Query         psy5589
Match_columns 60
No_of_seqs    101 out of 182
Neff          5.6 
Searched_HMMs 46136
Date          Fri Aug 16 21:24:21 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5589.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5589hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF03098 An_peroxidase:  Animal  99.8 8.5E-20 1.8E-24  133.5   3.2   59    1-59     23-86  (530)
  2 KOG2408|consensus               99.8 5.5E-19 1.2E-23  134.5   4.6   58    1-59    173-234 (719)
  3 PLN02283 alpha-dioxygenase      99.1 1.6E-10 3.4E-15   87.6   5.2   53    1-59    107-160 (633)
  4 COG2186 FadR Transcriptional r  49.9      16 0.00035   24.5   2.3   20   11-31     25-44  (241)
  5 COG1725 Predicted transcriptio  39.9      28  0.0006   22.0   2.1   19   12-31     27-45  (125)
  6 KOG3958|consensus               38.1      23 0.00049   26.2   1.7   12   47-58    312-323 (371)
  7 PF13940 Ldr_toxin:  Toxin Ldr,  33.7      38 0.00083   17.1   1.6   12   48-59      3-14  (35)
  8 PF11055 Gsf2:  Glucose signall  32.5      27 0.00058   26.0   1.3   18   43-60    171-188 (377)
  9 TIGR00799 mtp Golgi 4-transmem  27.3      25 0.00053   24.9   0.4   19    6-24    232-254 (258)
 10 PF11591 2Fe-2S_Ferredox:  Ferr  26.9      22 0.00048   17.7   0.1   10   20-29     23-32  (34)
 11 PRK14954 DNA polymerase III su  26.7      42 0.00091   26.1   1.6   17   44-60    502-518 (620)
 12 COG2880 Uncharacterized protei  25.9      15 0.00032   21.1  -0.7   13    5-17      7-19  (67)
 13 PRK04984 fatty acid metabolism  21.3      92   0.002   20.2   2.2   20   11-31     22-41  (239)

No 1  
>PF03098 An_peroxidase:  Animal haem peroxidase;  InterPro: IPR002007 Peroxidases are haem-containing enzymes that use hydrogen peroxide as the electron acceptor to catalyse a number of oxidative reactions. Peroxidases are found in bacteria, fungi, plants and animals. On the basis of sequence similarity, a number of animal haem peroxidases can be categorised as members of a superfamily: myeloperoxidase (MPO); eosinophil peroxidase (EPO); lactoperoxidase (LPO); thyroid peroxidase (TPO); prostaglandin H synthase (PGHS); and peroxidasin [, , ].  MPO plays a major role in the oxygen-dependent microbicidal system of neutrophils. EPO from eosinophilic granulocytes participates in immunological reactions, and potentiates tumor necrosis factor (TNF) production and hydrogen peroxide release by human monocyte-derived macrophages [, ]. In the main, MPO (and possibly EPO) utilises Cl-ions and H2O2 to form hypochlorous acid (HOCl), which can effectively kill bacteria or parasites. In secreted fluids, LPO catalyses the oxidation of thiocyanate ions (SCN-) by H2O2, producing the weak oxidising agent hypothiocyanite (OSCN-), which has bacteriostatic activity []. TPO uses I- ions and H2O2 to generate iodine, and plays a central role in the biosynthesis of thyroid hormones T(3) and T(4).  To date, the 3D structures of MPO and PGHS have been reported. MPO is a homodimer: each monomer consists of a light (A or B) and a heavy (C or D) chain resulting from post-translational excision of 6 residues from the common precursor. Monomers are linked by a single inter-chain disulphide. Each monomer includes a bound calcium ion []. PGHS exists as a symmetric dimer, each monomer of which consists of 3 domains: an N-terminal epidermal growth factor (EGF) like module; a membrane-binding domain; and a large C-terminal catalytic domain containing the cyclooxygenase and the peroxidase active sites. The catalytic domain shows striking structural similarity to MPO. The cyclooxygenase active site, which catalyses the formation of prostaglandin G2 (PGG2) from arachidonic acid, resides at the apex of a long hydrophobic channel, extending from the membrane-binding domain to the centre of the molecule. The peroxidase active site, which catalyses the reduction of PGG2 to PGH2, is located on the other side of the molecule, at the haem binding site []. Both MPO and the catalytic domain of PGHS are mainly alpha-helical, 19 helices being identified as topologically and spatially equivalent; PGHS contains 5 additional N-terminal helices that have no equivalent in MPO. In both proteins, three Asn residues in each monomer are glycosylated.; GO: 0004601 peroxidase activity, 0020037 heme binding, 0006979 response to oxidative stress, 0055114 oxidation-reduction process; PDB: 1FE2_A 1PGG_B 1PGF_A 3N8W_B 1IGZ_A 3KK6_B 3N8Z_A 1Q4G_A 1PTH_A 1EQH_A ....
Probab=99.78  E-value=8.5e-20  Score=133.52  Aligned_cols=59  Identities=37%  Similarity=0.643  Sum_probs=44.6

