Query         psy5588
Match_columns 61
No_of_seqs    145 out of 1030
Neff          7.6 
Searched_HMMs 46136
Date          Fri Aug 16 21:23:38 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5588.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5588hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 COG2518 Pcm Protein-L-isoaspar  99.7 3.1E-17 6.6E-22  102.2   7.4   55    1-56    151-205 (209)
  2 PF01135 PCMT:  Protein-L-isoas  99.7 3.1E-16 6.7E-21   97.5   6.3   55    1-56    154-208 (209)
  3 KOG1661|consensus               99.4 2.1E-12 4.6E-17   81.2   6.7   60    1-60    175-234 (237)
  4 TIGR00080 pimt protein-L-isoas  99.3 1.4E-11 2.9E-16   76.0   7.8   56    1-59    159-214 (215)
  5 PRK13942 protein-L-isoaspartat  99.3   1E-11 2.2E-16   76.7   7.2   54    1-57    158-211 (212)
  6 PRK13944 protein-L-isoaspartat  99.3   2E-11 4.3E-16   75.0   7.1   51    1-53    155-205 (205)
  7 PRK00312 pcm protein-L-isoaspa  99.1 1.3E-09 2.7E-14   66.9   7.6   54    1-56    157-210 (212)
  8 PRK13943 protein-L-isoaspartat  98.0 2.5E-05 5.5E-10   51.4   6.4   55    1-56    162-217 (322)
  9 PF09857 DUF2084:  Uncharacteri  85.5     2.3 4.9E-05   23.4   3.7   31    4-34      9-39  (85)
 10 COG2242 CobL Precorrin-6B meth  85.4     0.5 1.1E-05   29.4   1.3   19    1-19    117-135 (187)
 11 PRK13687 hypothetical protein;  85.1     2.4 5.2E-05   23.3   3.7   32    3-34      8-39  (85)
 12 TIGR02469 CbiT precorrin-6Y C5  75.7     3.1 6.8E-05   22.4   2.2   17    3-19    106-122 (124)
 13 COG4106 Tam Trans-aconitate me  72.5       3 6.6E-05   27.1   1.9   19    3-21    113-131 (257)
 14 PRK00107 gidB 16S rRNA methylt  71.9     3.1 6.8E-05   25.4   1.8   20    3-22    129-148 (187)
 15 COG3811 Uncharacterized protei  70.4      12 0.00027   20.3   3.7   32    3-34      8-39  (85)
 16 COG0275 Predicted S-adenosylme  70.2       4 8.8E-05   27.4   2.1   18    3-20    228-245 (314)
 17 TIGR00006 S-adenosyl-methyltra  67.5     4.9 0.00011   26.7   2.1   16    4-19    225-240 (305)
 18 PF13659 Methyltransf_26:  Meth  66.5       4 8.6E-05   22.0   1.3   18    3-20     99-116 (117)
 19 PF06859 Bin3:  Bicoid-interact  65.2     3.2 6.9E-05   23.8   0.8   14    4-17     29-42  (110)
 20 PRK07402 precorrin-6B methylas  64.7     5.8 0.00013   23.8   1.9   18    3-20    126-143 (196)
 21 PLN02232 ubiquinone biosynthes  62.9     6.5 0.00014   23.0   1.8   16    3-18     65-80  (160)
 22 TIGR00452 methyltransferase, p  61.9     6.7 0.00015   26.0   1.9   16    3-18    209-224 (314)
 23 PF13489 Methyltransf_23:  Meth  61.6     4.4 9.5E-05   22.8   0.9   19    3-21     99-117 (161)
 24 TIGR00138 gidB 16S rRNA methyl  61.1     9.5 0.00021   23.0   2.4   20    3-22    126-145 (181)
 25 PF06962 rRNA_methylase:  Putat  60.9     5.3 0.00012   23.7   1.2   19    3-21     76-94  (140)
 26 PF09142 TruB_C:  tRNA Pseudour  59.7      15 0.00033   18.3   2.6   12    9-20     32-43  (56)
 27 PRK00050 16S rRNA m(4)C1402 me  59.3     8.6 0.00019   25.4   2.1   17    4-20    221-237 (296)
 28 PF02522 Antibiotic_NAT:  Amino  59.1     8.6 0.00019   24.1   2.0   19    3-21     21-39  (229)
 29 TIGR02716 C20_methyl_CrtF C-20  59.1     8.2 0.00018   24.8   1.9   15    4-18    239-253 (306)
 30 PF01795 Methyltransf_5:  MraW   59.0     5.1 0.00011   26.7   1.0   16    4-19    226-241 (310)
 31 PRK14103 trans-aconitate 2-met  57.7     9.9 0.00021   23.7   2.1   17    4-20    111-127 (255)
 32 PRK15451 tRNA cmo(5)U34 methyl  57.4     9.2  0.0002   23.9   1.9   16    3-18    148-163 (247)
 33 KOG1270|consensus               57.4     7.5 0.00016   25.8   1.5   16    3-18    179-194 (282)
 34 PLN02233 ubiquinone biosynthes  57.0     8.9 0.00019   24.3   1.8   17    3-19    166-182 (261)
 35 PRK00377 cbiT cobalt-precorrin  56.6     9.9 0.00021   22.9   1.9   15    4-18    130-144 (198)
 36 TIGR01934 MenG_MenH_UbiE ubiqu  56.4     9.9 0.00022   22.6   1.9   16    3-18    127-142 (223)
 37 PRK10148 hypothetical protein;  56.1      14  0.0003   21.6   2.4   19    4-22    101-119 (147)
 38 PRK15068 tRNA mo(5)U34 methylt  55.0      10 0.00022   25.0   1.9   15    3-17    210-224 (322)
 39 PF11250 DUF3049:  Protein of u  54.9      27 0.00059   17.6   3.2   31    8-40     22-52  (56)
 40 PTZ00098 phosphoethanolamine N  54.4      11 0.00023   24.0   1.9   15    4-18    141-155 (263)
 41 smart00828 PKS_MT Methyltransf  53.9      12 0.00025   22.7   1.9   15    4-18     89-103 (224)
 42 PF05401 NodS:  Nodulation prot  53.7       7 0.00015   24.7   0.9   16    3-18    130-145 (201)
 43 smart00138 MeTrc Methyltransfe  53.4      11 0.00023   24.1   1.8   16    3-18    226-241 (264)
 44 PRK04266 fibrillarin; Provisio  53.1      12 0.00026   23.5   1.9   15    5-19    162-176 (226)
 45 PRK11088 rrmA 23S rRNA methylt  52.6      12 0.00025   23.8   1.8   18    3-20    165-182 (272)
 46 PRK11873 arsM arsenite S-adeno  52.6      12 0.00026   23.5   1.9   14    4-17    168-181 (272)
 47 PRK08317 hypothetical protein;  52.1      12 0.00026   22.3   1.8   17    3-19    108-124 (241)
 48 PRK08287 cobalt-precorrin-6Y C  51.9      13 0.00028   22.0   1.9   16    4-19    116-131 (187)
 49 COG1352 CheR Methylase of chem  51.3      13 0.00027   24.3   1.8   17    3-19    225-241 (268)
 50 KOG2198|consensus               51.0     9.1  0.0002   26.3   1.2   12    6-17    283-294 (375)
 51 PRK11188 rrmJ 23S rRNA methylt  50.9      14 0.00029   22.8   1.9   18    3-20    149-166 (209)
 52 TIGR02752 MenG_heptapren 2-hep  50.7      13 0.00028   22.6   1.8   16    4-19    136-151 (231)
 53 PF01209 Ubie_methyltran:  ubiE  50.4     7.8 0.00017   24.4   0.8   16    3-18    137-152 (233)
 54 PF01234 NNMT_PNMT_TEMT:  NNMT/  50.1     8.2 0.00018   25.0   0.9   18    4-21    184-201 (256)
 55 cd02440 AdoMet_MTases S-adenos  49.6      17 0.00036   17.9   1.9   15    4-18     89-103 (107)
 56 PLN02244 tocopherol O-methyltr  49.0      14 0.00031   24.4   1.8   16    4-19    208-223 (340)
 57 TIGR00477 tehB tellurite resis  48.8      15 0.00032   22.2   1.8   16    4-19    118-133 (195)
 58 PRK11036 putative S-adenosyl-L  48.6      15 0.00032   23.0   1.9   18    3-20    133-150 (255)
 59 PF11332 DUF3134:  Protein of u  48.1     4.8  0.0001   21.5  -0.4   15    3-17     22-36  (73)
 60 PRK04457 spermidine synthase;   47.9      16 0.00034   23.4   1.9   17    4-20    162-178 (262)
 61 PF12198 Tuberculin:  Theoretic  47.8      11 0.00024   17.1   0.9   10   13-22     21-30  (34)
 62 PRK10611 chemotaxis methyltran  47.2      16 0.00034   24.0   1.8   17    3-19    246-262 (287)
 63 TIGR00740 methyltransferase, p  46.6      17 0.00037   22.4   1.9   15    4-18    146-160 (239)
 64 PF03269 DUF268:  Caenorhabditi  44.9      22 0.00047   22.1   2.1   18    5-22     97-116 (177)
 65 PF11966 SSURE:  Fibronectin-bi  44.7     8.8 0.00019   20.8   0.3   12    3-14     37-48  (81)
 66 TIGR00417 speE spermidine synt  44.3      18  0.0004   23.0   1.8   17    4-20    171-187 (270)
 67 PRK01683 trans-aconitate 2-met  43.3      21 0.00046   22.1   1.9   17    3-19    114-130 (258)
 68 PRK00517 prmA ribosomal protei  42.8      21 0.00047   22.3   1.9   15    4-18    198-212 (250)
 69 PLN02396 hexaprenyldihydroxybe  42.7      21 0.00045   23.7   1.9   17    3-19    219-235 (322)
 70 PF01739 CheR:  CheR methyltran  42.3      13 0.00029   22.9   0.9   17    3-19    159-175 (196)
 71 COG4798 Predicted methyltransf  42.2      22 0.00048   22.9   1.9   15    4-18    151-165 (238)
 72 TIGR00438 rrmJ cell division p  41.7      23  0.0005   21.0   1.9   15    5-19    132-146 (188)
 73 TIGR01177 conserved hypothetic  41.7      30 0.00064   22.6   2.5   19    4-22    279-297 (329)
 74 COG2764 PhnB Uncharacterized p  41.0      34 0.00073   20.2   2.4   21    3-23     89-110 (136)
 75 PRK11207 tellurite resistance   40.5      24 0.00053   21.3   1.8   14    4-17    119-132 (197)
 76 PLN02336 phosphoethanolamine N  40.4      22 0.00049   24.2   1.8   16    3-18    353-368 (475)
 77 PF05219 DREV:  DREV methyltran  40.2      29 0.00063   22.8   2.3   18    4-21    173-190 (265)
 78 TIGR00537 hemK_rel_arch HemK-r  39.8      24 0.00053   20.7   1.8   17    5-21    126-142 (179)
 79 PRK00811 spermidine synthase;   39.6      25 0.00054   22.7   1.9   17    4-20    176-192 (283)
 80 PF02384 N6_Mtase:  N-6 DNA Met  39.3      19 0.00042   23.0   1.3   16    5-20    169-184 (311)
 81 PF11314 DUF3117:  Protein of u  39.2      20 0.00043   17.8   1.1   13    9-21     25-37  (51)
 82 PF08003 Methyltransf_9:  Prote  39.1      25 0.00054   23.7   1.8   14    4-17    204-217 (315)
 83 PRK14967 putative methyltransf  38.9      27 0.00058   21.4   1.9   17    5-21    145-161 (223)
 84 PRK09328 N5-glutamine S-adenos  38.5      33 0.00071   21.3   2.3   16    7-22    226-241 (275)
 85 cd06588 PhnB_like Escherichia   38.4      40 0.00087   18.6   2.4   20    3-22     89-108 (128)
 86 PF02381 MraZ:  MraZ protein;    38.3      44 0.00094   16.9   2.4   12    1-12     18-29  (72)
 87 TIGR03840 TMPT_Se_Te thiopurin  38.2      27 0.00059   21.6   1.8   16    3-18    136-151 (213)
 88 KOG2899|consensus               38.1      27 0.00058   23.2   1.8   14    4-17    194-207 (288)
 89 PLN02490 MPBQ/MSBQ methyltrans  37.3      28 0.00061   23.4   1.9   15    3-17    199-213 (340)
 90 TIGR00446 nop2p NOL1/NOP2/sun   37.0      27 0.00057   22.2   1.7   15    4-18    184-198 (264)
 91 TIGR00406 prmA ribosomal prote  36.8      30 0.00065   22.3   1.9   15    4-18    244-258 (288)
 92 TIGR00091 tRNA (guanine-N(7)-)  36.5      32 0.00068   20.7   1.9   17    4-20    117-133 (194)
 93 PF03492 Methyltransf_7:  SAM d  36.3      16 0.00036   24.3   0.7   14    7-20    171-184 (334)
 94 PRK09798 antitoxin MazE; Provi  36.2      39 0.00085   18.1   2.1   20    1-20     17-38  (82)
 95 PLN02781 Probable caffeoyl-CoA  35.7      32 0.00069   21.6   1.9   14    4-17    163-176 (234)
 96 PF02353 CMAS:  Mycolic acid cy  35.2      29 0.00063   22.4   1.7   13    5-17    152-164 (273)
 97 COG4122 Predicted O-methyltran  34.6      33 0.00072   21.8   1.8   15    3-17    150-164 (219)
 98 PRK00216 ubiE ubiquinone/menaq  34.5      35 0.00075   20.5   1.9   15    4-18    143-157 (239)
 99 TIGR01439 lp_hng_hel_AbrB loop  34.0      44 0.00096   14.8   1.8    7   12-18      6-12  (43)
100 COG2226 UbiE Methylase involve  33.7      34 0.00074   21.9   1.8   15    4-18    141-155 (238)
101 TIGR03534 RF_mod_PrmC protein-  33.6      44 0.00096   20.3   2.3   18    4-21    202-219 (251)
102 PRK00121 trmB tRNA (guanine-N(  33.4      38 0.00082   20.5   1.9   16    4-19    141-156 (202)
103 PRK10258 biotin biosynthesis p  33.2      36 0.00078   21.0   1.8   16    4-19    125-140 (251)
104 TIGR02072 BioC biotin biosynth  32.7      39 0.00085   20.1   1.9   16    4-19    120-135 (240)
105 PRK14968 putative methyltransf  32.2      49  0.0011   19.1   2.2   19    3-21    132-150 (188)
106 PLN02476 O-methyltransferase    31.8      40 0.00087   22.1   1.9   14    4-17    213-226 (278)
107 PRK00536 speE spermidine synth  31.7      40 0.00087   21.9   1.9   17    4-20    156-172 (262)
108 PLN02668 indole-3-acetate carb  31.1      36 0.00077   23.5   1.6   12    9-20    227-238 (386)
109 PLN02366 spermidine synthase    30.8      42 0.00091   22.2   1.9   15    4-18    191-205 (308)
110 COG2521 Predicted archaeal met  30.0      55  0.0012   21.7   2.3   20    4-23    230-249 (287)
111 PF01728 FtsJ:  FtsJ-like methy  29.9      34 0.00074   20.0   1.3   16    6-21    126-141 (181)
112 KOG1663|consensus               29.9      42 0.00091   21.8   1.7   15    3-17    167-181 (237)
113 PLN03075 nicotianamine synthas  29.9      45 0.00097   22.1   1.9   18    3-20    217-234 (296)
114 PRK14901 16S rRNA methyltransf  29.7      40 0.00086   23.0   1.7   15    4-18    369-383 (434)
115 PF04225 OapA:  Opacity-associa  29.4      99  0.0021   16.5   5.0   19    5-23     39-57  (85)
116 TIGR03438 probable methyltrans  28.7      49  0.0011   21.4   1.9   16    4-19    162-177 (301)
117 PRK01581 speE spermidine synth  28.6      48   0.001   22.8   1.9   17    4-20    253-269 (374)
118 TIGR00563 rsmB ribosomal RNA s  28.1      49  0.0011   22.5   1.9   14    5-18    354-367 (426)
119 COG2103 Predicted sugar phosph  27.8      36 0.00078   22.8   1.2   15    3-17     51-65  (298)
120 PRK10901 16S rRNA methyltransf  27.7      50  0.0011   22.5   1.9   16    4-19    357-372 (427)
121 TIGR03505 FimV_core FimV N-ter  27.6      38 0.00081   17.9   1.0   16    6-21     38-53  (74)
122 PRK11705 cyclopropane fatty ac  27.5      50  0.0011   22.4   1.9   15    4-18    252-266 (383)
123 PRK12335 tellurite resistance   27.0      54  0.0012   21.0   1.9   15    4-18    208-222 (287)
124 TIGR00536 hemK_fam HemK family  26.9      74  0.0016   20.3   2.5   18    5-22    230-247 (284)
125 PF03607 DCX:  Doublecortin;  I  26.9      52  0.0011   16.3   1.5   13    6-18     42-54  (60)
126 KOG2782|consensus               26.8      41 0.00088   22.2   1.3   14    6-19    255-268 (303)
127 TIGR03704 PrmC_rel_meth putati  26.0      79  0.0017   20.0   2.5   17    6-22    203-219 (251)
128 PF05175 MTS:  Methyltransferas  25.8      39 0.00085   19.8   1.0   17    6-22    127-143 (170)
129 COG1041 Predicted DNA modifica  25.7      58  0.0013   22.2   1.9   18    3-20    294-311 (347)
130 PRK11805 N5-glutamine S-adenos  25.7      79  0.0017   20.7   2.5   18    5-22    249-266 (307)
131 PRK03612 spermidine synthase;   25.7      56  0.0012   23.0   1.9   16    4-19    400-415 (521)
132 TIGR03533 L3_gln_methyl protei  25.4      74  0.0016   20.5   2.3   17    5-21    237-253 (284)
133 KOG4300|consensus               25.4      61  0.0013   21.1   1.9   16    4-19    167-182 (252)
134 PRK11426 hypothetical protein;  24.8      32  0.0007   20.3   0.5   15    3-17     98-112 (132)
135 PRK11933 yebU rRNA (cytosine-C  24.4      56  0.0012   23.0   1.7   12    6-17    229-240 (470)
136 PF10115 HlyU:  Transcriptional  24.3 1.4E+02   0.003   16.6   5.1   37   12-48     25-63  (91)
137 COG0144 Sun tRNA and rRNA cyto  24.3      57  0.0012   21.9   1.7   15    4-18    273-287 (355)
138 PRK05134 bifunctional 3-demeth  24.3      68  0.0015   19.5   1.9   16    4-19    136-151 (233)
139 PLN02589 caffeoyl-CoA O-methyl  23.4      69  0.0015   20.5   1.9   14    4-17    175-188 (247)
140 PF10590 PNPOx_C:  Pyridoxine 5  23.3      99  0.0021   14.5   4.4   34   12-45      2-41  (42)
141 PRK14904 16S rRNA methyltransf  23.0      69  0.0015   22.0   1.9   16    4-19    362-377 (445)
142 COG2350 Uncharacterized protei  23.0      60  0.0013   17.9   1.3   15    3-17     25-39  (92)
143 PRK06922 hypothetical protein;  22.9      67  0.0015   23.9   1.9   16    4-19    522-537 (677)
144 PF00107 ADH_zinc_N:  Zinc-bind  22.8      43 0.00094   18.1   0.8   17    4-20     74-90  (130)
145 PRK09489 rsmC 16S ribosomal RN  22.7      88  0.0019   20.9   2.3   16    5-20    289-304 (342)
146 PRK14902 16S rRNA methyltransf  22.4      65  0.0014   22.0   1.7   13    5-17    365-377 (444)
147 COG1224 TIP49 DNA helicase TIP  21.7 2.2E+02  0.0048   20.2   4.1   52    2-56    175-230 (450)
148 COG2813 RsmC 16S RNA G1207 met  21.6      76  0.0016   21.3   1.8   16    4-19     58-73  (300)
149 COG2264 PrmA Ribosomal protein  21.5      78  0.0017   21.2   1.8   15    3-17    247-261 (300)
150 COG4811 Predicted membrane pro  21.4 1.5E+02  0.0032   17.9   2.9   25    8-36    115-139 (152)
151 PLN02823 spermine synthase      21.4      79  0.0017   21.2   1.9   17    4-20    205-221 (336)
152 PF13847 Methyltransf_31:  Meth  21.3      48   0.001   18.8   0.8   16    4-19     95-110 (152)
153 PRK13255 thiopurine S-methyltr  21.2      80  0.0017   19.6   1.8   15    3-17    139-153 (218)
154 PF14315 DUF4380:  Domain of un  21.2      64  0.0014   20.7   1.4   17    6-22    147-163 (274)
155 COG0302 FolE GTP cyclohydrolas  21.1 2.2E+02  0.0047   18.0   3.7   42    1-45    133-174 (195)
156 PRK06274 indolepyruvate oxidor  20.9      88  0.0019   18.8   1.9   14    5-18     82-95  (197)
157 PRK13256 thiopurine S-methyltr  20.6      85  0.0018   19.9   1.8   17    4-20    148-164 (226)
158 PRK14903 16S rRNA methyltransf  20.4      85  0.0018   21.6   1.9   15    5-19    352-366 (431)
159 TIGR01983 UbiG ubiquinone bios  20.4      91   0.002   18.6   1.9   16    4-19    134-149 (224)
160 PF01555 N6_N4_Mtase:  DNA meth  20.3      73  0.0016   18.7   1.5   19    4-22     41-59  (231)
161 PF05195 AMP_N:  Aminopeptidase  20.3      87  0.0019   17.9   1.7   19    3-21     11-29  (134)

