Query         psy5619
Match_columns 66
No_of_seqs    103 out of 293
Neff          4.7 
Searched_HMMs 46136
Date          Fri Aug 16 22:18:17 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5619.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5619hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2046|consensus               99.8 5.8E-22 1.3E-26  138.5   3.7   63    2-64    127-190 (193)
  2 PF00402 Calponin:  Calponin fa  99.7 1.7E-18 3.7E-23   88.0   1.3   25   39-63      1-26  (26)
  3 COG5199 SCP1 Calponin [Cytoske  98.6 4.9E-08 1.1E-12   67.6   2.9   61    2-62    114-177 (178)
  4 PF14495 Cytochrom_C550:  Cytoc  40.9      27 0.00058   23.7   2.3   29    2-35     86-114 (135)
  5 PF11792 Baculo_LEF5_C:  Baculo  40.7     6.8 0.00015   21.8  -0.5   20   22-41     14-33  (43)
  6 PF03494 Beta-APP:  Beta-amyloi  38.8      12 0.00027   20.3   0.3   11   40-50     18-28  (39)
  7 PHA00650 hypothetical protein   25.2      38 0.00083   20.7   0.9   12    7-18     47-58  (82)
  8 PF01244 Peptidase_M19:  Membra  19.9      71  0.0015   23.4   1.6   24   20-43    207-233 (320)
  9 COG2355 Zn-dependent dipeptida  15.9 1.2E+02  0.0025   22.9   2.0   28   18-45    194-224 (313)
 10 PF04624 Dec-1:  Dec-1 repeat;   14.0      62  0.0013   16.3   0.1   11   24-34      8-18  (27)

No 1  
>KOG2046|consensus
Probab=99.85  E-value=5.8e-22  Score=138.50  Aligned_cols=63  Identities=46%  Similarity=0.714  Sum_probs=57.6

Q ss_pred             cccccCCCCCCCccCccCCccccccCcHHHHhcccCeeeecccccccccccCCC-CCccccccc
Q psy5619           2 DECYKHPEFRGPFLGPKPSEENKRFFTEDQLRAGEGMIGLQAGTNKLASQSGQN-FGATRKIIL   64 (66)
Q Consensus         2 ~~~~~~~~~~gp~~G~K~a~k~~R~fteeql~~g~~ii~LQ~GtNk~ASQ~Gmt-~G~~R~i~~   64 (66)
                      |+|+++--+.+|.||||+|++++|+|++++|++|+++|+|||||||||||+||+ ||++|++++
T Consensus       127 ~~a~~~~~~~~~~~g~k~a~kq~r~f~~~~lk~g~~vi~LQmGtnk~asq~g~~~~G~~R~l~d  190 (193)
T KOG2046|consen  127 RKAQKKGLFSGPGIGPKLAEKQPREFTDEQLKAGQNVIGLQMGTNKGASQAGMTAYGTRRHLYD  190 (193)
T ss_pred             HHHhhccccCCCCcCCchhhcCcccCCHHHHhcccceEEEeeeccchhhcccccccccccccCC
Confidence            456666446789999999999999999999999999999999999999999999 999998875


No 2  
>PF00402 Calponin:  Calponin family repeat;  InterPro: IPR000557 Calponin [, ] is a thin filament-associated protein that is implicated in the regulation and modulation of smooth muscle contraction. It is capable of binding to actin, calmodulin, troponin C and tropomyosin. The interaction of calponin with actin inhibits the actomyosin MgATPase activity. Calponin is a basic protein of approximately 34 Kd. Multiple isoforms are found in smooth muscles. Calponin contains three repeats of a well conserved 26 amino acid domain. Such a domain is also found in vertebrate smooth muscle protein (SM22 or transgelin), and a number of other proteins whose physiological role is not yet established, including Drosophila synchronous flight muscle protein SM20, Caenorhabditis elegans unc-87 protein [], rat neuronal protein NP25 [], and an Onchocerca volvulus antigen [].
Probab=99.72  E-value=1.7e-18  Score=87.99  Aligned_cols=25  Identities=68%  Similarity=0.890  Sum_probs=23.9

Q ss_pred             eeecccccccccccCCC-CCcccccc
Q psy5619          39 IGLQAGTNKLASQSGQN-FGATRKII   63 (66)
Q Consensus        39 i~LQ~GtNk~ASQ~Gmt-~G~~R~i~   63 (66)
                      |+|||||||||||+||| ||++|||+
T Consensus         1 i~LQ~GtNk~aSQ~Gmt~~G~~R~i~   26 (26)
T PF00402_consen    1 IGLQMGTNKGASQSGMTAFGTPRHIY   26 (26)
T ss_pred             CcccccccccccccCCccCCCCcccC
Confidence            79999999999999998 99999985


