Query         psy5569
Match_columns 110
No_of_seqs    114 out of 135
Neff          3.9 
Searched_HMMs 46136
Date          Fri Aug 16 20:51:01 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5569.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5569hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF01086 Clathrin_lg_ch:  Clath  99.9 5.1E-27 1.1E-31  182.8   0.1   58   50-107   163-224 (225)
  2 KOG4031|consensus               99.9 3.8E-22 8.2E-27  157.1   8.3   60   50-109   157-216 (216)
  3 PF00249 Myb_DNA-binding:  Myb-  75.0     6.4 0.00014   23.2   3.7   26   54-80      7-32  (48)
  4 smart00717 SANT SANT  SWI3, AD  49.4      32 0.00069   18.6   3.2   25   54-80      7-32  (49)
  5 PF08485 Polysacc_syn_2C:  Poly  36.1      28  0.0006   22.0   1.7   30   73-103    16-45  (48)
  6 cd00167 SANT 'SWI3, ADA2, N-Co  35.8      64  0.0014   17.2   3.0   27   53-80      4-30  (45)
  7 PF01846 FF:  FF domain;  Inter  35.8      72  0.0016   18.7   3.4   27   56-83      3-32  (51)
  8 PHA00097 K protein K            29.5      29 0.00062   22.6   0.9   15   77-91     42-56  (56)
  9 PF11903 DUF3423:  Protein of u  29.2      62  0.0013   21.7   2.6   30   69-103    29-58  (72)
 10 smart00441 FF Contains two con  26.3      74  0.0016   18.7   2.4   30   54-83      2-34  (55)
 11 cd00197 VHS_ENTH_ANTH VHS, ENT  25.8      89  0.0019   21.1   3.0   39   65-105    11-49  (115)
 12 cd03565 VHS_Tom1 VHS domain fa  24.3 1.3E+02  0.0027   21.9   3.7   37   66-104    13-49  (141)
 13 PF00790 VHS:  VHS domain;  Int  21.9      58  0.0013   23.2   1.5   40   65-106    16-55  (140)
 14 PF12283 Protein_K:  Bacterioph  21.3      51  0.0011   21.5   1.0   15   77-91     42-56  (56)
 15 smart00054 EFh EF-hand, calciu  21.2   1E+02  0.0022   13.9   3.0   28   71-101     1-28  (29)
 16 smart00510 TFS2M Domain in the  20.5      62  0.0013   22.5   1.4   17   90-106    49-67  (102)
 17 PF03579 SHP:  Small hydrophobi  20.5      57  0.0012   21.8   1.1   22   75-97     41-62  (64)

No 1  
>PF01086 Clathrin_lg_ch:  Clathrin light chain;  InterPro: IPR000996 Proteins synthesized on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment. These vesicles have specific coat proteins (such as clathrin or coatomer) that are important for cargo selection and direction of transport []. Clathrin coats contain both clathrin (acts as a scaffold) and adaptor complexes that link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. The two major types of clathrin adaptor complexes are the heterotetrameric adaptor protein (AP) complexes, and the monomeric GGA (Golgi-localising, Gamma-adaptin ear domain homology, ARF-binding proteins) adaptors [, ].  Clathrin is a trimer composed of three heavy chains and three light chains, each monomer projecting outwards like a leg; this three-legged structure is known as a triskelion [, ]. The heavy chains form the legs, their N-terminal beta-propeller regions extending outwards, while their C-terminal alpha-alpha-superhelical regions form the central hub of the triskelion. Peptide motifs can bind between the beta-propeller blades. The light chains appear to have a regulatory role, and may help orient the assembly and disassembly of clathrin coats as they interact with hsc70 uncoating ATPase []. Clathrin triskelia self-polymerise into a curved lattice by twisting individual legs together. The clathrin lattice forms around a vesicle as it buds from the TGN, plasma membrane or endosomes, acting to stabilise the vesicle and facilitate the budding process []. The multiple blades created when the triskelia polymerise are involved in multiple protein interactions, enabling the recruitment of different cargo adaptors and membrane attachment proteins [].  This entry represents clathrin light chains, which are more divergent in sequence than the heavy chains []. In higher eukaryotes, two genes encode distinct but related light chains, each of which can yield two separate forms via alternative splicing. In yeast there is a single light chain whose sequence is only distantly related to that of higher eukaryotes. Clathrin light chains have a conserved acidic N-terminal domain, a central coiled-coil domain and a conserved C-terminal domain.  More information about these proteins can be found at Protein of the Month: Clathrin [].; GO: 0005198 structural molecule activity, 0006886 intracellular protein transport, 0016192 vesicle-mediated transport, 0030130 clathrin coat of trans-Golgi network vesicle, 0030132 clathrin coat of coated pit; PDB: 3LVG_E 3LVH_D.
Probab=99.92  E-value=5.1e-27  Score=182.76  Aligned_cols=58  Identities=52%  Similarity=0.853  Sum_probs=2.8