No 1  
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones]
Probab=99.72  E-value=3.1e-17  Score=102.23  Aligned_cols=55  Identities=47%  Similarity=0.787  Sum_probs=51.3

Q ss_pred             CcHhHHhcccCCcEEEEEeeCCCCceEEEEEEECCCCcEEEEEeeeEEEEeccCCC
Q psy5588           1 MVVELIDQLRPGGRLIIPVGPEGSAQSLEQIDKNLDGTITRTPLMQVVYVPLTDKQ   56 (61)
Q Consensus         1 iP~~l~~QL~~gGrLV~pvg~~~~~~~l~~~~r~~~g~~~~~~l~~~~fvpL~~~~   56 (61)
                      +|++|++||++|||||+|+|.. ..|++++++|++++++..+.+++|+|+||.+..
T Consensus       151 vP~~Ll~QL~~gGrlv~PvG~~-~~q~l~~~~k~~~~~~~~~~l~~v~~vPl~~~~  205 (209)
T COG2518         151 VPEALLDQLKPGGRLVIPVGSG-PAQRLLRITKDGDGNFERRDLFNVRFVPLVGGD  205 (209)
T ss_pred             CCHHHHHhcccCCEEEEEEccC-CcEEEEEEEEcCCCcEEEeeeccceeeecCCcc
Confidence            6999999999999999999954 789999999998889999999999999999955


No 2  
>PF01135 PCMT:  Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT);  InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2.1.1.77 from EC) (PCMT) [] (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyses the transfer of a methyl group from S-adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerisation of normal L-aspartyl and L-asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process; PDB: 3LBF_A 1DL5_B 1JG3_B 1JG2_A 1JG1_A 1JG4_A 2YXE_A 2PBF_B 1VBF_C 1R18_A ....
Probab=99.66  E-value=3.1e-16  Score=97.49  Aligned_cols=55  Identities=42%  Similarity=0.787  Sum_probs=45.8

Q ss_pred             CcHhHHhcccCCcEEEEEeeCCCCceEEEEEEECCCCcEEEEEeeeEEEEeccCCC
Q psy5588           1 MVVELIDQLRPGGRLIIPVGPEGSAQSLEQIDKNLDGTITRTPLMQVVYVPLTDKQ   56 (61)
Q Consensus         1 iP~~l~~QL~~gGrLV~pvg~~~~~~~l~~~~r~~~g~~~~~~l~~~~fvpL~~~~   56 (61)
                      +|++|++||++|||||+|++. +..|.+++++|.+++.++.+.+++|+|+||.+.+
T Consensus       154 ip~~l~~qL~~gGrLV~pi~~-~~~~~l~~~~k~~~g~~~~~~~~~~~fvpl~~~~  208 (209)
T PF01135_consen  154 IPEALLEQLKPGGRLVAPIGQ-GGSQRLVRITKKGDGEFSREELFPVRFVPLVGGE  208 (209)
T ss_dssp             --HHHHHTEEEEEEEEEEESS-SSSEEEEEEEEETTTEEEEEEEEEE---B-BSCC
T ss_pred             HHHHHHHhcCCCcEEEEEEcc-CCceEEEEEEEeCCCcEEEEEEeeEEEEeccCCC
Confidence            689999999999999999998 4789999999997789999999999999999864


No 3  
>KOG1661|consensus
Probab=99.37  E-value=2.1e-12  Score=81.16  Aligned_cols=60  Identities=55%  Similarity=0.873  Sum_probs=55.0

Q ss_pred             CcHhHHhcccCCcEEEEEeeCCCCceEEEEEEECCCCcEEEEEeeeEEEEeccCCCCCCC
Q psy5588           1 MVVELIDQLRPGGRLIIPVGPEGSAQSLEQIDKNLDGTITRTPLMQVVYVPLTDKQHQWP   60 (61)
Q Consensus         1 iP~~l~~QL~~gGrLV~pvg~~~~~~~l~~~~r~~~g~~~~~~l~~~~fvpL~~~~~~~~   60 (61)
                      +|++|++||++||||++|+++.+..|.+..++|..+|....+.+|.+++|||.....+|.
T Consensus       175 ~pq~l~dqL~~gGrllip~~~~~~~q~~~~~dk~~~gki~~~~~f~v~yvPlt~~~~q~~  234 (237)
T KOG1661|consen  175 LPQELLDQLKPGGRLLIPVGQDGGTQYLRQIDKNEDGKIKLRTLFSVRYVPLTSRESQPS  234 (237)
T ss_pred             cHHHHHHhhccCCeEEEeecccCceeEEEeecccccCceeeeEeeceEEEeccccccccC
Confidence            589999999999999999998667788999999888999999999999999999887775


No 4  
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase. Among the prokaryotes, the gene name is pcm. Among eukaryotes, pimt.
Probab=99.32  E-value=1.4e-11  Score=75.96  Aligned_cols=56  Identities=36%  Similarity=0.553  Sum_probs=50.6

Q ss_pred             CcHhHHhcccCCcEEEEEeeCCCCceEEEEEEECCCCcEEEEEeeeEEEEeccCCCCCC
Q psy5588           1 MVVELIDQLRPGGRLIIPVGPEGSAQSLEQIDKNLDGTITRTPLMQVVYVPLTDKQHQW   59 (61)
Q Consensus         1 iP~~l~~QL~~gGrLV~pvg~~~~~~~l~~~~r~~~g~~~~~~l~~~~fvpL~~~~~~~   59 (61)
                      +|+.+.++|++||+|++|++.  ..+++.+++|. ++.|..+.+++|.|+||.+++++|
T Consensus       159 ~~~~~~~~L~~gG~lv~~~~~--~~~~~~~~~~~-~~~~~~~~~~~~~~~pl~~~~~~~  214 (215)
T TIGR00080       159 IPEALIDQLKEGGILVMPVGE--YLQVLKRAEKR-GGEIIIKDVEPVAFVPLVGGEGFQ  214 (215)
T ss_pred             ccHHHHHhcCcCcEEEEEEcC--CceEEEEEEEe-CCEEEEEEeeeEEEEeCCCCccCC
Confidence            578899999999999999986  57899999997 567999999999999999998777


No 5  
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional
Probab=99.32  E-value=1e-11  Score=76.75  Aligned_cols=54  Identities=39%  Similarity=0.705  Sum_probs=48.3

Q ss_pred             CcHhHHhcccCCcEEEEEeeCCCCceEEEEEEECCCCcEEEEEeeeEEEEeccCCCC
Q psy5588           1 MVVELIDQLRPGGRLIIPVGPEGSAQSLEQIDKNLDGTITRTPLMQVVYVPLTDKQH   57 (61)
Q Consensus         1 iP~~l~~QL~~gGrLV~pvg~~~~~~~l~~~~r~~~g~~~~~~l~~~~fvpL~~~~~   57 (61)
                      +|+.|.+||++||+||+|++..  .+.+++++|. ++.++.+.+++|+|+||.+...
T Consensus       158 ~~~~l~~~LkpgG~lvi~~~~~--~~~~~~~~~~-~~~~~~~~~~~~~f~~~~~~~~  211 (212)
T PRK13942        158 IPKPLIEQLKDGGIMVIPVGSY--SQELIRVEKD-NGKIIKKKLGEVAFVPLIGKNG  211 (212)
T ss_pred             chHHHHHhhCCCcEEEEEEcCC--CcEEEEEEEE-CCEEEEEEeccEEEEecccCCC
Confidence            5789999999999999999863  6899999997 4679999999999999998764


No 6  
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional
Probab=99.28  E-value=2e-11  Score=75.02  Aligned_cols=51  Identities=31%  Similarity=0.556  Sum_probs=45.2

Q ss_pred             CcHhHHhcccCCcEEEEEeeCCCCceEEEEEEECCCCcEEEEEeeeEEEEecc
Q psy5588           1 MVVELIDQLRPGGRLIIPVGPEGSAQSLEQIDKNLDGTITRTPLMQVVYVPLT   53 (61)
Q Consensus         1 iP~~l~~QL~~gGrLV~pvg~~~~~~~l~~~~r~~~g~~~~~~l~~~~fvpL~   53 (61)
                      +|+.|++||++||+|++|++.. ..|.+++++|. ++.++.+.++.|+||||.
T Consensus       155 ~~~~l~~~L~~gG~lvi~~~~~-~~~~~~~~~~~-~~~~~~~~~~~~~f~pl~  205 (205)
T PRK13944        155 IPSALVRQLKDGGVLVIPVEEG-VGQVLYKVVKR-GEKVEKRAITYVLFVPLR  205 (205)
T ss_pred             hhHHHHHhcCcCcEEEEEEcCC-CceEEEEEEEe-CCEEEEEEeceEEEEecC
Confidence            4789999999999999999865 56889999997 457999999999999985


No 7  
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed
Probab=99.06  E-value=1.3e-09  Score=66.86  Aligned_cols=54  Identities=37%  Similarity=0.634  Sum_probs=47.2

Q ss_pred             CcHhHHhcccCCcEEEEEeeCCCCceEEEEEEECCCCcEEEEEeeeEEEEeccCCC
Q psy5588           1 MVVELIDQLRPGGRLIIPVGPEGSAQSLEQIDKNLDGTITRTPLMQVVYVPLTDKQ   56 (61)
Q Consensus         1 iP~~l~~QL~~gGrLV~pvg~~~~~~~l~~~~r~~~g~~~~~~l~~~~fvpL~~~~   56 (61)
                      +|+.+.++|++||+|+++++.. ..+.+.+++|. ++.+..+.+++|+|+||.++.
T Consensus       157 ~~~~l~~~L~~gG~lv~~~~~~-~~~~~~~~~~~-~~~~~~~~~~~~~~~p~~~~~  210 (212)
T PRK00312        157 IPRALLEQLKEGGILVAPVGGE-EQQLLTRVRKR-GGRFEREVLEEVRFVPLVKGE  210 (212)
T ss_pred             hhHHHHHhcCCCcEEEEEEcCC-CceEEEEEEEc-CCeEEEEEEccEEEEecCCCC
Confidence            4678999999999999999944 67889999996 667999999999999999765


No 8  
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional
Probab=98.02  E-value=2.5e-05  Score=51.45  Aligned_cols=55  Identities=18%  Similarity=0.309  Sum_probs=43.7

Q ss_pred             CcHhHHhcccCCcEEEEEeeCC-CCceEEEEEEECCCCcEEEEEeeeEEEEeccCCC
Q psy5588           1 MVVELIDQLRPGGRLIIPVGPE-GSAQSLEQIDKNLDGTITRTPLMQVVYVPLTDKQ   56 (61)
Q Consensus         1 iP~~l~~QL~~gGrLV~pvg~~-~~~~~l~~~~r~~~g~~~~~~l~~~~fvpL~~~~   56 (61)
                      +|+.++++|++||++++|+... ...+...+++|. ++.+....+++++|++..|.-
T Consensus       162 ip~~~~~~LkpgG~Lvv~~~~~l~~~~~~~~~~r~-~~~~~~~~~~~~~~l~~~G~l  217 (322)
T PRK13943        162 VPETWFTQLKEGGRVIVPINLKLSRRQPAFLFKKK-DPYLVGNYKLETRFIKAGGNL  217 (322)
T ss_pred             hHHHHHHhcCCCCEEEEEeCCccCCCCceEEEEec-CCCceEEEEEEeeEEcccchH
Confidence            4778999999999999998752 134667777887 456999999999999986643


No 9  
>PF09857 DUF2084:  Uncharacterized protein conserved in bacteria (DUF2084);  InterPro: IPR018654  This domain is found in various hypothetical bacterial proteins that have no known function. 
Probab=85.55  E-value=2.3  Score=23.42  Aligned_cols=31  Identities=19%  Similarity=0.355  Sum_probs=25.6

Q ss_pred             hHHhcccCCcEEEEEeeCCCCceEEEEEEEC
Q psy5588           4 ELIDQLRPGGRLIIPVGPEGSAQSLEQIDKN   34 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg~~~~~~~l~~~~r~   34 (61)
                      ..+.-|+.||++..--.+.+....+..+||+
T Consensus         9 R~LHvLAqGG~I~~~rd~~gri~~v~C~TRe   39 (85)
T PF09857_consen    9 RVLHVLAQGGRIRHERDDSGRITAVECYTRE   39 (85)
T ss_pred             HHHHHHhcCCeEEEEECCCCCEEEEEEEccC
Confidence            4577899999999998877667788888885


No 10 
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism]
Probab=85.39  E-value=0.5  Score=29.44  Aligned_cols=19  Identities=32%  Similarity=0.725  Sum_probs=15.8

Q ss_pred             CcHhHHhcccCCcEEEEEe
Q psy5588           1 MVVELIDQLRPGGRLIIPV   19 (61)
Q Consensus         1 iP~~l~~QL~~gGrLV~pv   19 (61)
                      |.++..+.|++|||||+=.
T Consensus       117 ile~~~~~l~~ggrlV~na  135 (187)
T COG2242         117 ILEAAWERLKPGGRLVANA  135 (187)
T ss_pred             HHHHHHHHcCcCCeEEEEe
Confidence            3567889999999999954


No 11 
>PRK13687 hypothetical protein; Provisional
Probab=85.06  E-value=2.4  Score=23.28  Aligned_cols=32  Identities=19%  Similarity=0.293  Sum_probs=26.1

Q ss_pred             HhHHhcccCCcEEEEEeeCCCCceEEEEEEEC
Q psy5588           3 VELIDQLRPGGRLIIPVGPEGSAQSLEQIDKN   34 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg~~~~~~~l~~~~r~   34 (61)
                      +..+.-|+.|||+..--.+.+....+..+||+
T Consensus         8 QRvLHvLAqGGrI~~~rd~~gri~~v~C~TRe   39 (85)
T PRK13687          8 QRTLHVLAQGGRIEHERDDSGRITAVECYTRE   39 (85)
T ss_pred             HHHHHHHhcCCeEEEEECCCCcEEEEEEEccC
Confidence            34577899999999998877667888888885


No 12 
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit. This model recognizes the CbiT methylase which is responsible, in part (along with CbiE), for methylating precorrin-6y (or cobalt-precorrin-6y) at both the 5 and 15 positions as well as the concomitant decarbozylation at C-12. In many organisms, this protein is fused to the CbiE subunit. The fused protein, when found in organisms catalyzing the oxidative version of the cobalamin biosynthesis pathway, is called CobL.
Probab=75.67  E-value=3.1  Score=22.38  Aligned_cols=17  Identities=35%  Similarity=0.831  Sum_probs=14.1

Q ss_pred             HhHHhcccCCcEEEEEe
Q psy5588           3 VELIDQLRPGGRLIIPV   19 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pv   19 (61)
                      +...+.|++||++++.+
T Consensus       106 ~~~~~~Lk~gG~li~~~  122 (124)
T TIGR02469       106 EAIWRRLRPGGRIVLNA  122 (124)
T ss_pred             HHHHHHcCCCCEEEEEe
Confidence            45778999999999865


No 13 
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only]
Probab=72.54  E-value=3  Score=27.09  Aligned_cols=19  Identities=37%  Similarity=0.641  Sum_probs=16.1

Q ss_pred             HhHHhcccCCcEEEEEeeC
Q psy5588           3 VELIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg~   21 (61)
                      +.|++||+|||.|.+-+-.
T Consensus       113 ~rL~~~L~Pgg~LAVQmPd  131 (257)
T COG4106         113 PRLVSQLAPGGVLAVQMPD  131 (257)
T ss_pred             HHHHHhhCCCceEEEECCC
Confidence            5789999999999987654


No 14 
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed
Probab=71.89  E-value=3.1  Score=25.39  Aligned_cols=20  Identities=30%  Similarity=0.582  Sum_probs=16.6

Q ss_pred             HhHHhcccCCcEEEEEeeCC
Q psy5588           3 VELIDQLRPGGRLIIPVGPE   22 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg~~   22 (61)
                      +...+.|++||++++..+..
T Consensus       129 ~~~~~~LkpGG~lv~~~~~~  148 (187)
T PRK00107        129 ELCLPLLKPGGRFLALKGRD  148 (187)
T ss_pred             HHHHHhcCCCeEEEEEeCCC
Confidence            45678999999999998764


No 15 
>COG3811 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=70.43  E-value=12  Score=20.33  Aligned_cols=32  Identities=25%  Similarity=0.406  Sum_probs=23.8

Q ss_pred             HhHHhcccCCcEEEEEeeCCCCceEEEEEEEC
Q psy5588           3 VELIDQLRPGGRLIIPVGPEGSAQSLEQIDKN   34 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg~~~~~~~l~~~~r~   34 (61)
                      +..+..|+.|||+-+--..++....+-.++|+
T Consensus         8 QRtLH~LAqGGrIe~~rd~~grI~~v~C~tRd   39 (85)
T COG3811           8 QRTLHALAQGGRIEIERDASGRITSVECYTRD   39 (85)
T ss_pred             HHHHHHHhcCCeEEEEecCCCcEEEEEEeccc
Confidence            34577899999998877665555677777775


No 16 
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane]
Probab=70.20  E-value=4  Score=27.38  Aligned_cols=18  Identities=39%  Similarity=0.602  Sum_probs=14.3

Q ss_pred             HhHHhcccCCcEEEEEee
Q psy5588           3 VELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg   20 (61)
                      +...+.|++||||++.-=
T Consensus       228 ~~a~~~L~~gGRl~VIsF  245 (314)
T COG0275         228 EAALDLLKPGGRLAVISF  245 (314)
T ss_pred             HHHHHhhCCCcEEEEEEe
Confidence            356788999999998653


No 17 
>TIGR00006 S-adenosyl-methyltransferase MraW. Genetics paper in 1972 links mra cluster to peptidoglycan biosynthesis in E. coli. Seems to be common in proteobacteria.wn.
Probab=67.49  E-value=4.9  Score=26.71  Aligned_cols=16  Identities=44%  Similarity=0.509  Sum_probs=13.2

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      ...+.|++||||++.-
T Consensus       225 ~~~~~L~~gGrl~VIS  240 (305)
T TIGR00006       225 FAPNLLAPGGRLSIIS  240 (305)
T ss_pred             HHHHHhcCCCEEEEEe
Confidence            4568899999999965


No 18 
>PF13659 Methyltransf_26:  Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A ....
Probab=66.55  E-value=4  Score=21.99  Aligned_cols=18  Identities=28%  Similarity=0.438  Sum_probs=14.4