No 3  
>COG5199 SCP1 Calponin [Cytoskeleton]
Probab=98.55  E-value=4.9e-08  Score=67.62  Aligned_cols=61  Identities=33%  Similarity=0.550  Sum_probs=53.6

Q ss_pred             cccccCCCCCCCccCccCCccccccC-cHHHHhcccCeeeecccccccccccCCC--CCccccc
Q psy5619           2 DECYKHPEFRGPFLGPKPSEENKRFF-TEDQLRAGEGMIGLQAGTNKLASQSGQN--FGATRKI   62 (66)
Q Consensus         2 ~~~~~~~~~~gp~~G~K~a~k~~R~f-teeql~~g~~ii~LQ~GtNk~ASQ~Gmt--~G~~R~i   62 (66)
                      |-|++.--|.+|.+||+.|+|.+|.| ..++|..+++.|.||||.-+.++|++=-  ++.+|.+
T Consensus       114 Rya~K~~~~~~p~lGP~LatKkprvfS~q~~l~~~~g~~~lqyGy~d~~~q~tek~a~~~rrD~  177 (178)
T COG5199         114 RYAQKERMFSGPFLGPHLATKKPRVFSSQEVLDRSKGAIHLQYGYSDLSEQSTEKGASNVRRDL  177 (178)
T ss_pred             HHHHHhcCCCCCccCccccccCCcccccHHHHhhcccceEeeecccccchhcccccccceecCC
Confidence            44666646789999999999999999 8899999999999999999999999875  7777765


No 4  
>PF14495 Cytochrom_C550:  Cytochrome c-550 domain; PDB: 3ARC_V 1IZL 3A0H_V 3A0B_v 1E29_A 1F1C_B 1S5L_V 4FBY_i 3PRR_V 3PRQ_V ....
Probab=40.91  E-value=27  Score=23.65  Aligned_cols=29  Identities=31%  Similarity=0.315  Sum_probs=19.3

Q ss_pred             cccccCCCCCCCccCccCCccccccCcHHHHhcc
Q psy5619           2 DECYKHPEFRGPFLGPKPSEENKRFFTEDQLRAG   35 (66)
Q Consensus         2 ~~~~~~~~~~gp~~G~K~a~k~~R~fteeql~~g   35 (66)
                      +++..||.-.-++++|++     |+++||+|.+=
T Consensus        86 ~i~e~hp~~~s~di~p~m-----r~ltdddL~~i  114 (135)
T PF14495_consen   86 SISELHPSIKSADIFPKM-----RNLTDDDLYAI  114 (135)
T ss_dssp             BGTTTS-STTCTTTSGGG-----TS--HHHHHHH
T ss_pred             hHHHhCcCcccchhhHhh-----cCCCHHHHHHH
Confidence            356677777778888876     88999999753


No 5  
>PF11792 Baculo_LEF5_C:  Baculoviridae late expression factor 5 C-terminal domain;  InterPro: IPR021758  This C-terminal domain is likely to be a zinc-binding domain. 
Probab=40.68  E-value=6.8  Score=21.80  Aligned_cols=20  Identities=35%  Similarity=0.516  Sum_probs=14.7

Q ss_pred             cccccCcHHHHhcccCeeee
Q psy5619          22 ENKRFFTEDQLRAGEGMIGL   41 (66)
Q Consensus        22 k~~R~fteeql~~g~~ii~L   41 (66)
                      +++-..-|.|+|+|+..+++
T Consensus        14 ~H~f~~~E~Q~RAGDE~VSf   33 (43)
T PF11792_consen   14 KHKFVTIEKQLRAGDEAVSF   33 (43)
T ss_pred             eeeeeehhhhhcccchHHHH
Confidence            34455678999999987763