Q ss_pred             hhcHHHHHHHHHhhccCC-CCChhHHHHhhhcCCCCCCCCcchHHHHHHHHHHhh---cCCC
Q psy5569          50 LLFLNAEKQFVAEVDDIE-PGTEWERIAKLCDFNPKVGRTNKDVSRMRSIILQLK---QTPL  107 (110)
Q Consensus        50 ~~NR~~Ee~fl~~~~~~~-~gt~WERIakLiDf~~K~sk~~kDlSRMR~iLL~LK---~~p~  107 (110)
                      ++||++|++||+.+++.. +||+|+||++||||+++++++++|+||||+|||+||   +.|.
T Consensus       163 ~~nr~~ee~fl~~~~~~~~~~t~WerV~~Lid~~~~~~~~~kD~sRmR~iLl~LK~~~~~Pg  224 (225)
T PF01086_consen  163 KQNREEEEEFLAKREEFLQPGTEWERVAKLIDFNPKSSKSGKDVSRMREILLKLKGDENAPG  224 (225)
T ss_dssp             HTT-----------------------------------------------------------
T ss_pred             HHHHHHHHHHHHcccccCCCCCcHHHHHHHhCCCCCCCCCCCcHHHHHHHHHHhhhhccCCC
Confidence            899999999999998765 999999999999999999999999999999999999   6665


No 2  
>KOG4031|consensus
Probab=99.87  E-value=3.8e-22  Score=157.05  Aligned_cols=60  Identities=50%  Similarity=0.850  Sum_probs=54.9

Q ss_pred             hhcHHHHHHHHHhhccCCCCChhHHHHhhhcCCCCCCCCcchHHHHHHHHHHhhcCCCCC
Q psy5569          50 LLFLNAEKQFVAEVDDIEPGTEWERIAKLCDFNPKVGRTNKDVSRMRSIILQLKQTPLKK  109 (110)
Q Consensus        50 ~~NR~~Ee~fl~~~~~~~~gt~WERIakLiDf~~K~sk~~kDlSRMR~iLL~LK~~p~~~  109 (110)
                      .+||++++.|+...+..++||+||||++|||||+|++|++|||||||+|||+|||.|.+.
T Consensus       157 ~~nk~eee~~~~e~~~~~~gTeWErv~kL~D~n~k~sk~gkD~SRlrslL~~LK~aP~a~  216 (216)
T KOG4031|consen  157 ANNKAEEEALVKENEEFSPGTEWERVAKLCDFNPKSSKQGKDVSRLRSLLISLKQAPGAA  216 (216)
T ss_pred             HHhHHHHHHHHHhhcccCCCchHHHHHHHHcCCccchhccccHHHHHHHHHHhhhCcCCC
Confidence            778877777777778888999999999999999999999999999999999999999863