Q ss_pred             HhHHhcccCCcEEEEEee
Q psy5588           3 VELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg   20 (61)
                      +...+.|++||++++.+.
T Consensus        99 ~~~~~~L~~gG~~~~~~~  116 (117)
T PF13659_consen   99 EAAARLLKPGGVLVFITP  116 (117)
T ss_dssp             HHHHHHEEEEEEEEEEEE
T ss_pred             HHHHHHcCCCeEEEEEeC
Confidence            356788999999998764


No 19 
>PF06859 Bin3:  Bicoid-interacting protein 3 (Bin3);  InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3). Bin3, which shows similarity to a number of protein methyltransferases that modify RNA-binding proteins, interacts with Bicoid, which itself directs pattern formation in the early Drosophila embryo. The interaction might allow Bicoid to switch between its dual roles in transcription and translation []. Note that proteins of the entry contain a conserved HLN motif.; GO: 0008168 methyltransferase activity; PDB: 3G07_B.
Probab=65.16  E-value=3.2  Score=23.83  Aligned_cols=14  Identities=50%  Similarity=0.935  Sum_probs=11.5

Q ss_pred             hHHhcccCCcEEEE
Q psy5588           4 ELIDQLRPGGRLII   17 (61)
Q Consensus         4 ~l~~QL~~gGrLV~   17 (61)
                      ...++|+|||++|+
T Consensus        29 ~~~~~L~pGG~lil   42 (110)
T PF06859_consen   29 RIYSLLRPGGILIL   42 (110)
T ss_dssp             HHHHHEEEEEEEEE
T ss_pred             HHHHhhCCCCEEEE
Confidence            45678999999987


No 20 
>PRK07402 precorrin-6B methylase; Provisional
Probab=64.73  E-value=5.8  Score=23.80  Aligned_cols=18  Identities=33%  Similarity=0.682  Sum_probs=14.4

Q ss_pred             HhHHhcccCCcEEEEEee
Q psy5588           3 VELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg   20 (61)
                      +...+.|++||++++...
T Consensus       126 ~~~~~~LkpgG~li~~~~  143 (196)
T PRK07402        126 QAVWQYLKPGGRLVATAS  143 (196)
T ss_pred             HHHHHhcCCCeEEEEEee
Confidence            456678999999999764


No 21 
>PLN02232 ubiquinone biosynthesis methyltransferase
Probab=62.86  E-value=6.5  Score=23.05  Aligned_cols=16  Identities=38%  Similarity=0.623  Sum_probs=13.0

Q ss_pred             HhHHhcccCCcEEEEE
Q psy5588           3 VELIDQLRPGGRLIIP   18 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~p   18 (61)
                      ..+.+.|+|||++++-
T Consensus        65 ~ei~rvLkpGG~l~i~   80 (160)
T PLN02232         65 KEMYRVLKPGSRVSIL   80 (160)
T ss_pred             HHHHHHcCcCeEEEEE
Confidence            3567789999999875


No 22 
>TIGR00452 methyltransferase, putative. Known examples to date are restricted to the proteobacteria.
Probab=61.91  E-value=6.7  Score=25.97  Aligned_cols=16  Identities=31%  Similarity=0.412  Sum_probs=13.1

Q ss_pred             HhHHhcccCCcEEEEE
Q psy5588           3 VELIDQLRPGGRLIIP   18 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~p   18 (61)
                      ..+.+.|++||+||+-
T Consensus       209 ~el~r~LkpGG~Lvle  224 (314)
T TIGR00452       209 KQLKHQLVIKGELVLE  224 (314)
T ss_pred             HHHHHhcCCCCEEEEE
Confidence            3567899999999973


No 23 
>PF13489 Methyltransf_23:  Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C ....
Probab=61.58  E-value=4.4  Score=22.77  Aligned_cols=19  Identities=42%  Similarity=0.597  Sum_probs=15.1

Q ss_pred             HhHHhcccCCcEEEEEeeC
Q psy5588           3 VELIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg~   21 (61)
                      ..+.+.|+|||++++-.-.
T Consensus        99 ~~l~~~LkpgG~l~~~~~~  117 (161)
T PF13489_consen   99 KELSRLLKPGGYLVISDPN  117 (161)
T ss_dssp             HHHHHCEEEEEEEEEEEEB
T ss_pred             HHHHHhcCCCCEEEEEEcC
Confidence            3577889999999997653


No 24 
>TIGR00138 gidB 16S rRNA methyltransferase GidB. GidB (glucose-inhibited division protein B) appears to be present and in a single copy in nearly all complete eubacterial genomes. It is missing only from some obligate intracellular species of various lineages (Chlamydiae, Ehrlichia, Wolbachia, Anaplasma, Buchnera, etc.). GidB shows a methytransferase fold in its the crystal structure, and acts as a 7-methylguanosine (m(7)G) methyltransferase, apparently specific to 16S rRNA.
Probab=61.14  E-value=9.5  Score=22.98  Aligned_cols=20  Identities=20%  Similarity=0.336  Sum_probs=15.6

Q ss_pred             HhHHhcccCCcEEEEEeeCC
Q psy5588           3 VELIDQLRPGGRLIIPVGPE   22 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg~~   22 (61)
                      +.+...|++||++++..+..
T Consensus       126 ~~~~~~LkpgG~lvi~~~~~  145 (181)
T TIGR00138       126 ELTLNLLKVGGYFLAYKGKK  145 (181)
T ss_pred             HHHHHhcCCCCEEEEEcCCC
Confidence            34567799999999987654


No 25 
>PF06962 rRNA_methylase:  Putative rRNA methylase;  InterPro: IPR010719 This family contains a number of putative rRNA methylases.; PDB: 3EEY_H 3LBY_A 3MTI_A.
Probab=60.87  E-value=5.3  Score=23.74  Aligned_cols=19  Identities=37%  Similarity=0.655  Sum_probs=14.4

Q ss_pred             HhHHhcccCCcEEEEEeeC
Q psy5588           3 VELIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg~   21 (61)
                      +..++.|++||+|++.+=.
T Consensus        76 ~~al~lL~~gG~i~iv~Y~   94 (140)
T PF06962_consen   76 EAALELLKPGGIITIVVYP   94 (140)
T ss_dssp             HHHHHHEEEEEEEEEEE--
T ss_pred             HHHHHhhccCCEEEEEEeC
Confidence            4568899999999998743


No 26 
>PF09142 TruB_C:  tRNA Pseudouridine synthase II, C terminal;  InterPro: IPR015225 Pseudouridine synthases catalyse the isomerisation of uridine to pseudouridine (Psi) in a variety of RNA molecules, and may function as RNA chaperones. Pseudouridine is the most abundant modified nucleotide found in all cellular RNAs. There are four distinct families of pseudouridine synthases that share no global sequence similarity, but which do share the same fold of their catalytic domain(s) and uracil-binding site and are descended from a common molecular ancestor. The catalytic domain consists of two subdomains, each of which has an alpha+beta structure that has some similarity to the ferredoxin-like fold (note: some pseudouridine synthases contain additional domains). The active site is the most conserved structural region of the superfamily and is located between the two homologous domains. These families are []:   Pseudouridine synthase I, TruA. Pseudouridine synthase II, TruB, which contains and additional C-terminal PUA domain. Pseudouridine synthase RsuA (ribosomal small subunit) and RluC/RluD (ribosomal large subunits), both of which contain an additional N-terminal alpha-L RNA-binding motif.  Pseudouridine synthase TruD, which has a natural circular permutation in the catalytic domain, as well as an insertion of a family-specific alpha+beta subdomain.    TruB is responsible for the pseudouridine residue present in the T loops of virtually all tRNAs. TruB recognises the preformed 3-D structure of the T loop primarily through shape complementarity. It accesses its substrate uridyl residue by flipping out the nucleotide and disrupts the tertiary structure of tRNA []. The C-terminal domain adopts a secondary structure consisting of a four-stranded beta sheet and one alpha helix, similar to that found in PUA domains. It is predominantly involved in RNA-binding, being mostly found in tRNA pseudouridine synthase B (TruB) []. ; GO: 0003723 RNA binding, 0009982 pseudouridine synthase activity, 0001522 pseudouridine synthesis, 0009451 RNA modification; PDB: 1SGV_B.
Probab=59.70  E-value=15  Score=18.27  Aligned_cols=12  Identities=33%  Similarity=0.706  Sum_probs=5.5

Q ss_pred             ccCCcEEEEEee
Q psy5588           9 LRPGGRLIIPVG   20 (61)
Q Consensus         9 L~~gGrLV~pvg   20 (61)
                      +.++|+||+-+.
T Consensus        32 ~~pdG~lvAL~~   43 (56)
T PF09142_consen   32 FAPDGRLVALLE   43 (56)
T ss_dssp             E-TTS-EEEEEE
T ss_pred             ECCCCcEEEEEE
Confidence            455556555554


No 27 
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional
Probab=59.27  E-value=8.6  Score=25.40  Aligned_cols=17  Identities=41%  Similarity=0.675  Sum_probs=13.4

Q ss_pred             hHHhcccCCcEEEEEee
Q psy5588           4 ELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg   20 (61)
                      ...+.|++||||++.-=
T Consensus       221 ~~~~~L~~gGrl~visf  237 (296)
T PRK00050        221 AALDLLKPGGRLAVISF  237 (296)
T ss_pred             HHHHHhcCCCEEEEEec
Confidence            34678999999998653


No 28 
>PF02522 Antibiotic_NAT:  Aminoglycoside 3-N-acetyltransferase;  InterPro: IPR003679 This family consists of bacterial aminoglycoside 3-N-acetyltransferases (2.3.1.81 from EC) that catalyse the reaction []: Acetyl-Co + a 2-deoxystreptamine antibiotic = CoA + N3'-acetyl-2-deoxystreptamine antibiotic The enzyme can use a range of antibiotics with 2-deoxystreptamine rings as acceptor for its acetyltransferase activity, this inactivates and confers resistance to gentamicin, kanamycin, tobramycin, neomycin and apramycin amongst others. For the kanamycin group antibiotics acetylation occurred at the 3"-amino group in arbekacin and amikacin, and at the 3-amino group in dibekacin as in the case of kanamycin reflecting the effect of the (S)-4-amino-2-hydroxybutyryl side chain which is present in arbekacin and amikacin, but absent in dibekacin and kanamycin [].; GO: 0046353 aminoglycoside 3-N-acetyltransferase activity, 0046677 response to antibiotic; PDB: 3SMA_D 3N0M_B 3IJW_B 3N0S_D 3SLB_C 3SLF_A 3KZL_D 3E4F_B 2NYG_E.
Probab=59.12  E-value=8.6  Score=24.14  Aligned_cols=19  Identities=26%  Similarity=0.548  Sum_probs=14.6

Q ss_pred             HhHHhcccCCcEEEEEeeC
Q psy5588           3 VELIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg~   21 (61)
                      ++|++.+.+.|.||+|--.
T Consensus        21 ~aL~~~vg~~GTlvmPt~t   39 (229)
T PF02522_consen   21 DALLEVVGPEGTLVMPTFT   39 (229)
T ss_dssp             HHHHHHHTTTSEEEEE---
T ss_pred             HHHHHHhccCCeEEEEccC
Confidence            6788999999999999643


No 29 
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU. Members of this protein family are the S-adenosylmethionine-depenedent C-20 methyltransferase BchU, part of the pathway of bacteriochlorophyll c production in photosynthetic green sulfur bacteria. The position modified by this enzyme represents the difference between bacteriochlorophylls c and d; strains lacking this protein can only produced bacteriochlorophyll d.
Probab=59.06  E-value=8.2  Score=24.80  Aligned_cols=15  Identities=47%  Similarity=0.884  Sum_probs=12.5

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      ...+.|+||||+++-
T Consensus       239 ~~~~~L~pgG~l~i~  253 (306)
T TIGR02716       239 KAFDAMRSGGRLLIL  253 (306)
T ss_pred             HHHHhcCCCCEEEEE
Confidence            456889999999885


No 30 
>PF01795 Methyltransf_5:  MraW methylase family;  InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria. The Escherichia coli protein is essential and has been linked to peptidoglycan biosynthesis [, ].; GO: 0008168 methyltransferase activity; PDB: 1N2X_A 1M6Y_A 1WG8_A 3TKA_A.
Probab=59.02  E-value=5.1  Score=26.72  Aligned_cols=16  Identities=44%  Similarity=0.794  Sum_probs=13.1

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      ...+.|++||||++.-
T Consensus       226 ~a~~~L~~gGrl~VIS  241 (310)
T PF01795_consen  226 AAPDLLKPGGRLVVIS  241 (310)
T ss_dssp             HHHHHEEEEEEEEEEE
T ss_pred             HHHHHhcCCcEEEEEE
Confidence            4567899999999864


No 31 
>PRK14103 trans-aconitate 2-methyltransferase; Provisional
Probab=57.74  E-value=9.9  Score=23.73  Aligned_cols=17  Identities=29%  Similarity=0.634  Sum_probs=13.6

Q ss_pred             hHHhcccCCcEEEEEee
Q psy5588           4 ELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg   20 (61)
                      .+.+.|+|||++++.+.
T Consensus       111 ~~~~~LkpgG~l~~~~~  127 (255)
T PRK14103        111 RWVDELAPGSWIAVQVP  127 (255)
T ss_pred             HHHHhCCCCcEEEEEcC
Confidence            46677999999998653


No 32 
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional
Probab=57.43  E-value=9.2  Score=23.92  Aligned_cols=16  Identities=31%  Similarity=0.731  Sum_probs=13.2

Q ss_pred             HhHHhcccCCcEEEEE
Q psy5588           3 VELIDQLRPGGRLIIP   18 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~p   18 (61)
                      ..+.+.|+|||++++-
T Consensus       148 ~~i~~~LkpGG~l~l~  163 (247)
T PRK15451        148 DKIYQGLNPGGALVLS  163 (247)
T ss_pred             HHHHHhcCCCCEEEEE
Confidence            4567889999999884


No 33 
>KOG1270|consensus
Probab=57.37  E-value=7.5  Score=25.77  Aligned_cols=16  Identities=44%  Similarity=0.630  Sum_probs=13.3

Q ss_pred             HhHHhcccCCcEEEEE
Q psy5588           3 VELIDQLRPGGRLIIP   18 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~p   18 (61)
                      ..+.+.|+|||||++-
T Consensus       179 ~~l~~~lkP~G~lfit  194 (282)
T KOG1270|consen  179 NCLSALLKPNGRLFIT  194 (282)
T ss_pred             HHHHHHhCCCCceEee
Confidence            3567889999999985


No 34 
>PLN02233 ubiquinone biosynthesis methyltransferase
Probab=57.00  E-value=8.9  Score=24.33  Aligned_cols=17  Identities=35%  Similarity=0.534  Sum_probs=13.6

Q ss_pred             HhHHhcccCCcEEEEEe
Q psy5588           3 VELIDQLRPGGRLIIPV   19 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pv   19 (61)
                      ..+...|+|||++++--
T Consensus       166 ~ei~rvLkpGG~l~i~d  182 (261)
T PLN02233        166 QEMYRVLKPGSRVSILD  182 (261)
T ss_pred             HHHHHHcCcCcEEEEEE
Confidence            35678899999998864


No 35 
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional
Probab=56.58  E-value=9.9  Score=22.90  Aligned_cols=15  Identities=27%  Similarity=0.643  Sum_probs=12.0

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      ...+.|++||++++-
T Consensus       130 ~~~~~LkpgG~lv~~  144 (198)
T PRK00377        130 ASWEIIKKGGRIVID  144 (198)
T ss_pred             HHHHHcCCCcEEEEE
Confidence            456789999999973


No 36 
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases. Note that a number of non-orthologous genes which are members of pfam03737 have been erroneously annotated as MenG methyltransferases.
Probab=56.36  E-value=9.9  Score=22.60  Aligned_cols=16  Identities=50%  Similarity=0.893  Sum_probs=12.7

Q ss_pred             HhHHhcccCCcEEEEE
Q psy5588           3 VELIDQLRPGGRLIIP   18 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~p   18 (61)
                      +.+...|++||++++-
T Consensus       127 ~~~~~~L~~gG~l~~~  142 (223)
T TIGR01934       127 REMYRVLKPGGRLVIL  142 (223)
T ss_pred             HHHHHHcCCCcEEEEE
Confidence            3567889999999863


No 37 
>PRK10148 hypothetical protein; Provisional
Probab=56.10  E-value=14  Score=21.63  Aligned_cols=19  Identities=16%  Similarity=0.321  Sum_probs=17.0

Q ss_pred             hHHhcccCCcEEEEEeeCC
Q psy5588           4 ELIDQLRPGGRLIIPVGPE   22 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg~~   22 (61)
                      .+.+.|+.||.+++|+.+.
T Consensus       101 ~~~~aLa~gg~v~mpl~~~  119 (147)
T PRK10148        101 RWFDNLAANGKIEMAWQET  119 (147)
T ss_pred             HHHHHhhCCCEEEecchhc
Confidence            5889999999999999875


No 38 
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional
Probab=55.02  E-value=10  Score=24.97  Aligned_cols=15  Identities=53%  Similarity=0.942  Sum_probs=12.6

Q ss_pred             HhHHhcccCCcEEEE
Q psy5588           3 VELIDQLRPGGRLII   17 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~   17 (61)
                      ..+.+.|++||++|+
T Consensus       210 ~~l~~~LkpGG~lvl  224 (322)
T PRK15068        210 KQLKDQLVPGGELVL  224 (322)
T ss_pred             HHHHHhcCCCcEEEE
Confidence            356788999999987


No 39 
>PF11250 DUF3049:  Protein of unknown function (DUF3049);  InterPro: IPR021410  This eukaryotic family of proteins has no known function. 
Probab=54.94  E-value=27  Score=17.60  Aligned_cols=31  Identities=19%  Similarity=0.370  Sum_probs=17.9

Q ss_pred             cccCCcEEEEEeeCCCCceEEEEEEECCCCcEE
Q psy5588           8 QLRPGGRLIIPVGPEGSAQSLEQIDKNLDGTIT   40 (61)
Q Consensus         8 QL~~gGrLV~pvg~~~~~~~l~~~~r~~~g~~~   40 (61)
                      .-+.+||||+=.-.- ..+.....+|. +|.+.
T Consensus        22 ~~r~dGRLvl~~v~v-~~~~~~~A~R~-~GRL~   52 (56)
T PF11250_consen   22 PHREDGRLVLEEVRV-PSHEYFHAERE-DGRLR   52 (56)
T ss_pred             EEccCCEEEEEEEEc-CCcceEEEEcc-CCEEE
Confidence            345788888743332 23556666665 66544


No 40 
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional
Probab=54.43  E-value=11  Score=23.98  Aligned_cols=15  Identities=33%  Similarity=0.592  Sum_probs=12.2

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .+.+.|+|||++++-
T Consensus       141 ~i~r~LkPGG~lvi~  155 (263)
T PTZ00098        141 KCYKWLKPNGILLIT  155 (263)
T ss_pred             HHHHHcCCCcEEEEE
Confidence            456789999999974


No 41 
>smart00828 PKS_MT Methyltransferase  in polyketide synthase (PKS) enzymes.
Probab=53.86  E-value=12  Score=22.71  Aligned_cols=15  Identities=27%  Similarity=0.729  Sum_probs=12.2

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .+.+.|+|||++++-
T Consensus        89 ~~~~~LkpgG~l~i~  103 (224)
T smart00828       89 NISRHLKDGGHLVLA  103 (224)
T ss_pred             HHHHHcCCCCEEEEE
Confidence            456789999999974


No 42 
>PF05401 NodS:  Nodulation protein S (NodS);  InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins. The products of the rhizobial nodulation genes are involved in the biosynthesis of lipochitin oligosaccharides (LCOs), which are host-specific signal molecules required for nodule formation. NodS is an S-adenosyl-L-methionine (SAM)-dependent methyltransferase involved in N methylation of LCOs. NodS uses N-deacetylated chitooligosaccharides, the products of the NodBC proteins, as its methyl acceptors [].; GO: 0008757 S-adenosylmethionine-dependent methyltransferase activity, 0009312 oligosaccharide biosynthetic process, 0009877 nodulation; PDB: 3OFK_D 3OFJ_A.
Probab=53.73  E-value=7  Score=24.68  Aligned_cols=16  Identities=38%  Similarity=0.737  Sum_probs=13.1