Q ss_pred             CccCCCCCCCccccCcCC----CCCCCHHHHhHHHhcCCCC-CCCCCchhHHHHHHHHHHHhhc
Q psy5589           1 MTRKTPPAYSDGVYMLAG----MDRPSPRTLSTLFMKGEDG-QPSMKNRTALLAFFGKFWRKIL   59 (60)
Q Consensus         1 l~Rllp~~Y~DGv~~P~G----~~LP~pR~VS~~i~~~~~~-~~~~~~~t~l~m~fGQfi~h~~   59 (60)
                      |.|++||.|+||+++|++    .+|||||.||++|+...++ .+++...|+|+|+|||||+|++
T Consensus        23 ~~Rllp~~Y~dg~~~pr~~~~g~~lP~pR~is~~l~~~~~~~~~~~~~~t~l~~~~gQfi~HDi   86 (530)
T PF03098_consen   23 FRRLLPPAYADGVSEPRGSSNGSPLPNPREISNALFRRKDGFDPSHSGLTALFMQWGQFIDHDI   86 (530)
T ss_dssp             -BESS-B--TTSSSBTTTSBTTBS---HHHHHHHHTB-SSGTTBEEEEEEHHHHHHHHHHHHHH
T ss_pred             ccccCCccccccccccccccCCccCCCHHHHHHHHhhcccccCCCCCcchHHHHHHHHHHhhhh
Confidence            689999999999999984    6899999999999987653 4555677999999999999987


No 2  
>KOG2408|consensus
Probab=99.76  E-value=5.5e-19  Score=134.51  Aligned_cols=58  Identities=26%  Similarity=0.392  Sum_probs=51.4

Q ss_pred             CccCCCCCCCccccCcCCC----CCCCHHHHhHHHhcCCCCCCCCCchhHHHHHHHHHHHhhc
Q psy5589           1 MTRKTPPAYSDGVYMLAGM----DRPSPRTLSTLFMKGEDGQPSMKNRTALLAFFGKFWRKIL   59 (60)
Q Consensus         1 l~Rllp~~Y~DGv~~P~G~----~LP~pR~VS~~i~~~~~~~~~~~~~t~l~m~fGQfi~h~~   59 (60)
                      |.|++||.|+||+++|+|+    +||+||+||++|+.... .+.+.++|+|+|||||||+|+|
T Consensus       173 ~~Rllpp~Yedg~~~p~~~~~~~~lP~~R~vS~~l~~~~~-~~~~~~~~~~~mqwgQFi~HDl  234 (719)
T KOG2408|consen  173 FRRLLPPKYEDGFSTPRGWSDGTPLPSARLVSNKLLSRSF-SPPDSKFNHMAMQWGQFIDHDL  234 (719)
T ss_pred             hhccCCccccccccCccccccCCCCCchHHhhHhhhcccc-CCCCcchhHHHHHHHHHhcccc
Confidence            5799999999999999976    67999999999998763 4556778999999999999987


No 3  
>PLN02283 alpha-dioxygenase
Probab=99.08  E-value=1.6e-10  Score=87.64  Aligned_cols=53  Identities=19%  Similarity=0.251  Sum_probs=42.5

Q ss_pred             CccCCCCC-CCccccCcCCCCCCCHHHHhHHHhcCCCCCCCCCchhHHHHHHHHHHHhhc
Q psy5589           1 MTRKTPPA-YSDGVYMLAGMDRPSPRTLSTLFMKGEDGQPSMKNRTALLAFFGKFWRKIL   59 (60)
Q Consensus         1 l~Rllp~~-Y~DGv~~P~G~~LP~pR~VS~~i~~~~~~~~~~~~~t~l~m~fGQfi~h~~   59 (60)
                      |.|.+||+ |.||+.      +|+||.||+.++......+.....|+|+|+||||++|++
T Consensus       107 f~R~v~p~~~~~~~~------~P~pr~vs~~ll~r~~f~~~~~~~n~~~~~w~Qf~~HD~  160 (633)
T PLN02283        107 FGRNMPPVDQKDKLL------DPHPSVVATKLLARKKFIDTGKQFNMIAASWIQFMIHDW  160 (633)
T ss_pred             cccCCCccccCCCCC------CCCHHHHHHHHHhhccccCCCCcchHHHHHHHHHHHhhh
Confidence            57999996 666655      599999999999855444445567999999999999984


