BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= psy5569
         (110 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1XDO|A Chain A, Crystal Structure Of Escherichia Coli Polyphosphate Kinase
 pdb|1XDO|B Chain B, Crystal Structure Of Escherichia Coli Polyphosphate Kinase
 pdb|1XDP|A Chain A, Crystal Structure Of The E.Coli Polyphosphate Kinase In
           Complex With Amppnp
 pdb|1XDP|B Chain B, Crystal Structure Of The E.Coli Polyphosphate Kinase In
           Complex With Amppnp
          Length = 687

 Score = 28.5 bits (62), Expect = 1.0,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 46  MTNSLLFLNAEKQFVAEVDDIEPGTEWERIAKLCDFNPKVGR---TNKDVSRMRSI 98
           M N+L+ +  EK  ++  D I PG  +       +F P VG+    NK + R+R I
Sbjct: 267 MPNALVEVLREKLTISRYDSIVPGGRYHNFKDFINF-PNVGKANLVNKPLPRLRHI 321


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.133    0.378 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 3,182,859
Number of Sequences: 62578
Number of extensions: 109242
Number of successful extensions: 241
Number of sequences better than 100.0: 4
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 239
Number of HSP's gapped (non-prelim): 4
length of query: 110
length of database: 14,973,337
effective HSP length: 74
effective length of query: 36
effective length of database: 10,342,565
effective search space: 372332340
effective search space used: 372332340
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 45 (21.9 bits)