Q ss_pred             HhHHhcccCCcEEEEE
Q psy5588           3 VELIDQLRPGGRLIIP   18 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~p   18 (61)
                      ..+.+.|+|||.||+-
T Consensus       130 ~~l~~~L~pgG~LV~g  145 (201)
T PF05401_consen  130 DRLVAALAPGGHLVFG  145 (201)
T ss_dssp             HHHHHTEEEEEEEEEE
T ss_pred             HHHHHHhCCCCEEEEE
Confidence            3567889999999984


No 43 
>smart00138 MeTrc Methyltransferase, chemotaxis proteins. Methylates methyl-accepting chemotaxis proteins to form gamma-glutamyl methyl ester residues.
Probab=53.41  E-value=11  Score=24.11  Aligned_cols=16  Identities=31%  Similarity=0.704  Sum_probs=12.9

Q ss_pred             HhHHhcccCCcEEEEE
Q psy5588           3 VELIDQLRPGGRLIIP   18 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~p   18 (61)
                      ..+.+.|+|||.|++-
T Consensus       226 ~~l~~~L~pGG~L~lg  241 (264)
T smart00138      226 NRFAEALKPGGYLFLG  241 (264)
T ss_pred             HHHHHHhCCCeEEEEE
Confidence            3567899999999973


No 44 
>PRK04266 fibrillarin; Provisional
Probab=53.13  E-value=12  Score=23.50  Aligned_cols=15  Identities=27%  Similarity=0.432  Sum_probs=11.8

Q ss_pred             HHhcccCCcEEEEEe
Q psy5588           5 LIDQLRPGGRLIIPV   19 (61)
Q Consensus         5 l~~QL~~gGrLV~pv   19 (61)
                      +..-|+|||++++-+
T Consensus       162 ~~r~LKpGG~lvI~v  176 (226)
T PRK04266        162 AEFFLKDGGYLLLAI  176 (226)
T ss_pred             HHHhcCCCcEEEEEE
Confidence            445799999999954


No 45 
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional
Probab=52.63  E-value=12  Score=23.75  Aligned_cols=18  Identities=33%  Similarity=0.516  Sum_probs=14.7

Q ss_pred             HhHHhcccCCcEEEEEee
Q psy5588           3 VELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg   20 (61)
                      +.+...|++||++++...
T Consensus       165 ~e~~rvLkpgG~li~~~p  182 (272)
T PRK11088        165 EELARVVKPGGIVITVTP  182 (272)
T ss_pred             HHHHhhccCCCEEEEEeC
Confidence            467788999999998653


No 46 
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed
Probab=52.58  E-value=12  Score=23.52  Aligned_cols=14  Identities=50%  Similarity=0.928  Sum_probs=12.0

Q ss_pred             hHHhcccCCcEEEE
Q psy5588           4 ELIDQLRPGGRLII   17 (61)
Q Consensus         4 ~l~~QL~~gGrLV~   17 (61)
                      .+.+-|++||++++
T Consensus       168 ~~~r~LkpGG~l~i  181 (272)
T PRK11873        168 EAFRVLKPGGRFAI  181 (272)
T ss_pred             HHHHHcCCCcEEEE
Confidence            56677999999998


No 47 
>PRK08317 hypothetical protein; Provisional
Probab=52.10  E-value=12  Score=22.30  Aligned_cols=17  Identities=41%  Similarity=0.802  Sum_probs=13.5

Q ss_pred             HhHHhcccCCcEEEEEe
Q psy5588           3 VELIDQLRPGGRLIIPV   19 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pv   19 (61)
                      ..+.+.|++||++++-.
T Consensus       108 ~~~~~~L~~gG~l~~~~  124 (241)
T PRK08317        108 AEIARVLRPGGRVVVLD  124 (241)
T ss_pred             HHHHHHhcCCcEEEEEe
Confidence            45778899999998743


No 48 
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated
Probab=51.89  E-value=13  Score=22.03  Aligned_cols=16  Identities=38%  Similarity=0.781  Sum_probs=12.9

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      ...+.|++||++++-.
T Consensus       116 ~~~~~Lk~gG~lv~~~  131 (187)
T PRK08287        116 WSLAHLHPGGRLVLTF  131 (187)
T ss_pred             HHHHhcCCCeEEEEEE
Confidence            4567899999999854


No 49 
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms]
Probab=51.31  E-value=13  Score=24.30  Aligned_cols=17  Identities=35%  Similarity=0.667  Sum_probs=13.7

Q ss_pred             HhHHhcccCCcEEEEEe
Q psy5588           3 VELIDQLRPGGRLIIPV   19 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pv   19 (61)
                      ..+.++|++||.|++--
T Consensus       225 ~~f~~~L~~gG~LflG~  241 (268)
T COG1352         225 RRFADSLKPGGLLFLGH  241 (268)
T ss_pred             HHHHHHhCCCCEEEEcc
Confidence            45788999999999743


No 50 
>KOG2198|consensus
Probab=51.00  E-value=9.1  Score=26.35  Aligned_cols=12  Identities=42%  Similarity=0.836  Sum_probs=10.5

Q ss_pred             HhcccCCcEEEE
Q psy5588           6 IDQLRPGGRLII   17 (61)
Q Consensus         6 ~~QL~~gGrLV~   17 (61)
                      ++.|++||+||=
T Consensus       283 l~lLk~GG~lVY  294 (375)
T KOG2198|consen  283 LRLLKVGGRLVY  294 (375)
T ss_pred             HHHhcCCCEEEE
Confidence            578999999996


No 51 
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional
Probab=50.91  E-value=14  Score=22.79  Aligned_cols=18  Identities=33%  Similarity=0.449  Sum_probs=14.0

Q ss_pred             HhHHhcccCCcEEEEEee
Q psy5588           3 VELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg   20 (61)
                      +.+..-|++||++++-+-
T Consensus       149 ~~~~~~LkpGG~~vi~~~  166 (209)
T PRK11188        149 DMCRDVLAPGGSFVVKVF  166 (209)
T ss_pred             HHHHHHcCCCCEEEEEEe
Confidence            346678999999999554


No 52 
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase. MenG is a generic term for a methyltransferase that catalyzes the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species. Members of this MenG protein family are 2-heptaprenyl-1,4-naphthoquinone methyltransferase, and are found together in operons with the two subunits of the heptaprenyl diphosphate synthase in Bacillus subtilis and related species.
Probab=50.70  E-value=13  Score=22.58  Aligned_cols=16  Identities=25%  Similarity=0.657  Sum_probs=12.5

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .+...|++||++++.-
T Consensus       136 ~~~~~Lk~gG~l~~~~  151 (231)
T TIGR02752       136 EMYRVVKPGGKVVCLE  151 (231)
T ss_pred             HHHHHcCcCeEEEEEE
Confidence            4567899999998743


No 53 
>PF01209 Ubie_methyltran:  ubiE/COQ5 methyltransferase family;  InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities []. Apart from the ubiquinone/menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the ubiE gene of Escherichia coli), the ubiquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the COQ5 gene of Saccharomyces cerevisiae) and the menaquinone biosynthesis methyltransferases (for example, the C-methyltransferase from the MENH gene of Bacillus subtilis), this family also includes methyltransferases involved in biotin and sterol biosynthesis and in phosphatidylethanolamine methylation.; GO: 0008168 methyltransferase activity; PDB: 1VL5_C.
Probab=50.38  E-value=7.8  Score=24.43  Aligned_cols=16  Identities=50%  Similarity=0.893  Sum_probs=12.5

Q ss_pred             HhHHhcccCCcEEEEE
Q psy5588           3 VELIDQLRPGGRLIIP   18 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~p   18 (61)
                      .++..-|||||++++-
T Consensus       137 ~E~~RVLkPGG~l~il  152 (233)
T PF01209_consen  137 REMYRVLKPGGRLVIL  152 (233)
T ss_dssp             HHHHHHEEEEEEEEEE
T ss_pred             HHHHHHcCCCeEEEEe
Confidence            3566789999999874


No 54 
>PF01234 NNMT_PNMT_TEMT:  NNMT/PNMT/TEMT family;  InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. Several cytoplasmic vertebrate methyltransferases are evolutionary related [], including nicotinamide N-methyltransferase (2.1.1.1 from EC) (NNMT); phenylethanolamine N-methyltransferase (2.1.1.28 from EC) (PNMT); and thioether S-methyltransferase (2.1.1.96 from EC) (TEMT). NNMT catalyzes the N-methylation of nicotinamide and other pyridines to form pyridinium ions. This activity is important for the biotransformation of many drugs and xenobiotic compounds. PNMT catalyzes the last step in catecholamine biosynthesis, the conversion of noradrenalin to adrenalin; and TEMT catalyzes the methylation of dimethyl sulphide into trimethylsulphonium. These three enzymes use S-adenosyl-L-methionine as the methyl donor. They are proteins of 30 to 32 kDa.; GO: 0008168 methyltransferase activity; PDB: 2IIP_C 3ROD_A 2OBF_A 3HCA_B 2ONY_B 3KR1_A 2OPB_B 3KQP_B 2AN4_B 3KQM_A ....
Probab=50.06  E-value=8.2  Score=25.01  Aligned_cols=18  Identities=33%  Similarity=0.577  Sum_probs=14.5

Q ss_pred             hHHhcccCCcEEEEEeeC
Q psy5588           4 ELIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg~   21 (61)
                      .+...|||||.||+.-.-
T Consensus       184 ni~~lLkpGG~Lil~~~l  201 (256)
T PF01234_consen  184 NISSLLKPGGHLILAGVL  201 (256)
T ss_dssp             HHHTTEEEEEEEEEEEES
T ss_pred             HHHHHcCCCcEEEEEEEc
Confidence            467899999999996543


No 55 
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I;  AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy). There are at least five structurally distinct families of AdoMet-MTases, class I being the largest and most diverse. Within this class enzymes can be classified by different substrate specificities (small molecules, lipids, nucleic acids, etc.) and different target atoms for methylation (nitrogen, oxygen, carbon, sulfur, etc.).
Probab=49.62  E-value=17  Score=17.90  Aligned_cols=15  Identities=40%  Similarity=0.747  Sum_probs=11.4

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .+.+.|+++|++++-
T Consensus        89 ~~~~~l~~~g~~~~~  103 (107)
T cd02440          89 EARRLLKPGGVLVLT  103 (107)
T ss_pred             HHHHHcCCCCEEEEE
Confidence            456778999998763


No 56 
>PLN02244 tocopherol O-methyltransferase
Probab=48.98  E-value=14  Score=24.38  Aligned_cols=16  Identities=50%  Similarity=0.785  Sum_probs=13.0

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .+...|+|||++++.-
T Consensus       208 e~~rvLkpGG~lvi~~  223 (340)
T PLN02244        208 ELARVAAPGGRIIIVT  223 (340)
T ss_pred             HHHHHcCCCcEEEEEE
Confidence            5677899999999853


No 57 
>TIGR00477 tehB tellurite resistance protein TehB. Part of a tellurite-reducing operon tehA and tehB
Probab=48.76  E-value=15  Score=22.17  Aligned_cols=16  Identities=31%  Similarity=0.567  Sum_probs=11.7

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .+.+.|++||++++..
T Consensus       118 ~~~~~LkpgG~lli~~  133 (195)
T TIGR00477       118 NMQAHTRPGGYNLIVA  133 (195)
T ss_pred             HHHHHhCCCcEEEEEE
Confidence            4567789999966543


No 58 
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional
Probab=48.65  E-value=15  Score=22.97  Aligned_cols=18  Identities=39%  Similarity=0.504  Sum_probs=13.9

Q ss_pred             HhHHhcccCCcEEEEEee
Q psy5588           3 VELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg   20 (61)
                      +.+.+.|+|||++++-.-
T Consensus       133 ~~~~~~LkpgG~l~i~~~  150 (255)
T PRK11036        133 QTLWSVLRPGGALSLMFY  150 (255)
T ss_pred             HHHHHHcCCCeEEEEEEE
Confidence            356788999999987543


No 59 
>PF11332 DUF3134:  Protein of unknown function (DUF3134);  InterPro: IPR021481  This family of proteins with unknown function appears to be restricted to Cyanobacteria. 
Probab=48.09  E-value=4.8  Score=21.50  Aligned_cols=15  Identities=47%  Similarity=0.671  Sum_probs=13.1

Q ss_pred             HhHHhcccCCcEEEE
Q psy5588           3 VELIDQLRPGGRLII   17 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~   17 (61)
                      ..|++.|...||||+
T Consensus        22 ~SlLdWLe~tGRLi~   36 (73)
T PF11332_consen   22 SSLLDWLESTGRLIA   36 (73)
T ss_pred             cHHHHHHHHcCCccc
Confidence            468999999999986


No 60 
>PRK04457 spermidine synthase; Provisional
Probab=47.95  E-value=16  Score=23.35  Aligned_cols=17  Identities=12%  Similarity=0.284  Sum_probs=13.4

Q ss_pred             hHHhcccCCcEEEEEee
Q psy5588           4 ELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg   20 (61)
                      ...+.|++||++++-+.
T Consensus       162 ~~~~~L~pgGvlvin~~  178 (262)
T PRK04457        162 DCRNALSSDGIFVVNLW  178 (262)
T ss_pred             HHHHhcCCCcEEEEEcC
Confidence            44578999999999654


No 61 
>PF12198 Tuberculin:  Theoretical tuberculin protein;  InterPro: IPR022015  This domain family is found in bacteria, and is approximately 30 amino acids in length. This protein is a theoretical model of the tuberculin protein from Mycobacterium tuberculosis. 
Probab=47.81  E-value=11  Score=17.08  Aligned_cols=10  Identities=60%  Similarity=1.112  Sum_probs=8.3

Q ss_pred             cEEEEEeeCC
Q psy5588          13 GRLIIPVGPE   22 (61)
Q Consensus        13 GrLV~pvg~~   22 (61)
                      -|+|+|+|++
T Consensus        21 ~R~iA~~GP~   30 (34)
T PF12198_consen   21 MRFIAPMGPE   30 (34)
T ss_pred             eEEeeccCcc
Confidence            4899999975


No 62 
>PRK10611 chemotaxis methyltransferase CheR; Provisional
Probab=47.18  E-value=16  Score=24.03  Aligned_cols=17  Identities=24%  Similarity=0.405  Sum_probs=13.2

Q ss_pred             HhHHhcccCCcEEEEEe
Q psy5588           3 VELIDQLRPGGRLIIPV   19 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pv   19 (61)
                      ..+.+.|+|||.|++--
T Consensus       246 ~~l~~~L~pgG~L~lG~  262 (287)
T PRK10611        246 RRFVPLLKPDGLLFAGH  262 (287)
T ss_pred             HHHHHHhCCCcEEEEeC
Confidence            45788999999887544


No 63 
>TIGR00740 methyltransferase, putative. A simple BLAST search finds all members of this family and weaker hits to a large number of known and predicted methyltransferases. A single iteration with PSI-BLAST, keeping only clear members of the family, leads to a large number of highly significant hits to a set of known and predicted methyltransferases with a large repertoire of different specifities. This model is restricted to a subfamily found so far only in the Proteobacteria, sharing consistent length, full-length homology, and on average better than 35 % identity. It is reasonable to predict equivalent function within this subfamily.
Probab=46.64  E-value=17  Score=22.41  Aligned_cols=15  Identities=27%  Similarity=0.716  Sum_probs=12.3

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .+...|++||++++-
T Consensus       146 ~i~~~LkpgG~l~i~  160 (239)
T TIGR00740       146 KIYEGLNPNGVLVLS  160 (239)
T ss_pred             HHHHhcCCCeEEEEe
Confidence            466789999999884


No 64 
>PF03269 DUF268:  Caenorhabditis protein of unknown function, DUF268;  InterPro: IPR004951 This family consists of proteins of unknown function found in Caenorhabditis species.
Probab=44.87  E-value=22  Score=22.10  Aligned_cols=18  Identities=44%  Similarity=0.916  Sum_probs=13.6

Q ss_pred             HHhcccCCcEEEE--EeeCC
Q psy5588           5 LIDQLRPGGRLII--PVGPE   22 (61)
Q Consensus         5 l~~QL~~gGrLV~--pvg~~   22 (61)
                      +..-||+||+|+.  |+|.+
T Consensus        97 i~~vLK~GG~L~l~vPvG~d  116 (177)
T PF03269_consen   97 IKCVLKPGGLLFLGVPVGTD  116 (177)
T ss_pred             HHHhhccCCeEEEEeecCCc
Confidence            4567999999986  67753


No 65 
>PF11966 SSURE:  Fibronectin-binding repeat;  InterPro: IPR021021  Streptococcal surface repeat domain - SSURE - is a protein fragment found to bind to extracellular matrix protein fibronectin but not to collagen or submaxillary mucin in Streptococci. Anti-SSURE antibodies recognised the corresponding protein on the surface of streptococcal cells. The full-length proteins are thus fibronectin-binding surface adhesins []. The proteins are further characterised by having an N-terminal motif resembling [YF]SIRKxxxGxxS[VIA] IPR005877 from INTERPRO and a C-terminal LPXTG motif-containing region which is a characteristic of many surface proteins of Streptococcus and Streptomyces species. Cleavage between the Thr and Gly by sortase or a related enzyme leads to covalent anchoring at the new C-terminal Thr to the cell wall (see IPR019931 from INTERPRO). 
Probab=44.71  E-value=8.8  Score=20.79  Aligned_cols=12  Identities=50%  Similarity=0.792  Sum_probs=10.1

Q ss_pred             HhHHhcccCCcE
Q psy5588           3 VELIDQLRPGGR   14 (61)
Q Consensus         3 ~~l~~QL~~gGr   14 (61)
                      ++|++||+.+|.
T Consensus        37 q~LLDqlraNGt   48 (81)
T PF11966_consen   37 QALLDQLRANGT   48 (81)
T ss_pred             HHHHHHHHhCCc
Confidence            589999998874


No 66 
>TIGR00417 speE spermidine synthase. the SpeE subunit of spermidine synthase catalysesthe reaction (putrescine + S-adenosylmethioninamine = spermidine + 5'-methylthioadenosine) and is involved in polyamine biosynthesis and in the biosynthesis of spermidine from arganine. The region between residues 77 and 120 of the seed alignment is thought to be involved in binding to decarboxylated SAM.
Probab=44.33  E-value=18  Score=22.99  Aligned_cols=17  Identities=18%  Similarity=0.194  Sum_probs=13.5

Q ss_pred             hHHhcccCCcEEEEEee
Q psy5588           4 ELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg   20 (61)
                      .+.+.|++||++++-..
T Consensus       171 ~~~~~L~pgG~lv~~~~  187 (270)
T TIGR00417       171 LLKKALNEDGIFVAQSE  187 (270)
T ss_pred             HHHHHhCCCcEEEEcCC
Confidence            45688999999998643


No 67 
>PRK01683 trans-aconitate 2-methyltransferase; Provisional
Probab=43.28  E-value=21  Score=22.13  Aligned_cols=17  Identities=35%  Similarity=0.677  Sum_probs=13.4

Q ss_pred             HhHHhcccCCcEEEEEe
Q psy5588           3 VELIDQLRPGGRLIIPV   19 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pv   19 (61)
                      ..+.+.|++||++++-+
T Consensus       114 ~~~~~~LkpgG~~~~~~  130 (258)
T PRK01683        114 PRLVSLLAPGGVLAVQM  130 (258)
T ss_pred             HHHHHhcCCCcEEEEEC
Confidence            34667899999998854


No 68 
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed
Probab=42.78  E-value=21  Score=22.33  Aligned_cols=15  Identities=53%  Similarity=1.052  Sum_probs=12.4

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .+.+.|++||++++-
T Consensus       198 ~~~~~LkpgG~lils  212 (250)
T PRK00517        198 DLARLLKPGGRLILS  212 (250)
T ss_pred             HHHHhcCCCcEEEEE
Confidence            466779999999984


No 69 
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase
Probab=42.70  E-value=21  Score=23.75  Aligned_cols=17  Identities=18%  Similarity=0.278  Sum_probs=13.4