No 4  
>COG2186 FadR Transcriptional regulators [Transcription]
Probab=49.92  E-value=16  Score=24.53  Aligned_cols=20  Identities=35%  Similarity=0.423  Sum_probs=14.5

Q ss_pred             ccccCcCCCCCCCHHHHhHHH
Q psy5589          11 DGVYMLAGMDRPSPRTLSTLF   31 (60)
Q Consensus        11 DGv~~P~G~~LP~pR~VS~~i   31 (60)
                      +|.+.| |..||+-|+++..+
T Consensus        25 ~g~~~~-G~~LP~EreLae~f   44 (241)
T COG2186          25 SGELPP-GDRLPSERELAERF   44 (241)
T ss_pred             cCCCCC-CCCCCCHHHHHHHH
Confidence            455543 88899999888765


No 5  
>COG1725 Predicted transcriptional regulators [Transcription]
Probab=39.91  E-value=28  Score=21.98  Aligned_cols=19  Identities=32%  Similarity=0.375  Sum_probs=14.0

Q ss_pred             cccCcCCCCCCCHHHHhHHH
Q psy5589          12 GVYMLAGMDRPSPRTLSTLF   31 (60)
Q Consensus        12 Gv~~P~G~~LP~pR~VS~~i   31 (60)
                      |... .|..|||.|+....+
T Consensus        27 g~l~-pGdkLPSvRelA~~~   45 (125)
T COG1725          27 GELK-PGDKLPSVRELAKDL   45 (125)
T ss_pred             CCcC-CCCCCCcHHHHHHHh
Confidence            4443 388999999987765


No 6  
>KOG3958|consensus
Probab=38.11  E-value=23  Score=26.17  Aligned_cols=12  Identities=8%  Similarity=0.207  Sum_probs=10.2

Q ss_pred             HHHHHHHHHHhh
Q psy5589          47 LLAFFGKFWRKI   58 (60)
Q Consensus        47 l~m~fGQfi~h~   58 (60)
                      -.|+|||.++|+
T Consensus       312 qa~~Fa~~lthl  323 (371)
T KOG3958|consen  312 QAMQFAQLLTHL  323 (371)
T ss_pred             HHHHHHHHHHHH
Confidence            368999999997


No 7  
>PF13940 Ldr_toxin:  Toxin Ldr, type I toxin-antitoxin system
Probab=33.71  E-value=38  Score=17.14  Aligned_cols=12  Identities=33%  Similarity=0.302  Sum_probs=10.4

Q ss_pred             HHHHHHHHHhhc
Q psy5589          48 LAFFGKFWRKIL   59 (60)
Q Consensus        48 ~m~fGQfi~h~~   59 (60)
                      +.|||-.++|+|
T Consensus         3 Laqlg~~~WhDL   14 (35)
T PF13940_consen    3 LAQLGIAFWHDL   14 (35)
T ss_pred             HHHHHHHHHHHh
Confidence            578999999987


No 8  
>PF11055 Gsf2:  Glucose signalling factor 2;  InterPro: IPR022757 This entry represents fungal Glucose singalling factor 2. Gsf2 is localised to the ER and functions to promote the secretion of certain hexose transporters []. 
Probab=32.45  E-value=27  Score=26.02  Aligned_cols=18  Identities=33%  Similarity=0.322  Sum_probs=15.2

Q ss_pred             chhHHHHHHHHHHHhhcC
Q psy5589          43 NRTALLAFFGKFWRKILK   60 (60)
Q Consensus        43 ~~t~l~m~fGQfi~h~~~   60 (60)
                      +.+-...||.-|+-||+|
T Consensus       171 ~~~g~~aQ~~FF~~HiiK  188 (377)
T PF11055_consen  171 NYSGVLAQWLFFVFHIIK  188 (377)
T ss_pred             CcccHHHHHHHHHHHHHH
Confidence            346688999999999987


No 9  
>TIGR00799 mtp Golgi 4-transmembrane spanning transporter. The proteins of the MET family have 4 TMS regions and are located in late endosomal or lysosomal membranes. Substrates of the mouse MTP transporter include thymidine, both nucleoside and nucleobase analogues, antibiotics, anthracyclines, ionophores and steroid hormones. MET transporters may be involved in the subcellular compartmentation of steroid hormones and other compounds.Drug sensitivity by mouse MET was regulated by compounds that inhibit lysosomal function, interface with intracellular cholesterol transport, or modulate the multidrug resistance phenotype of mammalian cells. Thus, MET family members may compartmentalize diverse hydrophobic molecules, thereby affecting cellular drug sensitivity,nucleoside/nucleobase availability and steroid hormone responses.
Probab=27.35  E-value=25  Score=24.94  Aligned_cols=19  Identities=26%  Similarity=0.630  Sum_probs=13.2