No 3  
>PF00249 Myb_DNA-binding:  Myb-like DNA-binding domain;  InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins. These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B ....
Probab=74.98  E-value=6.4  Score=23.20  Aligned_cols=26  Identities=19%  Similarity=0.461  Sum_probs=15.6

Q ss_pred             HHHHHHHHhhccCCCCChhHHHHhhhc
Q psy5569          54 NAEKQFVAEVDDIEPGTEWERIAKLCD   80 (110)
Q Consensus        54 ~~Ee~fl~~~~~~~~gt~WERIakLiD   80 (110)
                      ++++.|+...... +...|..|++.+.
T Consensus         7 eE~~~l~~~v~~~-g~~~W~~Ia~~~~   32 (48)
T PF00249_consen    7 EEDEKLLEAVKKY-GKDNWKKIAKRMP   32 (48)
T ss_dssp             HHHHHHHHHHHHS-TTTHHHHHHHHHS
T ss_pred             HHHHHHHHHHHHh-CCcHHHHHHHHcC
Confidence            3455555532222 2226999999997


No 4  
>smart00717 SANT SANT  SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains.
Probab=49.39  E-value=32  Score=18.64  Aligned_cols=25  Identities=28%  Similarity=0.533  Sum_probs=15.7

Q ss_pred             HHHHHHHHhhccCCCC-ChhHHHHhhhc
Q psy5569          54 NAEKQFVAEVDDIEPG-TEWERIAKLCD   80 (110)
Q Consensus        54 ~~Ee~fl~~~~~~~~g-t~WERIakLiD   80 (110)
                      ++++.|+.....  .| ..|..|++.+.
T Consensus         7 ~E~~~l~~~~~~--~g~~~w~~Ia~~~~   32 (49)
T smart00717        7 EEDELLIELVKK--YGKNNWEKIAKELP   32 (49)
T ss_pred             HHHHHHHHHHHH--HCcCCHHHHHHHcC
Confidence            444555553222  24 77999999985


No 5  
>PF08485 Polysacc_syn_2C:  Polysaccharide biosynthesis protein C-terminal;  InterPro: IPR013692 This domain is found to the C terminus of the IPR003869 from INTERPRO domain in bacterial polysaccharide biosynthesis enzymes including the capsule protein CapD [] and several putative epimerases/dehydratases. ; GO: 0003978 UDP-glucose 4-epimerase activity, 0009103 lipopolysaccharide biosynthetic process
Probab=36.10  E-value=28  Score=22.02  Aligned_cols=30  Identities=30%  Similarity=0.587  Sum_probs=23.3

Q ss_pred             HHHHhhhcCCCCCCCCcchHHHHHHHHHHhh
Q psy5569          73 ERIAKLCDFNPKVGRTNKDVSRMRSIILQLK  103 (110)
Q Consensus        73 ERIakLiDf~~K~sk~~kDlSRMR~iLL~LK  103 (110)
                      .+|+.+-|++...+. -=|+.-|+++|+.|-
T Consensus        16 ~~~~~~~dYnShNT~-rL~ve~~k~lLl~L~   45 (48)
T PF08485_consen   16 EKISEVEDYNSHNTE-RLDVEEMKELLLKLD   45 (48)
T ss_pred             cccccccccCCCCcc-ccCHHHHHHHHHhCh
Confidence            356777888887665 467999999999884


No 6  
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains. Tandem copies of the domain bind telomeric DNA tandem repeatsas part of the capping complex. Binding is sequence dependent for repeats which contain the G/C rich motif [C2-3 A (CA)1-6]. The domain is also found in regulatory transcriptional repressor complexes where it also binds DNA.
Probab=35.79  E-value=64  Score=17.17  Aligned_cols=27  Identities=22%  Similarity=0.393  Sum_probs=15.8