Q ss_pred             HhHHhcccCCcEEEEEe
Q psy5588           3 VELIDQLRPGGRLIIPV   19 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pv   19 (61)
                      ..+.+.|+|||++++-.
T Consensus       219 ~~l~r~LkPGG~liist  235 (322)
T PLN02396        219 KSLSALTIPNGATVLST  235 (322)
T ss_pred             HHHHHHcCCCcEEEEEE
Confidence            35677899999999764


No 70 
>PF01739 CheR:  CheR methyltransferase, SAM binding domain;  InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. Flagellated bacteria swim towards favourable chemicals and away from deleterious ones. Sensing of chemoeffector gradients involves chemotaxis receptors, transmembrane (TM) proteins that detect stimuli through their periplasmic domains and transduce the signals via their cytoplasmic domains []. Signalling outputs from these receptors are influenced both by the binding of the chemoeffector ligand to their periplasmic domains and by methylation of specific glutamate residues on their cytoplasmic domains. Methylation is catalysed by CheR, an S-adenosylmethionine-dependent methyltransferase [], which reversibly methylates specific glutamate residues within a coiled coil region, to form gamma-glutamyl methyl ester residues [, ]. The structure of the Salmonella typhimurium chemotaxis receptor methyltransferase CheR, bound to S-adenosylhomocysteine, has been determined to a resolution of 2.0 A []. The structure reveals CheR to be a two-domain protein, with a smaller N-terminal helical domain linked via a single polypeptide connection to a larger C-terminal alpha/beta domain. The C-terminal domain has the characteristics of a nucleotide-binding fold, with an insertion of a small anti-parallel beta-sheet subdomain. The S-adenosylhomocysteine-binding site is formed mainly by the large domain, with contributions from residues within the N-terminal domain and the linker region []. CheR proteins are part of the chemotaxis signaling mechanism which methylates the chemotaxis receptor at specific glutamate residues. This entry refers to the C-terminal SAM-binding domain of the CherR-type MCP methyltransferases, which are found in bacteria, archaea and green plants. This entry is found in association with PF03705 from PFAM. ; PDB: 1AF7_A 1BC5_A.
Probab=42.32  E-value=13  Score=22.93  Aligned_cols=17  Identities=35%  Similarity=0.589  Sum_probs=13.3

Q ss_pred             HhHHhcccCCcEEEEEe
Q psy5588           3 VELIDQLRPGGRLIIPV   19 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pv   19 (61)
                      +.+.+.|+|||.|++--
T Consensus       159 ~~l~~~L~pgG~L~lG~  175 (196)
T PF01739_consen  159 RRLHRSLKPGGYLFLGH  175 (196)
T ss_dssp             HHHGGGEEEEEEEEE-T
T ss_pred             HHHHHHcCCCCEEEEec
Confidence            45788999999999743


No 71 
>COG4798 Predicted methyltransferase [General function prediction only]
Probab=42.16  E-value=22  Score=22.90  Aligned_cols=15  Identities=27%  Similarity=0.755  Sum_probs=12.6

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      +..+.|||||.+++-
T Consensus       151 ~vf~~LKPGGv~~V~  165 (238)
T COG4798         151 AVFKALKPGGVYLVE  165 (238)
T ss_pred             HHHHhcCCCcEEEEE
Confidence            567899999999874


No 72 
>TIGR00438 rrmJ cell division protein FtsJ.
Probab=41.72  E-value=23  Score=21.01  Aligned_cols=15  Identities=27%  Similarity=0.645  Sum_probs=11.9

Q ss_pred             HHhcccCCcEEEEEe
Q psy5588           5 LIDQLRPGGRLIIPV   19 (61)
Q Consensus         5 l~~QL~~gGrLV~pv   19 (61)
                      ..+-|++||++++-+
T Consensus       132 ~~~~LkpgG~lvi~~  146 (188)
T TIGR00438       132 AKEVLKPKGNFVVKV  146 (188)
T ss_pred             HHHHccCCCEEEEEE
Confidence            466789999999843


No 73 
>TIGR01177 conserved hypothetical protein TIGR01177. This family is found exclusively in the Archaea.
Probab=41.68  E-value=30  Score=22.64  Aligned_cols=19  Identities=21%  Similarity=0.417  Sum_probs=14.7

Q ss_pred             hHHhcccCCcEEEEEeeCC
Q psy5588           4 ELIDQLRPGGRLIIPVGPE   22 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg~~   22 (61)
                      .+.+.|++||++++-+...
T Consensus       279 ~~~r~Lk~gG~lv~~~~~~  297 (329)
T TIGR01177       279 EFHEVLKSEGWIVYAVPTR  297 (329)
T ss_pred             HHHHHccCCcEEEEEEcCC
Confidence            3567899999999987643


No 74 
>COG2764 PhnB Uncharacterized protein conserved in bacteria [Function unknown]
Probab=40.99  E-value=34  Score=20.16  Aligned_cols=21  Identities=10%  Similarity=0.311  Sum_probs=18.3

Q ss_pred             HhHHhcccCCc-EEEEEeeCCC
Q psy5588           3 VELIDQLRPGG-RLIIPVGPEG   23 (61)
Q Consensus         3 ~~l~~QL~~gG-rLV~pvg~~~   23 (61)
                      ++++++|+.+| .+++|+....
T Consensus        89 da~f~~a~~aGa~v~mpl~~~f  110 (136)
T COG2764          89 DAVFERAAAAGATVVMPLEDTF  110 (136)
T ss_pred             HHHHHHHHhcCCeEEecchhcC
Confidence            57899999999 9999998764


No 75 
>PRK11207 tellurite resistance protein TehB; Provisional
Probab=40.54  E-value=24  Score=21.28  Aligned_cols=14  Identities=29%  Similarity=0.555  Sum_probs=10.6

Q ss_pred             hHHhcccCCcEEEE
Q psy5588           4 ELIDQLRPGGRLII   17 (61)
Q Consensus         4 ~l~~QL~~gGrLV~   17 (61)
                      .+.+.|++||++++
T Consensus       119 ~i~~~LkpgG~~~~  132 (197)
T PRK11207        119 NMQRCTKPGGYNLI  132 (197)
T ss_pred             HHHHHcCCCcEEEE
Confidence            46678899999654


No 76 
>PLN02336 phosphoethanolamine N-methyltransferase
Probab=40.36  E-value=22  Score=24.20  Aligned_cols=16  Identities=31%  Similarity=0.796  Sum_probs=13.0

Q ss_pred             HhHHhcccCCcEEEEE
Q psy5588           3 VELIDQLRPGGRLIIP   18 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~p   18 (61)
                      ..+...|+|||+|++-
T Consensus       353 ~~~~r~LkpgG~l~i~  368 (475)
T PLN02336        353 RSFFKWLKPGGKVLIS  368 (475)
T ss_pred             HHHHHHcCCCeEEEEE
Confidence            3567889999999874


No 77 
>PF05219 DREV:  DREV methyltransferase;  InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes. The function of this protein is unknown []. However, these proteins appear to be related to other methyltransferases.
Probab=40.25  E-value=29  Score=22.83  Aligned_cols=18  Identities=39%  Similarity=0.695  Sum_probs=13.5

Q ss_pred             hHHhcccCCcEEEEEeeC
Q psy5588           4 ELIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg~   21 (61)
                      .+.+.|+|+|+||+.+--
T Consensus       173 ~i~~~l~p~G~lilAvVl  190 (265)
T PF05219_consen  173 DIRRALKPNGRLILAVVL  190 (265)
T ss_pred             HHHHHhCCCCEEEEEEEe
Confidence            345678999999987643


No 78 
>TIGR00537 hemK_rel_arch HemK-related putative methylase. The gene hemK from E. coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase (Medline 95189105). Functional analysis of the nearest homolog in Saccharomyces cerevisiae, YNL063w, finds it is not protoporphyrinogen oxidase and sequence analysis suggests that HemK homologs have S-adenosyl-methionine-dependent methyltransferase activity (Medline 99237242). Homologs are found, usually in a single copy, in nearly all completed genomes, but varying somewhat in apparent domain architecture. This model represents an archaeal and eukaryotic protein family that lacks an N-terminal domain found in HemK and its eubacterial homologs. It is found in a single copy in the first six completed archaeal and eukaryotic genomes.
Probab=39.81  E-value=24  Score=20.70  Aligned_cols=17  Identities=29%  Similarity=0.505  Sum_probs=12.9

Q ss_pred             HHhcccCCcEEEEEeeC
Q psy5588           5 LIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         5 l~~QL~~gGrLV~pvg~   21 (61)
                      ....|++||++++....
T Consensus       126 ~~~~Lk~gG~~~~~~~~  142 (179)
T TIGR00537       126 LPEILKEGGRVQLIQSS  142 (179)
T ss_pred             HHHhhCCCCEEEEEEec
Confidence            34679999999887643


No 79 
>PRK00811 spermidine synthase; Provisional
Probab=39.62  E-value=25  Score=22.67  Aligned_cols=17  Identities=18%  Similarity=0.335  Sum_probs=13.3

Q ss_pred             hHHhcccCCcEEEEEee
Q psy5588           4 ELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg   20 (61)
                      ...+.|++||++++-.+
T Consensus       176 ~~~~~L~~gGvlv~~~~  192 (283)
T PRK00811        176 NCKRALKEDGIFVAQSG  192 (283)
T ss_pred             HHHHhcCCCcEEEEeCC
Confidence            45688999999998543


No 80 
>PF02384 N6_Mtase:  N-6 DNA Methylase;  InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2.1.1.72 from EC) from Type I and Type IC restriction systems. These enzymes are responsible for the methylation of specific DNA sequences in order to prevent the host from digesting its own genome via its restriction enzymes. These methylases have the same sequence specificity as their corresponding restriction enzymes. The type I restriction and modification system is composed of three polypeptides R, M and S. The M and S subunits together form a methyltransferase that methylates two adenine residues in complementary strands of a bipartite DNA recognition sequence. In the presence of the R subunit, the complex can also act as an endonuclease, binding to the same target sequence but cutting the DNA some distance from this site. Whether the DNA is cut or modified depends on the methylation state of the target sequence. When the target site is unmodified, the DNA is cut. When the target site is hemimethylated, the complex acts as a maintenance methyltransferase, modifying the DNA so that both strands become methylated.; GO: 0003677 DNA binding, 0008170 N-methyltransferase activity, 0006306 DNA methylation; PDB: 2F8L_A 2Y7C_C 2Y7H_C 2AR0_B 3KHK_A 3LKD_A 2OKC_B.
Probab=39.30  E-value=19  Score=23.01  Aligned_cols=16  Identities=38%  Similarity=0.673  Sum_probs=11.7

Q ss_pred             HHhcccCCcEEEEEee
Q psy5588           5 LIDQLRPGGRLIIPVG   20 (61)
Q Consensus         5 l~~QL~~gGrLV~pvg   20 (61)
                      .+++|++|||+++.+-
T Consensus       169 ~l~~Lk~~G~~~~Ilp  184 (311)
T PF02384_consen  169 ALSLLKPGGRAAIILP  184 (311)
T ss_dssp             HHHTEEEEEEEEEEEE
T ss_pred             HHhhcccccceeEEec
Confidence            4678888888777664


No 81 
>PF11314 DUF3117:  Protein of unknown function (DUF3117);  InterPro: IPR021465  This family of proteins with unknown function appears to be restricted to Actinobacteria. 
Probab=39.21  E-value=20  Score=17.80  Aligned_cols=13  Identities=46%  Similarity=1.030  Sum_probs=9.6

Q ss_pred             ccCCcEEEEEeeC
Q psy5588           9 LRPGGRLIIPVGP   21 (61)
Q Consensus         9 L~~gGrLV~pvg~   21 (61)
                      |.=|||||+=+..
T Consensus        25 leGGGRLVvEl~~   37 (51)
T PF11314_consen   25 LEGGGRLVVELNP   37 (51)
T ss_pred             cCCCcEEEEEeCH
Confidence            3458999987754


No 82 
>PF08003 Methyltransf_9:  Protein of unknown function (DUF1698);  InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals. The reaction is catalysed by methyltransferases (Mtases) and modifies DNA, RNA, proteins and small molecules, such as catechol for regulatory purposes. The various aspects of the role of DNA methylation in prokaryotic restriction-modification systems and in a number of cellular processes in eukaryotes including gene regulation and differentiation is well documented. Three classes of DNA Mtases transfer the methyl group from AdoMet to the target base to form either N-6-methyladenine, or N-4-methylcytosine, or C-5- methylcytosine. In C-5-cytosine Mtases, ten conserved motifs are arranged in the same order []. Motif I (a glycine-rich or closely related consensus sequence; FAGxGG in M.HhaI []), shared by other AdoMet-Mtases [], is part of the cofactor binding site and motif IV (PCQ) is part of the catalytic site. In contrast, sequence comparison among N-6-adenine and N-4-cytosine Mtases indicated two of the conserved segments [], although more conserved segments may be present. One of them corresponds to motif I in C-5-cytosine Mtases, and the other is named (D/N/S)PP(Y/F). Crystal structures are known for a number of Mtases [, , , ]. The cofactor binding sites are almost identical and the essential catalytic amino acids coincide. The comparable protein folding and the existence of equivalent amino acids in similar secondary and tertiary positions indicate that many (if not all) AdoMet-Mtases have a common catalytic domain structure. This permits tertiary structure prediction of other DNA, RNA, protein, and small-molecule AdoMet-Mtases from their amino acid sequences []. This entry represents a set of bacterial AdoMet-dependent tRNA (mo5U34)-methyltransferases. These enzymes catalyse the conversion of 5-hydroxyuridine (ho5U) to 5-methoxyuridine (mo5U) at the wobble position (34) of tRNA []. The 5-methoxyuridine is subsequently converted to uridine-5-oxyacetic acid, a modified nucleoside that is apparently necessary for the efficient decoding of G-ending Pro, Ala, and Val codons in these organisms [].; GO: 0016300 tRNA (uracil) methyltransferase activity, 0002098 tRNA wobble uridine modification
Probab=39.12  E-value=25  Score=23.72  Aligned_cols=14  Identities=57%  Similarity=1.149  Sum_probs=12.0

Q ss_pred             hHHhcccCCcEEEE
Q psy5588           4 ELIDQLRPGGRLII   17 (61)
Q Consensus         4 ~l~~QL~~gGrLV~   17 (61)
                      .+.++|++||.||.
T Consensus       204 ~Lk~~L~~gGeLvL  217 (315)
T PF08003_consen  204 QLKDSLRPGGELVL  217 (315)
T ss_pred             HHHHhhCCCCEEEE
Confidence            56788899999996


No 83 
>PRK14967 putative methyltransferase; Provisional
Probab=38.94  E-value=27  Score=21.40  Aligned_cols=17  Identities=29%  Similarity=0.481  Sum_probs=13.1

Q ss_pred             HHhcccCCcEEEEEeeC
Q psy5588           5 LIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         5 l~~QL~~gGrLV~pvg~   21 (61)
                      ..+.|++||++++....
T Consensus       145 a~~~Lk~gG~l~~~~~~  161 (223)
T PRK14967        145 APALLAPGGSLLLVQSE  161 (223)
T ss_pred             HHHhcCCCcEEEEEEec
Confidence            35789999999986543


No 84 
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional
Probab=38.46  E-value=33  Score=21.34  Aligned_cols=16  Identities=38%  Similarity=0.881  Sum_probs=13.7

Q ss_pred             hcccCCcEEEEEeeCC
Q psy5588           7 DQLRPGGRLIIPVGPE   22 (61)
Q Consensus         7 ~QL~~gGrLV~pvg~~   22 (61)
                      +.|++||++++.++..
T Consensus       226 ~~Lk~gG~l~~e~g~~  241 (275)
T PRK09328        226 RYLKPGGWLLLEIGYD  241 (275)
T ss_pred             HhcccCCEEEEEECch
Confidence            7899999999988753


No 85 
>cd06588 PhnB_like Escherichia coli PhnB and similar proteins; the E. coli phnB gene is found next to an operon involved in the cleavage of carbon-phosphorus bonds in unactivated alkylphosphonates. The Escherichia coli phnB gene is found next to an operon of fourteen genes (phnC-to-phnP) related to the cleavage of carbon-phosphorus (C-P) bonds in unactivated alkylphosphonates, supporting bacterial growth on alkylphosphonates as the sole phosphorus source. It was originally considered part of that operon. PhnB appears to play no direct catalytic role in the usage of alkylphosphonate. Although many of the proteins in this family have been annotated as 3-demethylubiquinone-9 3-methyltransferase enzymes by automatic annotation programs, the experimental evidence for this assignment is lacking. In Escherichia coli, the gene coding 3-demethylubiquinone-9 3-methyltransferase enzyme is ubiG, which belongs to the AdoMet-MTase protein family. PhnB-like proteins adopt a structural fold similar to 
Probab=38.40  E-value=40  Score=18.57  Aligned_cols=20  Identities=25%  Similarity=0.602  Sum_probs=16.1

Q ss_pred             HhHHhcccCCcEEEEEeeCC
Q psy5588           3 VELIDQLRPGGRLIIPVGPE   22 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg~~   22 (61)
                      +++.+.|+.||..+.|....
T Consensus        89 ~~~~~~l~~~g~~~~~~~~~  108 (128)
T cd06588          89 DRLFEALSEGGTVLMPLQKT  108 (128)
T ss_pred             HHHHHHHhcCCeEeccchhc
Confidence            46778899999999887654


No 86 
>PF02381 MraZ:  MraZ protein;  InterPro: IPR020603 this entry represents the 70 amino acid region found duplicated in the bacterial proteins MraZ. These proteins may be DNA-binding transcription factors, its members are probably enzymes containing a conserved DXXXR motif that probably forms part of the active site.; PDB: 1N0F_E 1N0E_F 1N0G_A.
Probab=38.34  E-value=44  Score=16.91  Aligned_cols=12  Identities=8%  Similarity=0.144  Sum_probs=4.8

Q ss_pred             CcHhHHhcccCC
Q psy5588           1 MVVELIDQLRPG   12 (61)
Q Consensus         1 iP~~l~~QL~~g   12 (61)
                      ||..|.++|..+
T Consensus        18 iP~~~R~~l~~~   29 (72)
T PF02381_consen   18 IPAKFREHLGIE   29 (72)
T ss_dssp             --CHHHHHTTSC
T ss_pred             cCHHHHhhhccC
Confidence            344444444444


No 87 
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family. Members of this family are thiopurine S-methyltransferase from a branch in which at least some member proteins can perform selenium methylation as a means to detoxify selenium, or perform a related detoxification of tellurium. Note that the EC number definition does not specify a particular thiopurine, but rather represents a class of activity.
Probab=38.16  E-value=27  Score=21.64  Aligned_cols=16  Identities=31%  Similarity=0.611  Sum_probs=11.9

Q ss_pred             HhHHhcccCCcEEEEE
Q psy5588           3 VELIDQLRPGGRLIIP   18 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~p   18 (61)
                      +.+.+-|+|||++++-
T Consensus       136 ~~l~~lLkpgG~~ll~  151 (213)
T TIGR03840       136 AHLLALLPPGARQLLI  151 (213)
T ss_pred             HHHHHHcCCCCeEEEE
Confidence            3577889999985553


No 88 
>KOG2899|consensus
Probab=38.14  E-value=27  Score=23.22  Aligned_cols=14  Identities=36%  Similarity=0.816  Sum_probs=11.6

Q ss_pred             hHHhcccCCcEEEE
Q psy5588           4 ELIDQLRPGGRLII   17 (61)
Q Consensus         4 ~l~~QL~~gGrLV~   17 (61)
                      .+..+|.|||+||+
T Consensus       194 kis~ll~pgGiLvv  207 (288)
T KOG2899|consen  194 KISSLLHPGGILVV  207 (288)
T ss_pred             HHHHhhCcCcEEEE
Confidence            35678999999997


No 89 
>PLN02490 MPBQ/MSBQ methyltransferase
Probab=37.30  E-value=28  Score=23.41  Aligned_cols=15  Identities=27%  Similarity=0.417  Sum_probs=12.3

