~-~vlv~f~a~wC~~C~   31 (104)
T cd03000           7 DSFKDVRKED-IWLVDFYAPWCGHCK   31 (104)
T ss_pred             hhhhhhccCC-eEEEEEECCCCHHHH
Confidence            4556766655 899999999775443


No 90 
>cd00894 PI3Kc_IB_gamma Phosphoinositide 3-kinase (PI3K), class IB, gamma isoform, catalytic domain; The PI3K catalytic domain family is part of a larger superfamily that includes the catalytic domains of other kinases such as the typical serine/threonine/tyrosine protein kinases (PKs), aminoglycoside phosphotransferase, choline kinase, and RIO kinases. PI3Ks catalyze the transfer of the gamma-phosphoryl group from ATP to the 3-hydroxyl of the inositol ring of D-myo-phosphatidylinositol (PtdIns) or its derivatives. PI3Ks can be divided into three main classes (I, II, and III), defined by their substrate specificity, regulation, and domain structure. Class I PI3Ks are the only enzymes capable of converting PtdIns(4,5)P2 to the critical second messenger PtdIns(3,4,5)P3. Class I enzymes are heterodimers and exist in multiple isoforms consisting of one catalytic subunit (out of four isoforms) and one of several regulatory subunits. They are further classified into class IA (alpha, beta and 
Probab=20.04  E-value=1.5e+02  Score=24.76  Aligned_cols=41  Identities=24%  Similarity=0.227  Sum_probs=32.4

Q ss_pred             hhhccccceeeeeccchhhhhhcCCceEEEeeCCCChhHHHHH
Q psy5544          39 TADKCVPLVREITFENAEELTEEGLPFLILFYAPGDTETIKLF   81 (96)
Q Consensus        39 ~~~kCvPLVREITFeNaEELtEEgLPfLILF~~pdD~~s~k~F   81 (96)
                      ...|..|+-  |+|.|++..+..|-|.-++|...||+--...-
T Consensus        76 ~~S~~~Pl~--l~f~~~d~~~~~~~~~~~IfK~GDDLRQD~l~  116 (365)
T cd00894          76 MASKKKPLW--LEFKCADPTALSNETIGIIFKHGDDLRQDMLI  116 (365)
T ss_pred             EcccCCceE--EEEECCCCCccCCCceeEEEeCCCcccHHHHH
Confidence            445567765  89999998888899999999999998654433


Done!