Q ss_pred             HHHHHHHHHhhccCCCCChhHHHHhhhc
Q psy5569          53 LNAEKQFVAEVDDIEPGTEWERIAKLCD   80 (110)
Q Consensus        53 R~~Ee~fl~~~~~~~~gt~WERIakLiD   80 (110)
                      .++++.|+...... +...|..|++.+.
T Consensus         4 ~eE~~~l~~~~~~~-g~~~w~~Ia~~~~   30 (45)
T cd00167           4 EEEDELLLEAVKKY-GKNNWEKIAKELP   30 (45)
T ss_pred             HHHHHHHHHHHHHH-CcCCHHHHHhHcC
Confidence            34455555432222 2167999999984


No 7  
>PF01846 FF:  FF domain;  InterPro: IPR002713 The FF domain may be involved in protein-protein interaction []. It often occurs as multiple copies and often accompanies WW domains IPR001202 from INTERPRO. PRP40 from yeast encodes a novel, essential splicing component that associates with the yeast U1 small nuclear ribonucleoprotein particle [].; PDB: 3HFH_B 2KIS_A 2DOD_A 2JUC_A 2LKS_A 1UZC_A 2KZG_A 2L9V_A 2DOF_A 2KFD_A ....
Probab=35.78  E-value=72  Score=18.68  Aligned_cols=27  Identities=26%  Similarity=0.516  Sum_probs=18.1

Q ss_pred             HHHHHH---hhccCCCCChhHHHHhhhcCCC
Q psy5569          56 EKQFVA---EVDDIEPGTEWERIAKLCDFNP   83 (110)
Q Consensus        56 Ee~fl~---~~~~~~~gt~WERIakLiDf~~   83 (110)
                      .+.|.+   +.. +++.+.|+.|..+|.-.|
T Consensus         3 ~~~F~~lL~e~~-i~~~s~W~~~~~~l~~dp   32 (51)
T PF01846_consen    3 REAFKELLKEHK-ITPYSSWEEVKPKLSKDP   32 (51)
T ss_dssp             HHHHHHHHHHTT-S-TTSSHHHHHHHHTTSC
T ss_pred             HHHHHHHHHhCC-CCCCCcHHHHHHHHccCH
Confidence            344554   333 789999999999995443


No 8  
>PHA00097 K protein K
Probab=29.50  E-value=29  Score=22.60  Aligned_cols=15  Identities=33%  Similarity=0.804  Sum_probs=12.2

Q ss_pred             hhhcCCCCCCCCcch
Q psy5569          77 KLCDFNPKVGRTNKD   91 (110)
Q Consensus        77 kLiDf~~K~sk~~kD   91 (110)
                      =||+++|++..++||
T Consensus        42 ll~~lsps~~r~~k~   56 (56)
T PHA00097         42 LLCNLSPSSQRSGKN   56 (56)
T ss_pred             HhhcCCCCcccccCC
Confidence            478999998887775


No 9  
>PF11903 DUF3423:  Protein of unknown function (DUF3423);  InterPro: IPR021831  This family of proteins are functionally uncharacterised. This protein is found in bacteria. Proteins in this family are typically between 73 to 118 amino acids in length. 
Probab=29.18  E-value=62  Score=21.71  Aligned_cols=30  Identities=23%  Similarity=0.462  Sum_probs=23.9

Q ss_pred             CChhHHHHhhhcCCCCCCCCcchHHHHHHHHHHhh
Q psy5569          69 GTEWERIAKLCDFNPKVGRTNKDVSRMRSIILQLK  103 (110)
Q Consensus        69 gt~WERIakLiDf~~K~sk~~kDlSRMR~iLL~LK  103 (110)
                      =..|-||.+++..||     .-+.+..+.+|+..-
T Consensus        29 iE~WariGr~~E~np-----~l~~~~I~~~l~~~~   58 (72)
T PF11903_consen   29 IEHWARIGRAAEDNP-----DLSYSFIEEMLLAAE   58 (72)
T ss_pred             HHHHHHHHHHHHHCC-----CCCHHHHHHHHHHhh
Confidence            458999999999888     445778888888654