Q ss_pred             HhHHhcccCCcEEEE
Q psy5588           3 VELIDQLRPGGRLII   17 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~   17 (61)
                      +.+.+.|++||++++
T Consensus       199 ~e~~rvLkPGG~LvI  213 (340)
T PLN02490        199 KEAYRVLKIGGKACL  213 (340)
T ss_pred             HHHHHhcCCCcEEEE
Confidence            356789999999876


No 90 
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase.
Probab=36.95  E-value=27  Score=22.21  Aligned_cols=15  Identities=40%  Similarity=0.818  Sum_probs=11.5

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .....|++||+||--
T Consensus       184 ~a~~~lkpgG~lvYs  198 (264)
T TIGR00446       184 SAFDALKPGGVLVYS  198 (264)
T ss_pred             HHHHhcCCCCEEEEE
Confidence            345679999999864


No 91 
>TIGR00406 prmA ribosomal protein L11 methyltransferase. Ribosomal protein L11 methyltransferase is an S-adenosyl-L-methionine-dependent methyltransferase required for the modification of ribosomal protein L11. This protein is found in bacteria and (with a probable transit peptide) in Arabidopsis.
Probab=36.83  E-value=30  Score=22.27  Aligned_cols=15  Identities=33%  Similarity=0.776  Sum_probs=12.4

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .+.+.|++||++++-
T Consensus       244 ~~~~~LkpgG~li~s  258 (288)
T TIGR00406       244 QFSRLVKPGGWLILS  258 (288)
T ss_pred             HHHHHcCCCcEEEEE
Confidence            467889999999883


No 92 
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase. In E. coli, this protein flanks the DNA repair protein MutY, also called micA.
Probab=36.47  E-value=32  Score=20.68  Aligned_cols=17  Identities=24%  Similarity=0.431  Sum_probs=13.1

Q ss_pred             hHHhcccCCcEEEEEee
Q psy5588           4 ELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg   20 (61)
                      .+...|++||++.+-..
T Consensus       117 ~~~r~LkpgG~l~~~td  133 (194)
T TIGR00091       117 EYANVLKKGGVIHFKTD  133 (194)
T ss_pred             HHHHHhCCCCEEEEEeC
Confidence            35677999999987654


No 93 
>PF03492 Methyltransf_7:  SAM dependent carboxyl methyltransferase;  InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine. Caffeine is synthesized through sequential three-step methylation of xanthine derivatives at positions 7-N, 3-N, and 1-N. The protein 7-methylxanthine methyltransferase (designated as CaMXMT) catalyses the second step to produce theobromine [].; GO: 0008168 methyltransferase activity; PDB: 2EFJ_A 1M6E_X 2EG5_C 3B5I_B.
Probab=36.32  E-value=16  Score=24.26  Aligned_cols=14  Identities=36%  Similarity=0.866  Sum_probs=11.0

Q ss_pred             hcccCCcEEEEEee
Q psy5588           7 DQLRPGGRLIIPVG   20 (61)
Q Consensus         7 ~QL~~gGrLV~pvg   20 (61)
                      +-|++||+||+-+-
T Consensus       171 ~ELv~GG~mvl~~~  184 (334)
T PF03492_consen  171 EELVPGGRMVLTFL  184 (334)
T ss_dssp             HHEEEEEEEEEEEE
T ss_pred             heeccCcEEEEEEe
Confidence            34889999999763


No 94 
>PRK09798 antitoxin MazE; Provisional
Probab=36.24  E-value=39  Score=18.12  Aligned_cols=20  Identities=15%  Similarity=0.197  Sum_probs=13.6

Q ss_pred             CcHhHHhccc--CCcEEEEEee
Q psy5588           1 MVVELIDQLR--PGGRLIIPVG   20 (61)
Q Consensus         1 iP~~l~~QL~--~gGrLV~pvg   20 (61)
                      ||.++++||.  .|-.+-+-+.
T Consensus        17 IPk~~l~~l~l~~g~~vei~v~   38 (82)
T PRK09798         17 IPATLMQALNLNIDDEVKIDLV   38 (82)
T ss_pred             cCHHHHHHcCCCCCCEEEEEEE
Confidence            7899999965  5555555554


No 95 
>PLN02781 Probable caffeoyl-CoA O-methyltransferase
Probab=35.68  E-value=32  Score=21.56  Aligned_cols=14  Identities=21%  Similarity=0.570  Sum_probs=11.4

Q ss_pred             hHHhcccCCcEEEE
Q psy5588           4 ELIDQLRPGGRLII   17 (61)
Q Consensus         4 ~l~~QL~~gGrLV~   17 (61)
                      .++..|++||.+++
T Consensus       163 ~~~~ll~~GG~ii~  176 (234)
T PLN02781        163 QLLKLVKVGGIIAF  176 (234)
T ss_pred             HHHHhcCCCeEEEE
Confidence            45678999999886


No 96 
>PF02353 CMAS:  Mycolic acid cyclopropane synthetase;  InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4). All are thought to be S-adenosyl-L-methionine (SAM) utilising methyltransferases []. Mycolic acid cyclopropane synthase or cyclopropane-fatty-acyl-phospholipid synthase (CFA synthase) 2.1.1.79 from EC catalyses the reaction:   S-adenosyl-L-methionine + phospholipid olefinic fatty acid -> S-adenosyl-L-homocysteine + phospholipid cyclopropane fatty acid.  The major mycolic acid produced by Mycobacterium tuberculosis contains two cis-cyclopropanes in the meromycolate chain. Cyclopropanation may contribute to the structural integrity of the cell wall complex [].; GO: 0008610 lipid biosynthetic process; PDB: 3HA5_A 2FK8_A 3HA7_A 3HA3_A 2FK7_A 1KPG_D 1KP9_B 1KPH_D 3VC2_E 3VC1_D ....
Probab=35.16  E-value=29  Score=22.44  Aligned_cols=13  Identities=46%  Similarity=1.055  Sum_probs=10.5

Q ss_pred             HHhcccCCcEEEE
Q psy5588           5 LIDQLRPGGRLII   17 (61)
Q Consensus         5 l~~QL~~gGrLV~   17 (61)
                      .-+-|+|||++++
T Consensus       152 ~~~~LkpgG~~~l  164 (273)
T PF02353_consen  152 ISRLLKPGGRLVL  164 (273)
T ss_dssp             HHHHSETTEEEEE
T ss_pred             HHHhcCCCcEEEE
Confidence            4467999999986


No 97 
>COG4122 Predicted O-methyltransferase [General function prediction only]
Probab=34.63  E-value=33  Score=21.76  Aligned_cols=15  Identities=33%  Similarity=0.671  Sum_probs=12.3

Q ss_pred             HhHHhcccCCcEEEE
Q psy5588           3 VELIDQLRPGGRLII   17 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~   17 (61)
                      +..++.|++||.+|+
T Consensus       150 e~~~~lLr~GGliv~  164 (219)
T COG4122         150 ERALPLLRPGGLIVA  164 (219)
T ss_pred             HHHHHHhCCCcEEEE
Confidence            346778999999998


No 98 
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed
Probab=34.53  E-value=35  Score=20.45  Aligned_cols=15  Identities=53%  Similarity=0.997  Sum_probs=12.1

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .+.+.|++||++++.
T Consensus       143 ~~~~~L~~gG~li~~  157 (239)
T PRK00216        143 EMYRVLKPGGRLVIL  157 (239)
T ss_pred             HHHHhccCCcEEEEE
Confidence            456789999999874


No 99 
>TIGR01439 lp_hng_hel_AbrB looped-hinge helix DNA binding domain, AbrB family. This DNA-binding domain family includes AbrB, a transition state regulator in Bacillus subtilis, whose DNA-binding domain structure in solution was determined by NMR. The domain binds DNA as a dimer in what is termed a looped-hinge helix fold. Some members of the family have two copies of the domain in tandem. The domain is found usually at the N-terminus of a small protein. This model excludes members of family TIGR02609.
Probab=34.01  E-value=44  Score=14.80  Aligned_cols=7  Identities=43%  Similarity=1.165  Sum_probs=3.3

Q ss_pred             CcEEEEE
Q psy5588          12 GGRLIIP   18 (61)
Q Consensus        12 gGrLV~p   18 (61)
                      .||+.+|
T Consensus         6 kgri~iP   12 (43)
T TIGR01439         6 KGQIVIP   12 (43)
T ss_pred             CCeEEec
Confidence            4444444


No 100
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism]
Probab=33.68  E-value=34  Score=21.95  Aligned_cols=15  Identities=47%  Similarity=0.970  Sum_probs=11.5

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      ++..-|+||||+++-
T Consensus       141 E~~RVlKpgG~~~vl  155 (238)
T COG2226         141 EMYRVLKPGGRLLVL  155 (238)
T ss_pred             HHHHhhcCCeEEEEE
Confidence            455679999998874


No 101
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific. Members of this protein family are HemK (PrmC), a protein once thought to be involved in heme biosynthesis but now recognized to be a protein-glutamine methyltransferase that modifies the peptide chain release factors. All members of the seed alignment are encoded next to the release factor 1 gene (prfA) and confirmed by phylogenetic analysis. SIMBAL analysis (manuscript in prep.) shows the motif [LIV]PRx[DE]TE (in Escherichia coli, IPRPDTE) confers specificity for the release factors rather than for ribosomal protein L3.
Probab=33.60  E-value=44  Score=20.32  Aligned_cols=18  Identities=33%  Similarity=0.697  Sum_probs=14.2

Q ss_pred             hHHhcccCCcEEEEEeeC
Q psy5588           4 ELIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg~   21 (61)
                      ....-|++||++++..+.
T Consensus       202 ~~~~~L~~gG~~~~~~~~  219 (251)
T TIGR03534       202 QAPRLLKPGGWLLLEIGY  219 (251)
T ss_pred             HHHHhcccCCEEEEEECc
Confidence            345578999999998864


No 102
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed
Probab=33.40  E-value=38  Score=20.54  Aligned_cols=16  Identities=25%  Similarity=0.571  Sum_probs=12.6

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .+.+-|++||++++-.
T Consensus       141 ~i~~~LkpgG~l~i~~  156 (202)
T PRK00121        141 LYARKLKPGGEIHFAT  156 (202)
T ss_pred             HHHHHcCCCCEEEEEc
Confidence            4466899999999864


No 103
>PRK10258 biotin biosynthesis protein BioC; Provisional
Probab=33.17  E-value=36  Score=21.01  Aligned_cols=16  Identities=38%  Similarity=0.677  Sum_probs=12.9

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .+.+.|++||++++..
T Consensus       125 ~~~~~Lk~gG~l~~~~  140 (251)
T PRK10258        125 ELYRVVRPGGVVAFTT  140 (251)
T ss_pred             HHHHHcCCCeEEEEEe
Confidence            4567899999999864


No 104
>TIGR02072 BioC biotin biosynthesis protein BioC. This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulfur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable). The enzyme appears related to methyltransferases by homology.
Probab=32.66  E-value=39  Score=20.13  Aligned_cols=16  Identities=44%  Similarity=0.727  Sum_probs=12.5

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .+...|++||++++-.
T Consensus       120 ~~~~~L~~~G~l~~~~  135 (240)
T TIGR02072       120 ELARVLKPGGLLAFST  135 (240)
T ss_pred             HHHHHcCCCcEEEEEe
Confidence            4567899999999743


No 105
>PRK14968 putative methyltransferase; Provisional
Probab=32.23  E-value=49  Score=19.06  Aligned_cols=19  Identities=32%  Similarity=0.590  Sum_probs=14.0

Q ss_pred             HhHHhcccCCcEEEEEeeC
Q psy5588           3 VELIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg~   21 (61)
                      +.+..-|++||++++-+..
T Consensus       132 ~~~~~~Lk~gG~~~~~~~~  150 (188)
T PRK14968        132 DEVGRYLKPGGRILLLQSS  150 (188)
T ss_pred             HHHHHhcCCCeEEEEEEcc
Confidence            3456779999999887653


No 106
>PLN02476 O-methyltransferase
Probab=31.83  E-value=40  Score=22.11  Aligned_cols=14  Identities=29%  Similarity=0.657  Sum_probs=11.8

Q ss_pred             hHHhcccCCcEEEE
Q psy5588           4 ELIDQLRPGGRLII   17 (61)
Q Consensus         4 ~l~~QL~~gGrLV~   17 (61)
                      ..++.|++||.||+
T Consensus       213 ~~l~lL~~GGvIV~  226 (278)
T PLN02476        213 LLLQLVRVGGVIVM  226 (278)
T ss_pred             HHHHhcCCCcEEEE
Confidence            45678999999998


No 107
>PRK00536 speE spermidine synthase; Provisional
Probab=31.71  E-value=40  Score=21.88  Aligned_cols=17  Identities=24%  Similarity=0.239  Sum_probs=13.7

Q ss_pred             hHHhcccCCcEEEEEee
Q psy5588           4 ELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg   20 (61)
                      .+.+.|++||.||.=-+
T Consensus       156 ~~~~~L~~~Gi~v~Qs~  172 (262)
T PRK00536        156 GLKRMLKEDGVFISVAK  172 (262)
T ss_pred             HHHHhcCCCcEEEECCC
Confidence            46788999999998544


No 108
>PLN02668 indole-3-acetate carboxyl methyltransferase
Probab=31.08  E-value=36  Score=23.47  Aligned_cols=12  Identities=17%  Similarity=0.490  Sum_probs=10.4

Q ss_pred             ccCCcEEEEEee
Q psy5588           9 LRPGGRLIIPVG   20 (61)
Q Consensus         9 L~~gGrLV~pvg   20 (61)
                      |.+||+||+-+-
T Consensus       227 LvpGG~mvl~~~  238 (386)
T PLN02668        227 MKRGGAMFLVCL  238 (386)
T ss_pred             hccCcEEEEEEe
Confidence            899999999763


No 109
>PLN02366 spermidine synthase
Probab=30.77  E-value=42  Score=22.17  Aligned_cols=15  Identities=33%  Similarity=0.625  Sum_probs=12.1

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .+.+.|++||+++.=
T Consensus       191 ~~~~~L~pgGvlv~q  205 (308)
T PLN02366        191 SVARALRPGGVVCTQ  205 (308)
T ss_pred             HHHHhcCCCcEEEEC
Confidence            456789999999873


No 110
>COG2521 Predicted archaeal methyltransferase [General function prediction only]
Probab=30.03  E-value=55  Score=21.71  Aligned_cols=20  Identities=50%  Similarity=0.722  Sum_probs=16.9

Q ss_pred             hHHhcccCCcEEEEEeeCCC
Q psy5588           4 ELIDQLRPGGRLIIPVGPEG   23 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg~~~   23 (61)
                      .+..-|++||||+=-+|..+
T Consensus       230 El~RiLkrgGrlFHYvG~Pg  249 (287)
T COG2521         230 ELYRILKRGGRLFHYVGNPG  249 (287)
T ss_pred             HHHHHcCcCCcEEEEeCCCC
Confidence            56778999999999999753


No 111
>PF01728 FtsJ:  FtsJ-like methyltransferase;  InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes. RrmJ is responsible for methylating 23 S rRNA at position U2552 in the aminoacyl (A)1-site of the ribosome []. U2552 is one of the five universally conserved A-loop residues and has been shown to be methylated at the ribose 2'-OH group in the majority of organisms investigated so far. This suggests that this modification plays an important role in the A-loop function. RrmJ recognises its methylation target only when the 23 S rRNA is present in 50 S ribosomal subunits. This suggests that the RrmJ-mediated methylation must occur late in the maturation process of the ribosome. This is in contrast to other known 23 S rRNA modifications that occur in earlier maturation steps. The 1.5 A crystal structure of RrmJ in complex with its cofactor S-adenosylmethionine revealed that RrmJ has a methyltransferase fold. The active site of RrmJ appears to be formed by a catalytic triad consisting of two lysine residues and the negatively charged aspartate residue. Another highly conserved glutamate residue that is present in the active site of RrmJ appears to play only a minor role in the methyltransfer reaction in vivo []. ; GO: 0003676 nucleic acid binding, 0008168 methyltransferase activity, 0032259 methylation; PDB: 3GCZ_A 2PLW_A 2NYU_A 2OXT_C 3EMD_A 3ELY_A 3ELW_A 3ELU_A 3ELD_A 3EMB_A ....
Probab=29.88  E-value=34  Score=20.05  Aligned_cols=16  Identities=38%  Similarity=0.777  Sum_probs=12.5

Q ss_pred             HhcccCCcEEEEEeeC
Q psy5588           6 IDQLRPGGRLIIPVGP   21 (61)
Q Consensus         6 ~~QL~~gGrLV~pvg~   21 (61)
                      ++.|++||.+|+=+=.
T Consensus       126 ~~~L~~gG~~v~K~~~  141 (181)
T PF01728_consen  126 LELLKPGGTFVIKVFK  141 (181)
T ss_dssp             HHHHCTTEEEEEEESS
T ss_pred             HhhhcCCCEEEEEecc
Confidence            4679999999986643


No 112
>KOG1663|consensus
Probab=29.86  E-value=42  Score=21.79  Aligned_cols=15  Identities=33%  Similarity=0.678  Sum_probs=13.1

Q ss_pred             HhHHhcccCCcEEEE
Q psy5588           3 VELIDQLRPGGRLII   17 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~   17 (61)
                      +.++..|++||.|++
T Consensus       167 e~~l~Llr~GGvi~~  181 (237)
T KOG1663|consen  167 ERLLRLLRVGGVIVV  181 (237)
T ss_pred             HHHHhhcccccEEEE
Confidence            567889999999998


No 113
>PLN03075 nicotianamine synthase; Provisional
Probab=29.85  E-value=45  Score=22.15  Aligned_cols=18  Identities=22%  Similarity=0.414  Sum_probs=14.2

Q ss_pred             HhHHhcccCCcEEEEEee
Q psy5588           3 VELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg   20 (61)
                      +.+.+.|++||.+++=.+
T Consensus       217 ~~l~~~LkPGG~Lvlr~~  234 (296)
T PLN03075        217 EHLGKHMAPGALLMLRSA  234 (296)
T ss_pred             HHHHHhcCCCcEEEEecc
Confidence            456778999999998553


No 114
>PRK14901 16S rRNA methyltransferase B; Provisional
Probab=29.72  E-value=40  Score=23.05  Aligned_cols=15  Identities=40%  Similarity=0.780  Sum_probs=11.6

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .....|++||+||.-
T Consensus       369 ~a~~~lkpgG~lvys  383 (434)
T PRK14901        369 SLAPLLKPGGTLVYA  383 (434)
T ss_pred             HHHHhcCCCCEEEEE
Confidence            446789999999853


No 115
>PF04225 OapA:  Opacity-associated protein A LysM-like domain;  InterPro: IPR007340 This entry includes the Haemophilus influenzae opacity-associated protein. This protein is required for efficient nasopharyngeal mucosal colonization, and its expression is associated with a distinctive transparent colony phenotype. OapA is thought to be a secreted protein, and its expression exhibits high-frequency phase variation [].; PDB: 2GU1_A.
Probab=29.37  E-value=99  Score=16.50  Aligned_cols=19  Identities=26%  Similarity=0.606  Sum_probs=10.4

Q ss_pred             HHhcccCCcEEEEEeeCCC
Q psy5588           5 LIDQLRPGGRLIIPVGPEG   23 (61)
Q Consensus         5 l~~QL~~gGrLV~pvg~~~   23 (61)
                      -+.+|+||=.|-+-+..++
T Consensus        39 ~L~~L~pGq~l~f~~d~~g   57 (85)
T PF04225_consen   39 PLTRLKPGQTLEFQLDEDG   57 (85)
T ss_dssp             -GGG--TT-EEEEEE-TTS
T ss_pred             hHhhCCCCCEEEEEECCCC
Confidence            4677888888888887653


No 116
>TIGR03438 probable methyltransferase. This model represents a distinct set of uncharacterized proteins found in the bacteria. Analysis by PSI-BLAST shows remote sequence homology to methyltransferases
Probab=28.74  E-value=49  Score=21.41  Aligned_cols=16  Identities=44%  Similarity=0.740  Sum_probs=12.9