Q ss_pred             CCCCCccccCcC----CCCCCCH
Q psy5589           6 PPAYSDGVYMLA----GMDRPSP   24 (60)
Q Consensus         6 p~~Y~DGv~~P~----G~~LP~p   24 (60)
                      =|.|||.++.|.    |.+-|.|
T Consensus       232 LPsYEeA~~~p~K~p~~~~~PPP  254 (258)
T TIGR00799       232 LPSYEEALSLPEKTPEGDPAPPP  254 (258)
T ss_pred             CCCHHHHhcCCccCCCCCCCCCC
Confidence            377888888774    6666654


No 10 
>PF11591 2Fe-2S_Ferredox:  Ferredoxin chloroplastic transit peptide;  InterPro: IPR023383 This entry represent the N-terminal transit peptide of a number of algal petF genes. The peptide is removed during transit into the chloroplast lumen.   The structure of chloroplast ferredoxin in water is unstructured however in a 30:70 molar-ratio mixture of 2,2,2-trifluoroethanol, residues 3 to 13 form an alpha-helix. The rest of the peptide remains unstructured []. This domain is the N-terminal of the [2Fe-2S), ferredoxin, from, C.reinhardtii:, petF., This, protein, catalyses, the, final, reaction, in, a, pathway, which, allows, the, production, of, H(2), from, water, in, the, chloroplast, ]. ; PDB: 1FCT_A.
Probab=26.86  E-value=22  Score=17.72  Aligned_cols=10  Identities=60%  Similarity=0.856  Sum_probs=4.2

Q ss_pred             CCCCHHHHhH
Q psy5589          20 DRPSPRTLST   29 (60)
Q Consensus        20 ~LP~pR~VS~   29 (60)
                      .+|++|.+|.
T Consensus        23 arpsart~s~   32 (34)
T PF11591_consen   23 ARPSARTVSV   32 (34)
T ss_dssp             TSSS-S----
T ss_pred             cCcccceeec
Confidence            4899999985


No 11 
>PRK14954 DNA polymerase III subunits gamma and tau; Provisional
Probab=26.71  E-value=42  Score=26.11  Aligned_cols=17  Identities=24%  Similarity=0.341  Sum_probs=13.8

Q ss_pred             hhHHHHHHHHHHHhhcC
Q psy5589          44 RTALLAFFGKFWRKILK   60 (60)
Q Consensus        44 ~t~l~m~fGQfi~h~~~   60 (60)
                      .-.+.+-|.||++|+.|
T Consensus       502 ~~~l~~~w~~~~~~~~~  518 (620)
T PRK14954        502 LEKLRMEWNQFLEHLLK  518 (620)
T ss_pred             HHHHHHHHHHHHHHHHH
Confidence            35678889999999864


No 12 
>COG2880 Uncharacterized protein conserved in archaea [Function unknown]
Probab=25.92  E-value=15  Score=21.11  Aligned_cols=13  Identities=23%  Similarity=0.353  Sum_probs=10.6

Q ss_pred             CCCCCCccccCcC
Q psy5589           5 TPPAYSDGVYMLA   17 (60)
Q Consensus         5 lp~~Y~DGv~~P~   17 (60)
                      +.|.|+|||-.|-
T Consensus         7 IEaiYEnGVfKPL   19 (67)
T COG2880           7 IEAIYENGVLKPL   19 (67)
T ss_pred             HHHHHhccccccc
Confidence            4578999999994


No 13 
>PRK04984 fatty acid metabolism regulator; Provisional
Probab=21.28  E-value=92  Score=20.21  Aligned_cols=20  Identities=30%  Similarity=0.403  Sum_probs=13.8

Q ss_pred             ccccCcCCCCCCCHHHHhHHH
Q psy5589          11 DGVYMLAGMDRPSPRTLSTLF   31 (60)
Q Consensus        11 DGv~~P~G~~LP~pR~VS~~i   31 (60)
                      +|...| |..||+-|+++..+
T Consensus        22 ~g~l~p-G~~LPsE~eLae~~   41 (239)
T PRK04984         22 NNRFPP-GSILPAERELSELI   41 (239)
T ss_pred             cCCCCC-CCcCCCHHHHHHHH
Confidence            344433 88899999887765


Done!