No 10 
>smart00441 FF Contains two conserved F residues. A novel motif that often accompanies WW domains. Often contains two conserved Phe (F) residues.
Probab=26.31  E-value=74  Score=18.73  Aligned_cols=30  Identities=27%  Similarity=0.488  Sum_probs=20.2

Q ss_pred             HHHHHHHHhh---ccCCCCChhHHHHhhhcCCC
Q psy5569          54 NAEKQFVAEV---DDIEPGTEWERIAKLCDFNP   83 (110)
Q Consensus        54 ~~Ee~fl~~~---~~~~~gt~WERIakLiDf~~   83 (110)
                      +..++|.+..   ...+++++|+.|.+++--.|
T Consensus         2 ~~~~~F~~LL~e~~~~~~~~~W~~~~~~~~~d~   34 (55)
T smart00441        2 EAKEAFKELLKEHEVITPDTTWSEARKKLKNDP   34 (55)
T ss_pred             hHHHHHHHHHHhCCCCCCCCcHHHHHHHHhcCh
Confidence            3456676643   22358999999999885443


No 11 
>cd00197 VHS_ENTH_ANTH VHS, ENTH and ANTH domain superfamily; composed of proteins containing a VHS, ENTH or ANTH domain. The VHS domain is present in Vps27 (Vacuolar Protein Sorting), Hrs (Hepatocyte growth factor-regulated tyrosine kinase substrate) and STAM (Signal Transducing Adaptor Molecule). It is located at the N-termini of proteins involved in intracellular membrane trafficking. The epsin N-terminal homology (ENTH) domain is an evolutionarily conserved protein module found primarily in proteins that participate in clathrin-mediated endocytosis. A set of proteins previously designated as harboring an ENTH domain in fact contains a highly similar, yet unique module referred to as an AP180 N-terminal homology (ANTH) domain. VHS, ENTH and ANTH domains are structurally similar and are composed of a superhelix of eight alpha helices. ENTH adnd ANTH (E/ANTH) domains bind both inositol phospholipids and proteins and contribute to the nucleation and formation of clathrin coats on membra
Probab=25.76  E-value=89  Score=21.11  Aligned_cols=39  Identities=18%  Similarity=0.443  Sum_probs=27.2

Q ss_pred             cCCCCChhHHHHhhhcCCCCCCCCcchHHHHHHHHHHhhcC
Q psy5569          65 DIEPGTEWERIAKLCDFNPKVGRTNKDVSRMRSIILQLKQT  105 (110)
Q Consensus        65 ~~~~gt~WERIakLiDf~~K~sk~~kDlSRMR~iLL~LK~~  105 (110)
                      +...+..|.-|-.+||+-.....++++  =|+.|..+|++.
T Consensus        11 ~~~~~p~~~~i~~i~d~~~~~~~~~~~--~~~~l~kRl~~~   49 (115)
T cd00197          11 NENMGPDWPLIMEICDLINETNVGPKE--AVDAIKKRINNK   49 (115)
T ss_pred             CCCCCCCHHHHHHHHHHHHCCCccHHH--HHHHHHHHhcCC
Confidence            345689999999999998655444444  466677777654


No 12 
>cd03565 VHS_Tom1 VHS domain family, Tom1 subfamily; The VHS domain is an essential part of Tom1 (Target of myb1 - retroviral oncogene) protein. The VHS domain has a superhelical structure similar to the structure of the ARM repeats and is present at the very N-termini of proteins. It is a right-handed superhelix of eight alpha helices. The VHS domain has been found in a number of proteins, some of which have been implicated in intracellular trafficking and sorting. The VHS domain of the Tom1 protein is essential for the negative regulation of Interleukin-1 and Tumor Necrosis Factor-induced signaling pathways.
Probab=24.31  E-value=1.3e+02  Score=21.92  Aligned_cols=37  Identities=19%  Similarity=0.369  Sum_probs=28.0

