Diaphorina citri psyllid: psy5591


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MRPPESNLLKYLQCYVVVENLRYMLIHYEKTTPIYFGCKFKPFVKQGYMSGGAGIQVFHYRALCGRENSLLVDKAIGLLDNNLCKQIYLSILMEPLVEFPGEDVIAKELKHKVRVLCWVMTNPDNHNKKARHVKATWGKRCNILLFMSSSVDPKLGTINLNISEGRDHLWGKTKAAFRYVYEHYRGQYDWVMKADDDT
cccccccccEEcHHHHHHHHHHHHHHcccccccEEEccccccccccccCCccccHHHHHHHHHcccccccHHHHHccccccccHHHHHHHHccccccccccccHHHHHHccccEEEEEEECcccccHHHHHHHHHHHHccccEEEEEEcccccccccEEcccccccccHHHHHHHHHHHHHHHccccccEEEEEcccc
*****SNLLKYLQCYVVVENLRYMLIHYEKTTPIYFGCKFKPFVKQGYMSGGAGIQVFHYRALCGRENSLLVDKAIGLLDNNLCKQIYLSILMEPLVEFPGEDVIAKELKHKVRVLCWVMTNPDNHNKKARHVKATWGKRCNILLFMSSSVDPKLGTINLNISEGRDHLWGKTKAAFRYVYEHYRGQYDWVMKADDD*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPPESNLLKYLQCYVVVENLRYMLIHYEKTTPIYFGCKFKPFVKQGYMSGGAGIQVFHYRALCGRENSLLVDKAIGLLDNNLCKQIYLSILMEPLVEFPGEDVIAKELKHKVRVLCWVMTNPDNHNKKARHVKATWGKRCNILLFMSSSVDPKLGTINLNISEGRDHLWGKTKAAFRYVYEHYRGQYDWVMKADDDT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 Glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Plays a central role in many processes, such as angiogenesis, thrombopoiesis and kidney homeostasis development.confidentQ9JJ05
Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 Glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins. Plays a central role in many processes, such as angiogenesis, thrombopoiesis and kidney homeostasis development.confidentQ9JJ06
Glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1 Glycosyltransferase that generates the core 1 O-glycan Gal-beta1-3GalNAc-alpha1-Ser/Thr (T antigen), which is a precursor for many extended O-glycans in glycoproteins.confidentQ18515

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0016021 [CC]integral to membraneprobableGO:0005575, GO:0044425, GO:0016020, GO:0031224
GO:0005797 [CC]Golgi medial cisternaprobableGO:0005795, GO:0005794, GO:0031985, GO:0031984, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005737, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0016266 [BP]O-glycan processingprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0009058, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0005975, GO:0044238, GO:0006493, GO:0006486, GO:1901137, GO:1901135, GO:0043412, GO:0009059, GO:0043170, GO:0019538, GO:0043413
GO:0016263 [MF]glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase activityprobableGO:0003674, GO:0003824, GO:0016740, GO:0008378, GO:0016757, GO:0016758, GO:0048531
GO:0009247 [BP]glycolipid biosynthetic processprobableGO:1901576, GO:0006629, GO:0044238, GO:0006643, GO:0071704, GO:1901137, GO:1901135, GO:0009987, GO:0044710, GO:0044237, GO:0044249, GO:0009058, GO:0008150, GO:0008152, GO:0046467, GO:0044255, GO:0006664, GO:0008610
GO:0048731 [BP]system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J0A, chain A
Confidence level:very confident
Coverage over the Query: 111-198
View the alignment between query and template
View the model in PyMOL
Template: 2J0A, chain A
Confidence level:very confident
Coverage over the Query: 4-59
View the alignment between query and template
View the model in PyMOL