Diaphorina citri psyllid: psy5603


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-----
MTSESIITEDIEIRHLKQYVVHELGIILNERDDWKKIMSIVTVDCDPLKPLKYSAKDIKIVERAGKRNFPERGCTDIFLDEWGTSGRRRPRLSDLIMFLKKAELHQAARYVEVDVLKKPESPGDNTEAAEWLQEVIQQEEANNKTEYIGELIAFTFCDLERATDGFNRKPYPRRGNKLGEGQFGTVYYGKLKNGMEIAVKTLENNANYSSSNSDNTEAAMIPILLFENEVQTLSQCKHVNLLRLLGLCNNIMNCIVYEYMCNGSLYDRLARVNNTPPLDSNKRYSIALGVAEALHYLHSLSKPIIHRDVKSANVLLDENFVPKLGDFGIVKMSETSNMKTMYTENLTGTRPYMPPEAMHCQISTKTDVFSYGVILLELLTGMKPIDDNNTILYYYLVVEQEVPVREVLDKEAGEWNETHVETLISIVFEKCCVFEKDKRASMRDIVDLLSKSVNN
cccccccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccHccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHcccccccccccccccccccccccEEEEEccccEEEEEEEccccccccccccccHHcccHHHHHHHHHHHHHHccccccccccccccccccEEEEEccccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHHccccccccccHHHHHHHHHccccc
*****IITEDIEIRHLKQYVVHELGIILNERDDWKKIMSIVTVDCDPLKPLKYSAKDIKIVERAGKRNFPERGCTDIFLDEWGTSGRRRPRLSDLIMFLKKAELHQAARYVEVDVL********************************GELIAFTFCDLERATDGFNRKPYPRRGNKLGEGQFGTVYYGKLKNGMEIAVKTL***************AAMIPILLFENEVQTLSQCKHVNLLRLLGLCNNIMNCIVYEYMCNGSLYDRLARVNNTPPLDSNKRYSIALGVAEALHYLHSLSKPIIHRDVKSANVLLDENFVPKLGDFGIVKMSETSNMKTMYTENLTGTRPYMPPEAMHCQISTKTDVFSYGVILLELLTGMKPIDDNNTILYYYLVVEQEVPVREVLDKEAGEWNETHVETLISIVFEKCCVFEKDKRASMRDIVDLLSKS***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTSESIITEDIEIRHLKQYVVHELGIILNERDDWKKIMSIVTVDCDPLKPLKYSAKDIKIVERAGKRNFPERGCTDIFLDEWGTSGRRRPRLSDLIMFLKKAELHQAARYVEVDVLKKPESPGDNTEAAEWLQEVIQQEEANNKTEYIGELIAFTFCDLERATDGFNRKPYPRRGNKLGEGQFGTVYYGKLKNGMEIAVKTLENNANYSSSNSDNTEAAMIPILLFENEVQTLSQCKHVNLLRLLGLCNNIMNCIVYEYMCNGSLYDRLARVNNTPPLDSNKRYSIALGVAEALHYLHSLSKPIIHRDVKSANVLLDENFVPKLGDFGIVKMSETSNMKTMYTENLTGTRPYMPPEAMHCQISTKTDVFSYGVILLELLTGMKPIDDNNTILYYYLVVEQEVPVREVLDKEAGEWNETHVETLISIVFEKCCVFEKDKRASMRDIVDLLSKSVNN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Interleukin-1 receptor-associated kinase 4 Serine/threonine-protein kinase that plays a critical role in initiating innate immune response against foreign pathogens. Involved in Toll-like receptor (TLR) and IL-1R signaling pathways. Is rapidly recruited by MYD88 to the receptor-signaling complex upon TLR activation to form the Myddosome together with IRAK2. Phosphorylates initially IRAK1, thus stimulating the kinase activity and intensive autophosphorylation of IRAK1. Phosphorylates E3 ubiquitin ligases Pellino proteins (PELI1, PELI2 and PELI3) to promote pellino-mediated polyubiquitination of IRAK1. Then, the ubiquitin-binding domain of IKBKG/NEMO binds to polyubiquitinated IRAK1 bringing together the IRAK1-MAP3K7/TAK1-TRAF6 complex and the NEMO-IKKA-IKKB complex. In turn, MAP3K7/TAK1 activates IKKs (CHUK/IKKA and IKBKB/IKKB) leading to NF-kappa-B nuclear translocation and activation. Alternatively, phosphorylates TIRAP to promote its ubiquitination and subsequent degradation. Phosphorylates NCF1 and regulates NADPH oxidase activation after LPS stimulation suggesting a similar mechanism during microbial infections.confidentQ9NWZ3
Interleukin-1 receptor-associated kinase 4 Serine/threonine-protein kinase that plays a critical role in initiating innate immune response against foreign pathogens. Involved in Toll-like receptor (TLR) and IL-1R signaling pathways. Is rapidly recruited by MYD88 to the receptor-signaling complex upon TLR activation to form the Myddosome together with IRAK2. Phosphorylates initially IRAK1, thus stimulating the kinase activity and intensive autophosphorylation of IRAK1. Phosphorylates E3 ubiquitin ligases Pellino proteins (PELI1, PELI2 and PELI3) to promote pellino-mediated polyubiquitination of