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .+.+.|++||++++-+
T Consensus       162 ~i~~~L~pgG~~lig~  177 (301)
T TIGR03438       162 RIRQLLGPGGGLLIGV  177 (301)
T ss_pred             HHHHhcCCCCEEEEec
Confidence            4567899999999755


No 117
>PRK01581 speE spermidine synthase; Validated
Probab=28.56  E-value=48  Score=22.84  Aligned_cols=17  Identities=12%  Similarity=0.245  Sum_probs=13.0

Q ss_pred             hHHhcccCCcEEEEEee
Q psy5588           4 ELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg   20 (61)
                      .+.+.|++||++|+-.+
T Consensus       253 ~~~~~LkPgGV~V~Qs~  269 (374)
T PRK01581        253 RIATFLTEDGAFVCQSN  269 (374)
T ss_pred             HHHHhcCCCcEEEEecC
Confidence            45678999999988543


No 118
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB. The seed alignment is built from bacterial sequences only. Eukaryotic homologs include Nop2, a protein required for processing pre-rRNA, that is likely also a rRNA methyltransferase, although the fine specificity may differ. Cutoff scores are set to avoid treating archaeal and eukaroytic homologs automatically as functionally equivalent, although they may have very similar roles.
Probab=28.07  E-value=49  Score=22.51  Aligned_cols=14  Identities=29%  Similarity=0.600  Sum_probs=11.2

Q ss_pred             HHhcccCCcEEEEE
Q psy5588           5 LIDQLRPGGRLIIP   18 (61)
Q Consensus         5 l~~QL~~gGrLV~p   18 (61)
                      ....|++||+||.-
T Consensus       354 a~~~LkpgG~lvys  367 (426)
T TIGR00563       354 IWPLLKTGGTLVYA  367 (426)
T ss_pred             HHHhcCCCcEEEEE
Confidence            45569999999975


No 119
>COG2103 Predicted sugar phosphate isomerase [General function prediction only]
Probab=27.82  E-value=36  Score=22.76  Aligned_cols=15  Identities=40%  Similarity=0.614  Sum_probs=12.1

Q ss_pred             HhHHhcccCCcEEEE
Q psy5588           3 VELIDQLRPGGRLII   17 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~   17 (61)
                      +...++|+.||||+-
T Consensus        51 ~~~~~~l~~GGRLiY   65 (298)
T COG2103          51 DIIAAALKQGGRLIY   65 (298)
T ss_pred             HHHHHHHHcCCeEEE
Confidence            345789999999975


No 120
>PRK10901 16S rRNA methyltransferase B; Provisional
Probab=27.70  E-value=50  Score=22.50  Aligned_cols=16  Identities=38%  Similarity=0.700  Sum_probs=11.9

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .....|++||+||.-.
T Consensus       357 ~a~~~LkpGG~lvyst  372 (427)
T PRK10901        357 ALWPLLKPGGTLLYAT  372 (427)
T ss_pred             HHHHhcCCCCEEEEEe
Confidence            3446799999999643


No 121
>TIGR03505 FimV_core FimV N-terminal domain. This region is found at, or about 200 amino acids from, the N-terminus of FimV from Pseudomonas aeruginosa, TspA of Neisseria meningitidis, and related proteins. Disruption of FimV blocks twitching motility from type IV pili; Semmler, et al. suggest a role for this family in peptidoglycan layer remodelling required by type IV fimbrial systems. Most but not all members of this protein family have a C-terminal region recognized by TIGR03504. In between is a highly variable, often repeat-filled region rich in the negatively charged amino acids Asp and Glu.
Probab=27.61  E-value=38  Score=17.87  Aligned_cols=16  Identities=38%  Similarity=0.557  Sum_probs=13.0

Q ss_pred             HhcccCCcEEEEEeeC
Q psy5588           6 IDQLRPGGRLIIPVGP   21 (61)
Q Consensus         6 ~~QL~~gGrLV~pvg~   21 (61)
                      ++.|+.|-.|.+|-..
T Consensus        38 in~L~~G~~L~iP~~~   53 (74)
T TIGR03505        38 INRLKVGQILRIPSEE   53 (74)
T ss_pred             hhhcCCCCEEeCCCHH
Confidence            4689999999999753


No 122
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional
Probab=27.53  E-value=50  Score=22.35  Aligned_cols=15  Identities=20%  Similarity=0.448  Sum_probs=12.0

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .+.+.|+|||++++-
T Consensus       252 ~i~r~LkpGG~lvl~  266 (383)
T PRK11705        252 VVRRCLKPDGLFLLH  266 (383)
T ss_pred             HHHHHcCCCcEEEEE
Confidence            345689999999985


No 123
>PRK12335 tellurite resistance protein TehB; Provisional
Probab=26.99  E-value=54  Score=20.97  Aligned_cols=15  Identities=27%  Similarity=0.572  Sum_probs=11.1

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      .+.+.|++||++++.
T Consensus       208 ~~~~~LkpgG~~l~v  222 (287)
T PRK12335        208 NMQEHTNPGGYNLIV  222 (287)
T ss_pred             HHHHhcCCCcEEEEE
Confidence            456778999996653


No 124
>TIGR00536 hemK_fam HemK family putative methylases. The gene hemK from E. coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase (Medline 95189105). Functional analysis of the nearest homolog in Saccharomyces cerevisiae, YNL063w, finds it is not protoporphyrinogen oxidase and sequence analysis suggests that HemK homologs have S-adenosyl-methionine-dependent methyltransferase activity (Medline 99237242). Homologs are found, usually in a single copy, in nearly all completed genomes, but varying somewhat in apparent domain architecture. Both E. coli and H. influenzae have two members rather than one. The members from the Mycoplasmas have an additional C-terminal domain.
Probab=26.87  E-value=74  Score=20.35  Aligned_cols=18  Identities=33%  Similarity=0.506  Sum_probs=14.5

Q ss_pred             HHhcccCCcEEEEEeeCC
Q psy5588           5 LIDQLRPGGRLIIPVGPE   22 (61)
Q Consensus         5 l~~QL~~gGrLV~pvg~~   22 (61)
                      ..+.|++||+|++-++..
T Consensus       230 a~~~L~~gG~l~~e~g~~  247 (284)
T TIGR00536       230 APDYLKPNGFLVCEIGNW  247 (284)
T ss_pred             HHHhccCCCEEEEEECcc
Confidence            345799999999999854


No 125
>PF03607 DCX:  Doublecortin;  InterPro: IPR003533  X-linked lissencephaly is a severe brain malformation affecting males. Recently it has been demonstrated that the doublecortin gene is implicated in this disorder []. Doublecortin was found to bind to the microtubule cytoskeleton. In vivo and in vitro assays show that Doublecortin stabilises microtubules and causes bundling []. Doublecortin is a basic protein with an iso-electric point of 10, typical of microtubule-binding proteins. However, its sequence contains no known microtubule-binding domain(s).   The detailed sequence analysis of Doublecortin and Doublecortin-like proteins allowed the identification of an evolutionarily conserved Doublecortin (DC) domain. This domain is found in the N terminus of proteins and consists of one or two tandemly repeated copies of an around 80 amino acids region. It has been suggested that the first DC domain of Doublecortin binds tubulin and enhances microtubule polymerisation [].  Some proteins known to contain a DC domain are listed below:  Doublecortin. It is required for neuronal migration []. A large number of point mutations in the human DCX gene leading to lissencephaly are located within the DC domains []. Human serine/threonine-protein kinase DCAMKL1. It is a probable kinase that may be involved in a calcium-signaling pathway controling neuronal migration in the developing brain []. Retinitis pigmentosa 1 protein. It could play a role in the differentiation of photoreceptor cells. Mutation in the human RP1 gene cause retinitis pigmentosa of type 1 [].  ; GO: 0035556 intracellular signal transduction; PDB: 1UF0_A 1MG4_A 1MFW_A 2DNF_A 2XRP_I 2BQQ_A 1MJD_A.
Probab=26.86  E-value=52  Score=16.33  Aligned_cols=13  Identities=31%  Similarity=0.733  Sum_probs=9.4

Q ss_pred             HhcccCCcEEEEE
Q psy5588           6 IDQLRPGGRLIIP   18 (61)
Q Consensus         6 ~~QL~~gGrLV~p   18 (61)
                      +++|.+|+..||-
T Consensus        42 l~~l~dg~~yVa~   54 (60)
T PF03607_consen   42 LDELEDGGSYVAS   54 (60)
T ss_dssp             GGGS-TTEEEEEE
T ss_pred             HHHHCCCCEEEEE
Confidence            4678889888876


No 126
>KOG2782|consensus
Probab=26.84  E-value=41  Score=22.19  Aligned_cols=14  Identities=50%  Similarity=0.852  Sum_probs=11.5

Q ss_pred             HhcccCCcEEEEEe
Q psy5588           6 IDQLRPGGRLIIPV   19 (61)
Q Consensus         6 ~~QL~~gGrLV~pv   19 (61)
                      .++|+++|||++.-
T Consensus       255 ~~vl~~~grl~~is  268 (303)
T KOG2782|consen  255 FDVLAPGGRLAVIS  268 (303)
T ss_pred             ccccCCCccEEEEE
Confidence            47899999999864


No 127
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific. This protein family is closely related to two different families of protein-(glutamine-N5) methyltransferase. The first is PrmB, which modifies ribosomal protein L3 in some bacteria. The second is PrmC (HemK), which modifies peptide chain release factors 1 and 2 in most bacteria and also in eukaryotes. The glutamine side chain-binding motif NPPY shared by PrmB and PrmC is N[VAT]PY in this family. The protein substrate is unknown.
Probab=26.03  E-value=79  Score=19.98  Aligned_cols=17  Identities=35%  Similarity=0.665  Sum_probs=14.0

Q ss_pred             HhcccCCcEEEEEeeCC
Q psy5588           6 IDQLRPGGRLIIPVGPE   22 (61)
Q Consensus         6 ~~QL~~gGrLV~pvg~~   22 (61)
                      .+.|++||++++-.+..
T Consensus       203 ~~~L~~gG~l~l~~~~~  219 (251)
T TIGR03704       203 PDWLAPGGHLLVETSER  219 (251)
T ss_pred             HHhcCCCCEEEEEECcc
Confidence            36799999999988754


No 128
>PF05175 MTS:  Methyltransferase small domain;  InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases.; GO: 0008168 methyltransferase activity; PDB: 1WY7_A 1DUS_A 2OZV_A 2PJD_A 1VQ1_A 1NV9_A 1SG9_C 1NV8_A 3Q87_B 3DMF_A ....
Probab=25.76  E-value=39  Score=19.81  Aligned_cols=17  Identities=35%  Similarity=0.747  Sum_probs=13.2

Q ss_pred             HhcccCCcEEEEEeeCC
Q psy5588           6 IDQLRPGGRLIIPVGPE   22 (61)
Q Consensus         6 ~~QL~~gGrLV~pvg~~   22 (61)
                      .+-|++||+|++.....
T Consensus       127 ~~~Lk~~G~l~lv~~~~  143 (170)
T PF05175_consen  127 RRYLKPGGRLFLVINSH  143 (170)
T ss_dssp             HHHEEEEEEEEEEEETT
T ss_pred             HHhccCCCEEEEEeecC
Confidence            46799999998877643


No 129
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair]
Probab=25.70  E-value=58  Score=22.24  Aligned_cols=18  Identities=28%  Similarity=0.637  Sum_probs=15.1

Q ss_pred             HhHHhcccCCcEEEEEee
Q psy5588           3 VELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg   20 (61)
                      +.+.+-|++||++|++.-
T Consensus       294 e~~~evLk~gG~~vf~~p  311 (347)
T COG1041         294 ESASEVLKPGGRIVFAAP  311 (347)
T ss_pred             HHHHHHhhcCcEEEEecC
Confidence            456788999999999876


No 130
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional
Probab=25.70  E-value=79  Score=20.70  Aligned_cols=18  Identities=33%  Similarity=0.486  Sum_probs=14.4

Q ss_pred             HHhcccCCcEEEEEeeCC
Q psy5588           5 LIDQLRPGGRLIIPVGPE   22 (61)
Q Consensus         5 l~~QL~~gGrLV~pvg~~   22 (61)
                      ..+.|++||++++=++..
T Consensus       249 a~~~L~pgG~l~~E~g~~  266 (307)
T PRK11805        249 APDYLTEDGVLVVEVGNS  266 (307)
T ss_pred             HHHhcCCCCEEEEEECcC
Confidence            446899999999988753


No 131
>PRK03612 spermidine synthase; Provisional
Probab=25.67  E-value=56  Score=23.05  Aligned_cols=16  Identities=31%  Similarity=0.517  Sum_probs=13.0

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      ...+.|+|||++++-.
T Consensus       400 ~~~~~L~pgG~lv~~~  415 (521)
T PRK03612        400 LLKRRLAPDGLLVVQS  415 (521)
T ss_pred             HHHHhcCCCeEEEEec
Confidence            4577899999999844


No 132
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific. Members of this protein family methylate ribosomal protein L3 on a glutamine side chain. This family is related to HemK, a protein-glutamine methyltranferase for peptide chain release factors.
Probab=25.45  E-value=74  Score=20.50  Aligned_cols=17  Identities=35%  Similarity=0.618  Sum_probs=13.9

Q ss_pred             HHhcccCCcEEEEEeeC
Q psy5588           5 LIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         5 l~~QL~~gGrLV~pvg~   21 (61)
                      ..+.|++||++++=++.
T Consensus       237 a~~~L~~gG~l~~e~g~  253 (284)
T TIGR03533       237 AADHLNENGVLVVEVGN  253 (284)
T ss_pred             HHHhcCCCCEEEEEECc
Confidence            35689999999988874


No 133
>KOG4300|consensus
Probab=25.44  E-value=61  Score=21.14  Aligned_cols=16  Identities=50%  Similarity=0.804  Sum_probs=12.1

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      ..-.-|+||||++..-
T Consensus       167 e~~rlLRpgG~iifiE  182 (252)
T KOG4300|consen  167 EVRRLLRPGGRIIFIE  182 (252)
T ss_pred             HHHHhcCCCcEEEEEe
Confidence            3456799999999853


No 134
>PRK11426 hypothetical protein; Provisional
Probab=24.79  E-value=32  Score=20.34  Aligned_cols=15  Identities=33%  Similarity=0.567  Sum_probs=11.9

Q ss_pred             HhHHhcccCCcEEEE
Q psy5588           3 VELIDQLRPGGRLII   17 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~   17 (61)
                      +.++++|.|+|++-.
T Consensus        98 P~~VDklTP~G~lp~  112 (132)
T PRK11426         98 PKIIDALSPQGEVSP  112 (132)
T ss_pred             HHHHhccCCCCCCCc
Confidence            467899999998743


No 135
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed
Probab=24.36  E-value=56  Score=23.00  Aligned_cols=12  Identities=42%  Similarity=0.969  Sum_probs=9.4

Q ss_pred             HhcccCCcEEEE
Q psy5588           6 IDQLRPGGRLII   17 (61)
Q Consensus         6 ~~QL~~gGrLV~   17 (61)
                      .+.|++||+||=
T Consensus       229 ~~~LkpGG~LVY  240 (470)
T PRK11933        229 FHALKPGGTLVY  240 (470)
T ss_pred             HHHcCCCcEEEE
Confidence            467899999865


No 136
>PF10115 HlyU:  Transcriptional activator HlyU;  InterPro: IPR018772  This is a family of hypothetical prokaryotic proteins, with no known function. One of the proteins in this entry corresponds to the transcriptional activator HlyU, indicating a possible similar role in other members. 
Probab=24.33  E-value=1.4e+02  Score=16.57  Aligned_cols=37  Identities=24%  Similarity=0.428  Sum_probs=24.8

Q ss_pred             CcEEEEE--eeCCCCceEEEEEEECCCCcEEEEEeeeEE
Q psy5588          12 GGRLIIP--VGPEGSAQSLEQIDKNLDGTITRTPLMQVV   48 (61)
Q Consensus        12 gGrLV~p--vg~~~~~~~l~~~~r~~~g~~~~~~l~~~~   48 (61)
                      .|.+|.|  ...+++.+..-+++|..+|+..+..+...-
T Consensus        25 kgf~I~~~P~~egGQfRvag~I~K~~~ge~k~H~FIRsD   63 (91)
T PF10115_consen   25 KGFLIYPEPMSEGGQFRVAGRIEKEIDGETKTHRFIRSD   63 (91)
T ss_pred             CCEEEEeCccccCCceeEEEEEEeccCCcEEEEEEEEcc
Confidence            4667764  555555678888999878876666655443


No 137
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis]
Probab=24.32  E-value=57  Score=21.88  Aligned_cols=15  Identities=33%  Similarity=0.729  Sum_probs=11.5

Q ss_pred             hHHhcccCCcEEEEE
Q psy5588           4 ELIDQLRPGGRLIIP   18 (61)
Q Consensus         4 ~l~~QL~~gGrLV~p   18 (61)
                      +-++-|++||+||--
T Consensus       273 ~a~~~lk~GG~LVYS  287 (355)
T COG0144         273 AALKLLKPGGVLVYS  287 (355)
T ss_pred             HHHHhcCCCCEEEEE
Confidence            345678999999963


No 138
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional
Probab=24.29  E-value=68  Score=19.47  Aligned_cols=16  Identities=19%  Similarity=0.499  Sum_probs=12.0

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .+..-|++||++++-.
T Consensus       136 ~~~~~L~~gG~l~v~~  151 (233)
T PRK05134        136 ACAKLVKPGGLVFFST  151 (233)
T ss_pred             HHHHHcCCCcEEEEEe
Confidence            4456789999998643


No 139
>PLN02589 caffeoyl-CoA O-methyltransferase
Probab=23.43  E-value=69  Score=20.53  Aligned_cols=14  Identities=36%  Similarity=0.548  Sum_probs=11.7

Q ss_pred             hHHhcccCCcEEEE
Q psy5588           4 ELIDQLRPGGRLII   17 (61)
Q Consensus         4 ~l~~QL~~gGrLV~   17 (61)
                      ..+..|++||.+|+
T Consensus       175 ~~l~ll~~GGviv~  188 (247)
T PLN02589        175 RLIDLVKVGGVIGY  188 (247)
T ss_pred             HHHHhcCCCeEEEE
Confidence            45688999999987


No 140
>PF10590 PNPOx_C:  Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region;  InterPro: IPR019576  Pyridoxamine 5'-phosphate oxidase (1.4.3.5 from EC) is an enzyme that is involved in the de novo synthesis of pyridoxine (vitamin B6) and pyridoxal phosphate. It oxidizes pyridoxamine-5-P (PMP) and pyridoxine-5-P (PNP) to pyridoxal-5-P. The enzyme requires the presence of flavin mononucleotide (FMN) as a cofactor, although there is some evidence that coenzyme F420 may perform this role in some species [].  The sequences of the enzyme from bacterial (genes pdxH or fprA) [] and fungal (gene PDX3) [] sources show that this protein has been highly conserved throughout evolution. PdxH is evolutionary related [] to one of the enzymes in the phenazine biosynthesis protein pathway, phzD (also known as phzG).  This entry represents one of the two dimerisation regions of the protein, located at the edge of the dimer interface, at the C terminus, being the last three beta strands, S6, S7, and S8 along with the last three residues to the end. In P21159 from SWISSPROT, S6 runs from residues 178-192, S7 from 200-206 and S8 from 211-215. the extended loop, of residues 167-177 may well be involved in the pocket formed between the two dimers that positions the FMN molecule []. ; GO: 0016638 oxidoreductase activity, acting on the CH-NH2 group of donors, 0055114 oxidation-reduction process; PDB: 1WV4_B 1DNL_A 1G76_A 1G79_A 1G77_A 1JNW_A 1G78_A 1TY9_A 1CI0_A 1NRG_A ....
Probab=23.32  E-value=99  Score=14.49  Aligned_cols=34  Identities=21%  Similarity=0.321  Sum_probs=19.3