No 6  
>PF03494 Beta-APP:  Beta-amyloid peptide (beta-APP);  InterPro: IPR013803 Amyloid-beta precursor protein (APP, or A4) is associated with Alzheimer's disease (AD), because one of its breakdown products, amyloid-beta (A-beta), aggregates to form amyloid or senile plaques [, ]. Mutations in APP or in proteins that process APP have been linked with early-onset, familial AD. Individuals with Down's syndrome carry an extra copy of chromosome 21, which contains the APP gene, and almost invariably develop amyloid plaques and Alzheimer's symptoms.  APP is important for the neurogenesis and neuronal regeneration, either through the intact protein, or through its many breakdown products []. APP consists of a large N-terminal extracellular region containing heparin-binding and copper-binding sites, a short hydrophobic transmembrane domain, and a short C-terminal intracellular domain. The N-terminal region is similar in structure to cysteine-rich growth factors and appears to function as a cell surface receptor, contributing to neurite growth, neuronal adhesion, axonogenesis and cell mobility []. APP acts as a kinesin I membrane receptor to mediate the axonal transport of beta-secretase and presenilin 1. The N-terminal domain can regulate neurite outgrowth through its binding to heparin and collagen I and IV, which are components of the extracellular matrix. APP is also coupled to apoptosis-inducing pathways, and is involved in copper homeostasis/oxidative stress through copper ion reduction, where copper-metallated APP induces neuronal death []. The C-terminal intracellular domain appears to be involved in transcription regulation through protein-protein interactions. APP can promote transcription activation through binding to APBB1/Tip60, and may bind to the adaptor protein FE65 to transactivate a wide variety of different promoters. APP can be processed by different sets of enzymes:    In the non-amyloidogenic (non-plaque-forming) pathway, APP is cleaved by alpha-secretase to yield a soluble N-terminal sAPP-alpha (neuroprotective) and a membrane-bound CTF-alpha. CTF-alpha is broken-down by presenilin-containing gamma-secretase to yield soluble p3 and membrane-bound AICD (nuclear signalling).  In the amyloidogenic pathway (plaque-forming), APP is broken down by beta-secretase to yield soluble sAPP-beta and membrane-bound CTF-beta. CTF-beta is broken down by gamma-secretase to yield soluble amyloid-beta and membrane-bound AICD. Amyloid-beta is required for neuronal function, but can aggregate to form amyloid plaques that seem to disrupt brain cells by clogging points of cell-cell contact.   This entry represents the amyloid-beta peptide (A-beta), which originates as a breakdown product from the cleavage of amyloid-beta precursor protein (APP, or A4), an integral, glycosylated membrane brain protein.  More information about these protein can be found at Protein of the Month: Amyloid-beta Precursor Protein [].; GO: 0005488 binding, 0016021 integral to membrane; PDB: 2LMQ_F 3JTI_B 2LMO_B 3MOQ_D 2LNQ_E 2LMP_G 2BEG_B 1AMC_A 3OW9_B 3U0T_F ....
Probab=38.81  E-value=12  Score=20.31  Aligned_cols=11  Identities=36%  Similarity=0.305  Sum_probs=8.2

Q ss_pred             eeccccccccc
Q psy5619          40 GLQAGTNKLAS   50 (66)
Q Consensus        40 ~LQ~GtNk~AS   50 (66)
                      .-.||+||+|-
T Consensus        18 aEDvgSNKGAI   28 (39)
T PF03494_consen   18 AEDVGSNKGAI   28 (39)
T ss_dssp             CCCCSSSSSEE
T ss_pred             hhHcCCCCceE
Confidence            33589999984


No 7  
>PHA00650 hypothetical protein
Probab=25.16  E-value=38  Score=20.75  Aligned_cols=12  Identities=42%  Similarity=1.041  Sum_probs=9.2

Q ss_pred             CCCCCCCccCcc
Q psy5619           7 HPEFRGPFLGPK   18 (66)
Q Consensus         7 ~~~~~gp~~G~K   18 (66)
                      -|+|.||++.|-
T Consensus        47 tpdyegptldpv   58 (82)
T PHA00650         47 TPDYEGPTLDPV   58 (82)
T ss_pred             CCCCcCCCcChH
Confidence            467889998874