IRAK1. Then, the ubiquitin-binding domain of IKBKG/NEMO binds to polyubiquitinated IRAK1 bringing together the IRAK1-MAP3K7/TAK1-TRAF6 complex and the NEMO-IKKA-IKKB complex. In turn, MAP3K7/TAK1 activates IKKs (CHUK/IKKA and IKBKB/IKKB) leading to NF-kappa-B nuclear translocation and activation. Alternatively, phosphorylates TIRAP to promote its ubiquitination and subsequent degradation. Phosphorylates NCF1 and regulates NADPH oxidase activation after LPS stimulation suggesting a similar mechanism during microbial infections.confidentQ8R4K2
Interleukin-1 receptor-associated kinase 4 Serine/threonine-protein kinase that plays a critical role in initiating innate immune response against foreign pathogens. Involved in Toll-like receptor (TLR) and IL-1R signaling pathways. Is rapidly recruited by MYD88 to the receptor-signaling complex upon TLR activation to form the Myddosome together with IRAK2. Phosphorylates initially IRAK1, thus stimulating the kinase activity and intensive autophosphorylation of IRAK1. Phosphorylates E3 ubiquitin ligases Pellino proteins (PELI1, PELI2 and PELI3) to promote pellino-mediated polyubiquitination of IRAK1. Then, the ubiquitin-binding domain of IKBKG/NEMO binds to polyubiquitinated IRAK1 bringing together the IRAK1-MAP3K7/TAK1-TRAF6 complex and the NEMO-IKKA-IKKB complex. In turn, MAP3K7/TAK1 activates IKKs (CHUK/IKKA and IKBKB/IKKB) leading to NF-kappa-B nuclear translocation and activation. Alternatively, phosphorylates TIRAP to promote its ubiquitination and subsequent degradation. Phosphorylates NCF1 and regulates NADPH oxidase activation after LPS stimulation suggesting a similar mechanism during microbial infections.confidentQ1RMT8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0035556 [BP]intracellular signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0005768 [CC]endosomeprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0004674 [MF]protein serine/threonine kinase activityprobableGO:0016773, GO:0016772, GO:0016301, GO:0003824, GO:0016740, GO:0003674, GO:0004672
GO:0048584 [BP]positive regulation of response to stimulusprobableGO:0048518, GO:0065007, GO:0048583, GO:0050789, GO:0008150
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006952 [BP]defense responseprobableGO:0006950, GO:0008150, GO:0050896
GO:0044446 [CC]intracellular organelle partprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043226, GO:0044422
GO:0009617 [BP]response to bacteriumprobableGO:0008150, GO:0009607, GO:0050896, GO:0051707, GO:0051704
GO:0046777 [BP]protein autophosphorylationprobableGO:0044267, GO:0006468, GO:0044260, GO:0044238, GO:0019538, GO:0016310, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0071704, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0042803 [MF]protein homodimerization activityprobableGO:0046983, GO:0003674, GO:0005515, GO:0042802, GO:0005488
GO:0009506 [CC]plasmodesmaprobableGO:0055044, GO:0005575, GO:0030054, GO:0005911
GO:0001816 [BP]cytokine productionprobableGO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0045893 [BP]positive regulation of transcription, DNA-dependentprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0009891, GO:2000112, GO:0019219, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0010556, GO:0048522
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NRU, chain A
Confidence level:very confident
Coverage over the Query: 150-453
View the alignment between query and template
View the model in PyMOL
Template: 1D2Z, chain B
Confidence level:very confident
Coverage over the Query: 4-127
View the alignment between query and template
View the model in PyMOL