Q ss_pred             CcEEEEEee------CCCCceEEEEEEECCCCcEEEEEee
Q psy5588          12 GGRLIIPVG------PEGSAQSLEQIDKNLDGTITRTPLM   45 (61)
Q Consensus        12 gGrLV~pvg------~~~~~~~l~~~~r~~~g~~~~~~l~   45 (61)
                      ||-.|.|..      .......=++++|++++.++.+.|.
T Consensus         2 gGy~l~P~~iEFWqg~~~RlHdR~~y~r~~~~~W~~~rL~   41 (42)
T PF10590_consen    2 GGYRLVPEEIEFWQGRPDRLHDRIRYTRDEDGGWTKERLQ   41 (42)
T ss_dssp             EEEEEEECEEEEEEEETTSEEEEEEEEEETTTCEEEEEE-
T ss_pred             CeEEEEcCEEEEeCCCCCCCEEEEEEEecCCCCEEEEEEc
Confidence            456666652      2223345556777656668887764


No 141
>PRK14904 16S rRNA methyltransferase B; Provisional
Probab=23.02  E-value=69  Score=21.97  Aligned_cols=16  Identities=31%  Similarity=0.615  Sum_probs=12.4

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .....|++||+||.-.
T Consensus       362 ~a~~~lkpgG~lvyst  377 (445)
T PRK14904        362 HAASLLKPGGVLVYAT  377 (445)
T ss_pred             HHHHhcCCCcEEEEEe
Confidence            3456789999999854


No 142
>COG2350 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=23.01  E-value=60  Score=17.88  Aligned_cols=15  Identities=33%  Similarity=0.552  Sum_probs=13.2

Q ss_pred             HhHHhcccCCcEEEE
Q psy5588           3 VELIDQLRPGGRLII   17 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~   17 (61)
                      -++++||..-|||++
T Consensus        25 ~~~L~~~~a~G~ll~   39 (92)
T COG2350          25 LARLKQLYAEGRLLT   39 (92)
T ss_pred             HHHHHHhhhcCeEEE
Confidence            468999999999998


No 143
>PRK06922 hypothetical protein; Provisional
Probab=22.87  E-value=67  Score=23.93  Aligned_cols=16  Identities=44%  Similarity=0.806  Sum_probs=12.9

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .+...|++||++++--
T Consensus       522 eI~RVLKPGGrLII~D  537 (677)
T PRK06922        522 SAYEVLKPGGRIIIRD  537 (677)
T ss_pred             HHHHHcCCCcEEEEEe
Confidence            4567899999999953


No 144
>PF00107 ADH_zinc_N:  Zinc-binding dehydrogenase;  InterPro: IPR013149 Alcohol dehydrogenase (1.1.1.1 from EC) (ADH) catalyzes the reversible oxidation of alcohols to their corresponding acetaldehyde or ketone with the concomitant reduction of NAD:  alcohol + NAD = aldehyde or ketone + NADH  Currently three structurally and catalytically different types of alcohol dehydrogenases are known:  Zinc-containing 'long-chain' alcohol dehydrogenases. Insect-type, or 'short-chain' alcohol dehydrogenases. Iron-containing alcohol dehydrogenases.  Zinc-containing ADH's [, ] are dimeric or tetrameric enzymes that bind two atoms of zinc per subunit. One of the zinc atom is essential for catalytic activity while the other is not. Both zinc atoms are coordinated by either cysteine or histidine residues; the catalytic zinc is coordinated by two cysteines and one histidine. Zinc-containing ADH's are found in bacteria, mammals, plants, and in fungi. In many species there is more than one isozyme (for example, humans have at least six isozymes, yeast have three, etc.). A number of other zinc-dependent dehydrogenases are closely related to zinc ADH [] and are included in this family.  Sorbitol dehydrogenase (1.1.1.14 from EC) L-threonine 3-dehydrogenase (1.1.1.103 from EC) Glutathione-dependent formaldehyde dehydrogenase (1.1.1.284 from EC) Mannitol dehydrogenase (1.1.1.255 from EC)   In addition, this family includes NADP-dependent quinone oxidoreductase (1.6.5.5 from EC), an enzyme found in bacteria (gene qor), in yeast and in mammals where, in some species such as rodents, it has been recruited as an eye lens protein and is known as zeta-crystallin []. The sequence of quinone oxidoreductase is distantly related to that other zinc-containing alcohol dehydrogenases and it lacks the zinc-ligand residues. The torpedo fish and mammalian synaptic vesicle membrane protein vat-1 is related to qor. This entry represents the cofactor-binding domain of these enzymes, which is normally found towards the C terminus. Structural studies indicate that it forms a classical Rossman fold that reversibly binds NAD(H) [, , ].; GO: 0008270 zinc ion binding, 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3PI7_A 3COS_D 1VJ1_A 2ZB3_A 1PIW_B 1Q1N_A 1PS0_A 2EER_B 3KRT_A 1ZSY_A ....
Probab=22.81  E-value=43  Score=18.13  Aligned_cols=17  Identities=47%  Similarity=0.786  Sum_probs=12.9

Q ss_pred             hHHhcccCCcEEEEEee
Q psy5588           4 ELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg   20 (61)
                      .-++.|+++|+++..=.
T Consensus        74 ~~~~~l~~~G~~v~vg~   90 (130)
T PF00107_consen   74 EAIKLLRPGGRIVVVGV   90 (130)
T ss_dssp             HHHHHEEEEEEEEEESS
T ss_pred             HHHHHhccCCEEEEEEc
Confidence            34678999999988643


No 145
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional
Probab=22.69  E-value=88  Score=20.91  Aligned_cols=16  Identities=31%  Similarity=0.530  Sum_probs=12.2

Q ss_pred             HHhcccCCcEEEEEee
Q psy5588           5 LIDQLRPGGRLIIPVG   20 (61)
Q Consensus         5 l~~QL~~gGrLV~pvg   20 (61)
                      ..+.|++||+|++...
T Consensus       289 a~~~LkpgG~L~iVan  304 (342)
T PRK09489        289 AVRHLNSGGELRIVAN  304 (342)
T ss_pred             HHHhcCcCCEEEEEEe
Confidence            3556999999987653


No 146
>PRK14902 16S rRNA methyltransferase B; Provisional
Probab=22.36  E-value=65  Score=22.04  Aligned_cols=13  Identities=31%  Similarity=0.603  Sum_probs=10.4

Q ss_pred             HHhcccCCcEEEE
Q psy5588           5 LIDQLRPGGRLII   17 (61)
Q Consensus         5 l~~QL~~gGrLV~   17 (61)
                      ....|++||+||.
T Consensus       365 a~~~LkpGG~lvy  377 (444)
T PRK14902        365 VAQYLKKGGILVY  377 (444)
T ss_pred             HHHHcCCCCEEEE
Confidence            3467999999994


No 147
>COG1224 TIP49 DNA helicase TIP49, TBP-interacting protein [Transcription]
Probab=21.72  E-value=2.2e+02  Score=20.19  Aligned_cols=52  Identities=17%  Similarity=0.306  Sum_probs=29.9

Q ss_pred             cHhHHhcccCCcEE---EEEeeCCCCceEEEEEEECCCCcE-EEEEeeeEEEEeccCCC
Q psy5588           2 VVELIDQLRPGGRL---IIPVGPEGSAQSLEQIDKNLDGTI-TRTPLMQVVYVPLTDKQ   56 (61)
Q Consensus         2 P~~l~~QL~~gGrL---V~pvg~~~~~~~l~~~~r~~~g~~-~~~~l~~~~fvpL~~~~   56 (61)
                      ++.+.+||-.-|..   |+-+..  ...++.++-|. .+.- ....+.+.+||||..++
T Consensus       175 g~~i~~ql~~~~V~~GDVI~Id~--etG~V~klGrs-~~~~~~~~dl~~~~~V~~P~Ge  230 (450)
T COG1224         175 GPEIAEQLVKEGVEEGDVIYIDA--ETGRVKKLGRS-KARAREDFDLEDTRFVPLPEGE  230 (450)
T ss_pred             CHHHHHHHHHhCcccCCEEEEEc--cccEEEEeecc-cccccccccccceEEEECCCCc
Confidence            45556666544332   222222  23466667675 3322 25678899999998765


No 148
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis]
Probab=21.59  E-value=76  Score=21.27  Aligned_cols=16  Identities=31%  Similarity=0.789  Sum_probs=13.2

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .++++|.+||.||+.=
T Consensus        58 ~ll~~~~~g~~i~v~g   73 (300)
T COG2813          58 QLLARLPPGGEIVVVG   73 (300)
T ss_pred             HHHhhCCCCCeEEEEe
Confidence            5788999999998854


No 149
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis]
Probab=21.48  E-value=78  Score=21.16  Aligned_cols=15  Identities=47%  Similarity=0.948  Sum_probs=12.8

Q ss_pred             HhHHhcccCCcEEEE
Q psy5588           3 VELIDQLRPGGRLII   17 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~   17 (61)
                      +.+...|+|||++++
T Consensus       247 ~~~~~~lkpgg~lIl  261 (300)
T COG2264         247 PDIKRLLKPGGRLIL  261 (300)
T ss_pred             HHHHHHcCCCceEEE
Confidence            456788999999998


No 150
>COG4811 Predicted membrane protein [Function unknown]
Probab=21.44  E-value=1.5e+02  Score=17.89  Aligned_cols=25  Identities=28%  Similarity=0.397  Sum_probs=17.4

Q ss_pred             cccCCcEEEEEeeCCCCceEEEEEEECCC
Q psy5588           8 QLRPGGRLIIPVGPEGSAQSLEQIDKNLD   36 (61)
Q Consensus         8 QL~~gGrLV~pvg~~~~~~~l~~~~r~~~   36 (61)
                      -|+++|.||+-...    +++....|+.+
T Consensus       115 NLsEdgvLVi~l~~----rRLli~~r~~~  139 (152)
T COG4811         115 NLSEDGVLVIQLEQ----RRLLIRVRNID  139 (152)
T ss_pred             CcCcCcEEEEEecc----ceeEEEecchh
Confidence            37899999998863    46666556533


No 151
>PLN02823 spermine synthase
Probab=21.37  E-value=79  Score=21.20  Aligned_cols=17  Identities=29%  Similarity=0.618  Sum_probs=13.2

Q ss_pred             hHHhcccCCcEEEEEee
Q psy5588           4 ELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg   20 (61)
                      .+.+.|++||.+|+-.+
T Consensus       205 ~~~~~L~p~Gvlv~q~~  221 (336)
T PLN02823        205 IVKPKLNPGGIFVTQAG  221 (336)
T ss_pred             HHHHhcCCCcEEEEecc
Confidence            35668999999987554


No 152
>PF13847 Methyltransf_31:  Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A ....
Probab=21.26  E-value=48  Score=18.79  Aligned_cols=16  Identities=50%  Similarity=0.841  Sum_probs=12.3

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .+.+.|+++|++++-.
T Consensus        95 ~~~~~lk~~G~~i~~~  110 (152)
T PF13847_consen   95 NIIRLLKPGGILIISD  110 (152)
T ss_dssp             HHHHHEEEEEEEEEEE
T ss_pred             HHHHHcCCCcEEEEEE
Confidence            4667899999988754


No 153
>PRK13255 thiopurine S-methyltransferase; Reviewed
Probab=21.24  E-value=80  Score=19.60  Aligned_cols=15  Identities=27%  Similarity=0.344  Sum_probs=10.6

Q ss_pred             HhHHhcccCCcEEEE
Q psy5588           3 VELIDQLRPGGRLII   17 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~   17 (61)
                      +.+.+-|+|||++++
T Consensus       139 ~~l~~lL~pgG~~~l  153 (218)
T PRK13255        139 QQLAALLPAGCRGLL  153 (218)
T ss_pred             HHHHHHcCCCCeEEE
Confidence            356778999997443


No 154
>PF14315 DUF4380:  Domain of unknown function (DUF4380)
Probab=21.24  E-value=64  Score=20.72  Aligned_cols=17  Identities=47%  Similarity=1.077  Sum_probs=14.6

Q ss_pred             HhcccCCcEEEEEeeCC
Q psy5588           6 IDQLRPGGRLIIPVGPE   22 (61)
Q Consensus         6 ~~QL~~gGrLV~pvg~~   22 (61)
                      +.|+++||+.++|+...
T Consensus       147 ~t~~~~gg~~~ip~~~~  163 (274)
T PF14315_consen  147 VTQVPPGGTVIIPLAPR  163 (274)
T ss_pred             eeEEcCCCEEEEecCCC
Confidence            45899999999999875


No 155
>COG0302 FolE GTP cyclohydrolase I [Coenzyme metabolism]
Probab=21.08  E-value=2.2e+02  Score=18.04  Aligned_cols=42  Identities=17%  Similarity=0.164  Sum_probs=25.8

Q ss_pred             CcHhHHhcccCCcEEEEEeeCCCCceEEEEEEECCCCcEEEEEee
Q psy5588           1 MVVELIDQLRPGGRLIIPVGPEGSAQSLEQIDKNLDGTITRTPLM   45 (61)
Q Consensus         1 iP~~l~~QL~~gGrLV~pvg~~~~~~~l~~~~r~~~g~~~~~~l~   45 (61)
                      |.+++.+-|++-|..|+.-+.  .....++-.|+ .++...++.+
T Consensus       133 IA~al~~~L~p~GVaVvieA~--HmCm~mRGv~k-~~s~t~Ts~~  174 (195)
T COG0302         133 IADALQEILKPRGVAVVIEAE--HMCMSMRGVRK-PGSSTVTSAL  174 (195)
T ss_pred             HHHHHHHhcCcCceEEEEEEE--EeeehhcCccC-CCceEEEEee
Confidence            346788999999999987764  23334443344 3344554433


No 156
>PRK06274 indolepyruvate oxidoreductase subunit B; Reviewed
Probab=20.93  E-value=88  Score=18.78  Aligned_cols=14  Identities=29%  Similarity=0.681  Sum_probs=11.0

Q ss_pred             HHhcccCCcEEEEE
Q psy5588           5 LIDQLRPGGRLIIP   18 (61)
Q Consensus         5 l~~QL~~gGrLV~p   18 (61)
                      .++.|++||.+|+=
T Consensus        82 ~~~~l~~gg~ii~n   95 (197)
T PRK06274         82 NLHFLKKGGKIIVN   95 (197)
T ss_pred             HHhhcCCCcEEEEE
Confidence            56789999988753


No 157
>PRK13256 thiopurine S-methyltransferase; Reviewed
Probab=20.57  E-value=85  Score=19.91  Aligned_cols=17  Identities=6%  Similarity=0.178  Sum_probs=13.4

Q ss_pred             hHHhcccCCcEEEEEee
Q psy5588           4 ELIDQLRPGGRLIIPVG   20 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg   20 (61)
                      .+.+.|++||++++..-
T Consensus       148 ~l~~lL~pgg~llll~~  164 (226)
T PRK13256        148 MMLEVCSNNTQILLLVM  164 (226)
T ss_pred             HHHHHhCCCcEEEEEEE
Confidence            46677999999998653


No 158
>PRK14903 16S rRNA methyltransferase B; Provisional
Probab=20.43  E-value=85  Score=21.60  Aligned_cols=15  Identities=27%  Similarity=0.379  Sum_probs=11.9

Q ss_pred             HHhcccCCcEEEEEe
Q psy5588           5 LIDQLRPGGRLIIPV   19 (61)
Q Consensus         5 l~~QL~~gGrLV~pv   19 (61)
                      ..+.|++||+||.-.
T Consensus       352 a~~~LkpGG~LvYsT  366 (431)
T PRK14903        352 AWKLLEKGGILLYST  366 (431)
T ss_pred             HHHhcCCCCEEEEEE
Confidence            457789999998854


No 159
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase. This model represents an O-methyltransferase believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and fungi (COQ3). A separate methylase (MenG/UbiE) catalyzes the single C-methylation step. The most commonly used names for genes in this family do not indicate whether this gene is an O-methyl, or C-methyl transferase.
Probab=20.40  E-value=91  Score=18.64  Aligned_cols=16  Identities=31%  Similarity=0.594  Sum_probs=12.0

Q ss_pred             hHHhcccCCcEEEEEe
Q psy5588           4 ELIDQLRPGGRLIIPV   19 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pv   19 (61)
                      .+.+.|++||++++-.
T Consensus       134 ~~~~~L~~gG~l~i~~  149 (224)
T TIGR01983       134 ACAQLLKPGGILFFST  149 (224)
T ss_pred             HHHHhcCCCcEEEEEe
Confidence            4557789999988754


No 160
>PF01555 N6_N4_Mtase:  DNA methylase;  InterPro: IPR002941 This domain is found in DNA methylases. In prokaryotes, the major role of DNA methylation is to protect host DNA against degradation by restriction enzymes. This family contains both N-4 cytosine-specific DNA methylases and N-6 Adenine-specific DNA methylases. N-4 cytosine-specific DNA methylases (2.1.1.113 from EC) [] are enzymes that specifically methylate the amino group at the C-4 position of cytosines in DNA. Such enzymes are found as components of type II restriction-modification systems in prokaryotes. Such enzymes recognise a specific sequence in DNA and methylate a cytosine in that sequence. By this action they protect DNA from cleavage by type II restriction enzymes that recognise the same sequence. N-6 adenine-specific DNA methylases (2.1.1.72 from EC) (A-Mtase) are enzymes that specifically methylate the amino group at the C-6 position of adenines in DNA. Such enzymes are found in the three existing types of bacterial restriction-modification systems (in type I system the A-Mtase is the product of the hsdM gene, and in type III it is the product of the mod gene). All of these enzymes recognise a specific sequence in DNA and methylate an adenine in that sequence.; GO: 0003677 DNA binding, 0008170 N-methyltransferase activity, 0006306 DNA methylation; PDB: 2ZIF_A 2ZIE_A 2ZIG_A 1NW6_A 1NW8_A 1NW7_A 1NW5_A 1EG2_A 1BOO_A 1G60_B ....
Probab=20.34  E-value=73  Score=18.72  Aligned_cols=19  Identities=32%  Similarity=0.593  Sum_probs=14.3

Q ss_pred             hHHhcccCCcEEEEEeeCC
Q psy5588           4 ELIDQLRPGGRLIIPVGPE   22 (61)
Q Consensus         4 ~l~~QL~~gGrLV~pvg~~   22 (61)
                      .+..-|+++|.+++-++..
T Consensus        41 ~~~rvLk~~g~~~i~~~~~   59 (231)
T PF01555_consen   41 ECYRVLKPGGSIFIFIDDR   59 (231)
T ss_dssp             HHHHHEEEEEEEEEEE-CC
T ss_pred             HHHhhcCCCeeEEEEecch
Confidence            4567789999999988753


No 161
>PF05195 AMP_N:  Aminopeptidase P, N-terminal domain;  InterPro: IPR007865 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This N-terminal domain is associated with N-terminal region of aminopeptidase P (X-Pro aminopeptidase I and II, 3.4.11.9 from EC) and related sequences. It is not found associated with methionyl aminopeptidase 1 (IPR002467 from INTERPRO) or methionyl aminopeptidase 2 (IPR002468 from INTERPRO) families. The domain is structurally very similar [] to the creatinase N-terminal domain (IPR000587 from INTERPRO), however, little or no sequence similarity exists between the two domains. The sequences belong to MEROPS peptidase family M24B, clan MG.; GO: 0004177 aminopeptidase activity, 0030145 manganese ion binding; PDB: 3IG4_B 2OKN_A 2IW2_B 1WBQ_A 2BH3_A 1WLR_A 2V3Z_A 1W2M_B 2BWT_A 2BWW_A ....
Probab=20.29  E-value=87  Score=17.92  Aligned_cols=19  Identities=32%  Similarity=0.611  Sum_probs=12.8

Q ss_pred             HhHHhcccCCcEEEEEeeC
Q psy5588           3 VELIDQLRPGGRLIIPVGP   21 (61)
Q Consensus         3 ~~l~~QL~~gGrLV~pvg~   21 (61)
                      +.|+++|.++|.+|++=+.
T Consensus        11 ~~l~~~l~~~~~vil~~~~   29 (134)
T PF05195_consen   11 KKLAEKLPDNSIVILPGGP   29 (134)
T ss_dssp             HHHHHHSHSSEEEEEE---
T ss_pred             HHHHHhcCCCcEEEEECCC
Confidence            4578888888888886554


Done!