Q ss_pred             CCCCChhHHHHhhhcCCCCCCCCcchHHHHHHHHHHhhc
Q psy5569          66 IEPGTEWERIAKLCDFNPKVGRTNKDVSRMRSIILQLKQ  104 (110)
Q Consensus        66 ~~~gt~WERIakLiDf~~K~sk~~kDlSRMR~iLL~LK~  104 (110)
                      .-..--|.-|-.+||.-+...-+++|.  ||.|-.+|++
T Consensus        13 ~l~~~dw~~ileicD~In~~~~~~k~a--~ralkkRl~~   49 (141)
T cd03565          13 SLQSEDWGLNMEICDIINETEDGPKDA--VRALKKRLNG   49 (141)
T ss_pred             CCCCcCHHHHHHHHHHHhCCCCcHHHH--HHHHHHHHcc
Confidence            345668999999999977655566664  7788888874


No 13 
>PF00790 VHS:  VHS domain;  InterPro: IPR002014 The VHS domain is a ~140 residues long domain, whose name is derived from its occurrence in VPS-27, Hrs and STAM. Based on regions surrounding the domain, VHS-proteins can be divided into 4 groups []:  STAM/EAST/Hbp which all share the domain composition VHS-SH3-ITAM and carry one or two ubiquitin-interacting motifs   Proteins with a FYVE domain (IPR000306 from INTERPRO) C-terminal to VHS which also carry one or two ubiquitin-interacting motifs   GGA proteins with a domain composition VHS-GAT (GGA and Tom1) homology domain   VHS domain alone or in combination with domains other than those listed above The VHS domain is always found at the N- terminus of proteins suggesting that such topology is important for function. The domain is considered to have a general membrane targeting/cargo recognition role in vesicular trafficking []. Resolution of the crystal structure of the VHS domain of Drosophila Hrs and human Tom1 revealed that it consists of eight helices arranged in a double-layer superhelix []. The existence of conserved patches of residues on the domain surface suggests that VHS domains may be involved in protein-protein recognition and docking. Overall, sequence similarity is low (approx 25%) amongst domain family members.; GO: 0006886 intracellular protein transport; PDB: 1X5B_A 2L0T_B 1DVP_A 3LDZ_C 3ZYQ_A 4AVX_A 3G2U_A 3G2W_A 1UJJ_A 3G2V_A ....
Probab=21.89  E-value=58  Score=23.18  Aligned_cols=40  Identities=23%  Similarity=0.464  Sum_probs=26.4

Q ss_pred             cCCCCChhHHHHhhhcCCCCCCCCcchHHHHHHHHHHhhcCC
Q psy5569          65 DIEPGTEWERIAKLCDFNPKVGRTNKDVSRMRSIILQLKQTP  106 (110)
Q Consensus        65 ~~~~gt~WERIakLiDf~~K~sk~~kDlSRMR~iLL~LK~~p  106 (110)
                      ......-|..|-.|||+-.....++++.  +|.|-.+|++..
T Consensus        16 ~~~~~~Dw~~~l~icD~i~~~~~~~kea--~~~l~krl~~~~   55 (140)
T PF00790_consen   16 ESLPSPDWSLILEICDLINSSPDGAKEA--ARALRKRLKHGN   55 (140)
T ss_dssp             TTSSS--HHHHHHHHHHHHTSTTHHHHH--HHHHHHHHTTSS
T ss_pred             cCCCCCCHHHHHHHHHHHHcCCccHHHH--HHHHHHHHhCCC
Confidence            3346679999999999866555556665  445777777743


No 14 
>PF12283 Protein_K:  Bacteriophage protein K;  InterPro: IPR020962  This family of proteins is found in the microviridae (isometric ssDNA phages) and are approximately 60 amino acids in length. The function of these proteins are unknown. In phi X174 site-directed mutagenesis of gene K produces small plaques on su- hosts. The mutant phage has an identical latent period, but a more reduced burst size than that of the wild-type phi X174. The reduced burst size in the gene K mutant suggests that the gene K protein, although not essential, has a role in increasing infectivity by increasing the burst size three to six fold [].
Probab=21.30  E-value=51  Score=21.47  Aligned_cols=15  Identities=40%  Similarity=0.612  Sum_probs=11.9

