Diaphorina citri psyllid: psy5581


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240
MAPLVDQAGYWGERTSTVDWCEKNYVESYYVAEMWNTVSNLVMMLQALYGIYDVFRNDFEKKFIIAYTFLFVVGMGSWAFHMTLLYEMQLFDELPMVWGTCFSLYLLCDIKSPKSLSKPGLVAGLLLSISFTLIYLYNPLPVLHNTAFAILAISSYVLQICMIRQTRCRLCATLYALSFACYLFGFALWNVDKFYCDNLTSFRESIPGWISPTTQLHAWWHCFAGHGTYLSVLLTVLSGR
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEHHHHHHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHEEccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHccc
*****DQ**YWGERTSTVDWCEKNYVESYYVAEMWNTVSNLVMMLQALYGIYDVFRNDFEKKFIIAYTFLFVVGMGSWAFHMTLLYEMQLFDELPMVWGTCFSLYLLCDIKSPKSLSKPGLVAGLLLSISFTLIYLYNPLPVLHNTAFAILAISSYVLQICMIRQTRCRLCATLYALSFACYLFGFALWNVDKFYCDNLTSFRESIPGWISPTTQLHAWWHCFAGHGTYLSVLLTVLSG*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAPLVDQAGYWGERTSTVDWCEKNYVESYYVAEMWNTVSNLVMMLQALYGIYDVFRNDFEKKFIIAYTFLFVVGMGSWAFHMTLLYEMQLFDELPMVWGTCFSLYLLCDIKSPKSLSKPGLVAGLLLSISFTLIYLYNPLPVLHNTAFAILAISSYVLQICMIRQTRCRLCATLYALSFACYLFGFALWNVDKFYCDNLTSFRESIPGWISPTTQLHAWWHCFAGHGTYLSVLLTVLSGR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Alkaline ceramidase 3 Hydrolyzes only phytoceramide into phytosphingosine and free fatty acid. Does not have reverse activity.confidentQ9NUN7
Alkaline ceramidase 3 Hydrolyzes only phytoceramide into phytosphingosine and free fatty acid. Does not have reverse activity.confidentQ9D099
Alkaline ceramidase YPC1 Hydrolyzes phytoceramide and also dihydroceramide into phytosphingosine or dihydrosphingosine. Prefers phytoceramide. Has also reverse hydrolysis activity, catalyzing synthesis of phytoceramide and dihydroceramide from palmitic acid and phytosphingosine or dihydrosphingosine. Is not responsible for the breakdown of unsaturated ceramide.confidentP38298

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0071602 [BP]phytosphingosine biosynthetic processprobableGO:0046173, GO:0019751, GO:0044249, GO:0034641, GO:0006807, GO:0044281, GO:0044283, GO:0006629, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0046520, GO:0046467, GO:0006665, GO:0030148, GO:0006643, GO:0046165, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:1901564, GO:0044255, GO:0008610, GO:0044238, GO:0044271, GO:1901566, GO:0044237, GO:0006066, GO:0046519, GO:1901617, GO:0006671, GO:1901615
GO:0030176 [CC]integral to endoplasmic reticulum membraneprobableGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0030173 [CC]integral to Golgi membraneprobableGO:0043229, GO:0031301, GO:0031300, GO:0005622, GO:0043227, GO:0043226, GO:0031224, GO:0005737, GO:0005575, GO:0031090, GO:0016021, GO:0016020, GO:0044431, GO:0005794, GO:0012505, GO:0043231, GO:0044464, GO:0031228, GO:0005623, GO:0000139, GO:0044446, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0070774 [MF]phytoceramidase activityprobableGO:0016787, GO:0017040, GO:0016810, GO:0016811, GO:0016798, GO:0003824, GO:0003674, GO:0004553
GO:0046512 [BP]sphingosine biosynthetic processprobableGO:0046173, GO:0019751, GO:0034311, GO:0044249, GO:0034641, GO:0034312, GO:0044281, GO:0044283, GO:0006629, GO:1901576, GO:0044710, GO:0044711, GO:0071704, GO:0046520, GO:0046467, GO:0006665, GO:0030148, GO:0006643, GO:0046165, GO:0009987, GO:0009058, GO:0008150, GO:0008152, GO:1901564, GO:0044255, GO:0008610, GO:0044238, GO:0044271, GO:1901566, GO:0044237, GO:0006066, GO:0006807, GO:0046519, GO:1901615, GO:1901617, GO:0006670
GO:0006672 [BP]ceramide metabolic processprobableGO:0044238, GO:0044710, GO:1901564, GO:0006643, GO:0009987, GO:0044237, GO:0071704, GO:0006807, GO:0008150, GO:0008152, GO:0044255, GO:0006665, GO:0006629
GO:0006644 [BP]phospholipid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0009987, GO:0044237, GO:0071704, GO:0006796, GO:0008150, GO:0008152, GO:0006793, GO:0019637, GO:0044255
GO:0071633 [MF]dihydroceramidase activityprobableGO:0016787, GO:0017040, GO:0016810, GO:0016811, GO:0016798, GO:0003824, GO:0003674, GO:0004553

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

No confident structure templates for the query are predicted