No 8  
>PF01244 Peptidase_M19:  Membrane dipeptidase (Peptidase family M19);  InterPro: IPR008257 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date. In these enzymes, a divalent cation, usually zinc, activates the water molecule. The metal ion is held in place by amino acid ligands, usually three in number. The known metal ligands are His, Glu, Asp or Lys and at least one other residue is required for catalysis, which may play an electrophillic role. Of the known metalloproteases, around half contain an HEXXH motif, which has been shown in crystallographic studies to form part of the metal-binding site []. The HEXXH motif is relatively common, but can be more stringently defined for metalloproteases as 'abXHEbbHbc', where 'a' is most often valine or threonine and forms part of the S1' subsite in thermolysin and neprilysin, 'b' is an uncharged residue, and 'c' a hydrophobic residue. Proline is never found in this site, possibly because it would break the helical structure adopted by this motif in metalloproteases []. This group of peptidases belong to the MEROPS peptidase family M19 (membrane dipeptidase family, clan MJ). The protein fold of the peptidase domain for members of this family resembles that of Klebsiella urease, the type example for clan MJ. Renal dipeptidase (rDP) (3.4.13.19 from EC), also known as microsomal dipeptidase, is a zinc-dependent metalloenzyme that hydrolyzes a wide range of dipeptides. It is involved in renal metabolism of glutathione and its conjugates. It is a homodimeric disulphide-linked glycoprotein attached to the renal brush border microvilli membrane by a GPI-anchor. A glutamate residue has recently been shown [,] to be important for the catalytic activity of rDP. rDP seems to be evolutionary related to hypothetical proteins in the PQQ biosynthesis operons of Acinetobacter calcoaceticus and Klebsiella pneumoniae.; GO: 0008235 metalloexopeptidase activity, 0008239 dipeptidyl-peptidase activity, 0016805 dipeptidase activity, 0006508 proteolysis; PDB: 3NEH_B 2RAG_D 3LU2_A 3B40_A 3LY0_A 3FDG_B 2I5G_B 3S2J_A 3S2N_A 3S2L_A ....
Probab=19.86  E-value=71  Score=23.44  Aligned_cols=24  Identities=33%  Similarity=0.519  Sum_probs=15.8

Q ss_pred             CccccccCcHHHHhc---ccCeeeecc
Q psy5619          20 SEENKRFFTEDQLRA---GEGMIGLQA   43 (66)
Q Consensus        20 a~k~~R~fteeql~~---g~~ii~LQ~   43 (66)
                      --.++|+.++||+++   ..++||+-+
T Consensus       207 l~~h~RNltDe~iraia~~GGviGi~~  233 (320)
T PF01244_consen  207 LCPHPRNLTDEQIRAIAERGGVIGINF  233 (320)
T ss_dssp             TS--TTSB-HHHHHHHHHTT-EEEEES
T ss_pred             hCCCCCCCCHHHHHHHHHCCcEEEEEc
Confidence            335899999999986   568888864


No 9  
>COG2355 Zn-dependent dipeptidase, microsomal dipeptidase homolog [Amino acid transport and metabolism]
Probab=15.86  E-value=1.2e+02  Score=22.93  Aligned_cols=28  Identities=25%  Similarity=0.445  Sum_probs=21.2

Q ss_pred             cCCccccccCcHHHHhc---ccCeeeecccc
Q psy5619          18 KPSEENKRFFTEDQLRA---GEGMIGLQAGT   45 (66)
Q Consensus        18 K~a~k~~R~fteeql~~---g~~ii~LQ~Gt   45 (66)
                      +---.++|+.+++|+++   ..++||+-+-.
T Consensus       194 ~al~~h~RNl~D~qlkaI~~~gGvIgv~~~~  224 (313)
T COG2355         194 RALVDHPRNLSDEQLKAIAETGGVIGVNFIP  224 (313)
T ss_pred             hhccCCCCCCCHHHHHHHHhcCCEEEEEeeh
Confidence            33456899999999976   66888886544


No 10 
>PF04624 Dec-1:  Dec-1 repeat;  InterPro: IPR006718 The defective chorion-1 gene (dec-1) in Drosophila encodes follicle cell proteins necessary for proper eggshell assembly. Multiple products of the dec-1 gene are formed by alternative RNA splicing and proteolytic processing []. Cleavage products include S80 (80 kDa) which is incorporated into the eggshell, and further proteolysis of S80 gives S60 (60 kDa).  This repeat is usually found in 12 copies in the central region of the protein. Its function is unknown. Length polymorphisms of Dec-1 have been observed in wild-type strains, and are caused by changes in the numbers of the first five repeats [].; GO: 0005213 structural constituent of chorion, 0007304 chorion-containing eggshell formation, 0005576 extracellular region, 0042600 chorion
Probab=14.03  E-value=62  Score=16.34  Aligned_cols=11  Identities=27%  Similarity=0.558  Sum_probs=8.8

Q ss_pred             cccCcHHHHhc
Q psy5619          24 KRFFTEDQLRA   34 (66)
Q Consensus        24 ~R~fteeql~~   34 (66)
                      .|.|+||+.+.
T Consensus         8 qRQwsEeqAk~   18 (27)
T PF04624_consen    8 QRQWSEEQAKI   18 (27)
T ss_pred             HHHhhHHHHHH
Confidence            38899999875


Done!