Q ss_pred             hhhcCCCCCCCCcch
Q psy5569          77 KLCDFNPKVGRTNKD   91 (110)
Q Consensus        77 kLiDf~~K~sk~~kD   91 (110)
                      =||+++|++..++||
T Consensus        42 llr~lsps~~~~~kd   56 (56)
T PF12283_consen   42 LLRDLSPSSQRSGKD   56 (56)
T ss_pred             HhhcCCCCccccccC
Confidence            478999988887776


No 15 
>smart00054 EFh EF-hand, calcium binding motif. EF-hands are calcium-binding motifs that occur at least in pairs. Links between disease states and genes encoding EF-hands, particularly the S100 subclass, are emerging. Each motif consists of a 12 residue loop flanked on either side by a 12 residue alpha-helix. EF-hands undergo a conformational change unpon binding calcium ions.
Probab=21.18  E-value=1e+02  Score=13.88  Aligned_cols=28  Identities=14%  Similarity=0.224  Sum_probs=17.6

Q ss_pred             hhHHHHhhhcCCCCCCCCcchHHHHHHHHHH
Q psy5569          71 EWERIAKLCDFNPKVGRTNKDVSRMRSIILQ  101 (110)
Q Consensus        71 ~WERIakLiDf~~K~sk~~kDlSRMR~iLL~  101 (110)
                      +|.++-+.+|.+..+   .-+...++.++.+
T Consensus         1 ~~~~~f~~~d~~~~g---~i~~~e~~~~~~~   28 (29)
T smart00054        1 ELKEAFRLFDKDGDG---KIDFEEFKDLLKA   28 (29)
T ss_pred             CHHHHHHHHCCCCCC---cEeHHHHHHHHHh
Confidence            366777888876533   3456667766654


No 16 
>smart00510 TFS2M Domain in the central regions of transcription elongation factor S-II (and elsewhere).
Probab=20.54  E-value=62  Score=22.54  Aligned_cols=17  Identities=35%  Similarity=0.600  Sum_probs=14.4

Q ss_pred             chHHHHHHHHHHhh--cCC
Q psy5569          90 KDVSRMRSIILQLK--QTP  106 (110)
Q Consensus        90 kDlSRMR~iLL~LK--~~p  106 (110)
                      +=.++||+|+-.||  ++|
T Consensus        49 ~Yk~k~Rsl~fNLkd~kN~   67 (102)
T smart00510       49 KYKNKYRSLYFNLKDKKNP   67 (102)
T ss_pred             HHHHHHHHHHHHhcCCCCH
Confidence            34789999999999  776


No 17 
>PF03579 SHP:  Small hydrophobic protein;  InterPro: IPR005327 The small hydrophobic integral membrane protein, SH (previously designated 1A) is found to have a variety of glycosylated forms [, ]. This protein is a component of the mature respiratory syncytial virion [] where it may form complexes and appears to play a structural role.; GO: 0016020 membrane, 0016021 integral to membrane, 0048222 glycoprotein network
Probab=20.46  E-value=57  Score=21.81  Aligned_cols=22  Identities=27%  Similarity=0.410  Sum_probs=15.7

Q ss_pred             HHhhhcCCCCCCCCcchHHHHHH
Q psy5569          75 IAKLCDFNPKVGRTNKDVSRMRS   97 (110)
Q Consensus        75 IakLiDf~~K~sk~~kDlSRMR~   97 (110)
                      ..||||++..-++ +-|+-+++.
T Consensus        41 LNKLcd~n~~h~~-sldi~~~~~   62 (64)
T PF03579_consen   41 LNKLCDLNDFHTN-SLDIRTRLR   62 (64)
T ss_pred             HHHHHHhhhhccc-cchHhHHhc
Confidence            4799999987766 466666653


Done!