Query         psy5652
Match_columns 92
No_of_seqs    107 out of 1522
Neff          11.4
Searched_HMMs 46136
Date          Fri Aug 16 23:11:51 2013
Command       hhsearch -i /work/01045/syshi/Psyhhblits/psy5652.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/5652hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2462|consensus               99.9 3.4E-24 7.4E-29  119.3   3.6   89    1-92    131-243 (279)
  2 KOG2462|consensus               99.9 9.7E-23 2.1E-27  113.6   3.9   76    1-83    188-263 (279)
  3 KOG3576|consensus               99.7 2.1E-19 4.6E-24   97.0  -2.0   81    1-88    118-198 (267)
  4 KOG3623|consensus               99.7 8.7E-18 1.9E-22  104.1  -0.7   76    1-83    895-970 (1007)
  5 KOG3623|consensus               99.5 6.2E-15 1.4E-19   91.8  -0.6   83    1-83    241-329 (1007)
  6 PHA00733 hypothetical protein   99.4 5.7E-13 1.2E-17   68.7   4.4   83    2-88     42-124 (128)
  7 PHA02768 hypothetical protein;  99.3 2.2E-12 4.7E-17   56.6   1.9   43   35-79      5-47  (55)
  8 KOG3576|consensus               99.2 6.3E-12 1.4E-16   68.5   2.7   79    2-87    147-236 (267)
  9 KOG3608|consensus               99.2 2.5E-11 5.4E-16   70.9   3.3   83    2-91    265-349 (467)
 10 KOG1074|consensus               99.2 2.2E-12 4.8E-17   81.5  -1.1   80    2-89    607-693 (958)
 11 KOG3608|consensus               99.1 1.4E-11   3E-16   71.9   0.5   60   26-88    256-316 (467)
 12 PF13465 zf-H2C2_2:  Zinc-finge  99.0 2.4E-10 5.1E-15   43.3   2.2   26   50-75      1-26  (26)
 13 KOG1074|consensus               99.0   2E-10 4.3E-15   73.0   2.3   54   36-90    880-933 (958)
 14 PHA02768 hypothetical protein;  98.8 1.5E-10 3.3E-15   50.8  -1.5   42    1-51      6-47  (55)
 15 KOG3993|consensus               98.8 1.2E-09 2.6E-14   65.2  -0.2   80    1-88    268-380 (500)
 16 PHA00616 hypothetical protein   98.7 1.1E-08 2.3E-13   43.0   1.8   34   35-68      1-34  (44)
 17 PLN03086 PRLI-interacting fact  98.7 1.9E-08 4.1E-13   62.7   3.5   61    2-74    455-515 (567)
 18 PHA00616 hypothetical protein   98.7   1E-08 2.2E-13   43.1   1.6   29   63-92      1-29  (44)
 19 PLN03086 PRLI-interacting fact  98.6 1.3E-07 2.8E-12   59.1   4.6   77    1-88    479-565 (567)
 20 PHA00732 hypothetical protein   98.5 9.2E-08   2E-12   45.5   2.7   44    1-57      2-46  (79)
 21 PHA00733 hypothetical protein   98.5 1.6E-07 3.5E-12   48.6   2.7   50    1-59     74-123 (128)
 22 PF05605 zf-Di19:  Drought indu  98.4 2.1E-06 4.5E-11   38.0   4.5   50   35-87      2-53  (54)
 23 PF00096 zf-C2H2:  Zinc finger,  98.3 1.3E-06 2.8E-11   31.8   2.4   20   37-56      2-21  (23)
 24 PF00096 zf-C2H2:  Zinc finger,  98.1 2.2E-06 4.8E-11   31.1   1.8   23   64-87      1-23  (23)
 25 KOG3993|consensus               98.1 2.3E-06 4.9E-11   51.7   1.9   59    1-59    296-380 (500)
 26 PF05605 zf-Di19:  Drought indu  98.1   2E-06 4.3E-11   38.0   1.2   49    1-58      3-52  (54)
 27 PF13465 zf-H2C2_2:  Zinc-finge  98.1 8.5E-08 1.8E-12   36.2  -2.8   21   26-46      5-25  (26)
 28 PHA00732 hypothetical protein   97.9 3.5E-06 7.7E-11   40.1   0.5   43   35-83      1-44  (79)
 29 PF13894 zf-C2H2_4:  C2H2-type   97.9 2.6E-05 5.7E-10   28.2   2.6   19   65-83      2-20  (24)
 30 PF12756 zf-C2H2_2:  C2H2 type   97.8 2.6E-05 5.7E-10   38.3   3.0   19    2-20      1-19  (100)
 31 PF13912 zf-C2H2_6:  C2H2-type   97.8 1.5E-05 3.3E-10   30.0   1.4   21   36-56      2-22  (27)
 32 PF13894 zf-C2H2_4:  C2H2-type   97.8 4.1E-05 8.9E-10   27.7   2.4   23   36-58      1-23  (24)
 33 PF13912 zf-C2H2_6:  C2H2-type   97.7 2.4E-05 5.2E-10   29.5   1.4   25   63-88      1-25  (27)
 34 smart00355 ZnF_C2H2 zinc finge  97.5 0.00019 4.2E-09   26.2   2.6   19   65-83      2-20  (26)
 35 PF09237 GAGA:  GAGA factor;  I  97.5 0.00018 3.8E-09   31.1   2.6   33   31-63     20-52  (54)
 36 smart00355 ZnF_C2H2 zinc finge  97.5  0.0002 4.3E-09   26.1   2.6   24   36-59      1-24  (26)
 37 PF09237 GAGA:  GAGA factor;  I  97.4 0.00082 1.8E-08   29.1   4.1   33   59-92     20-52  (54)
 38 PRK04860 hypothetical protein;  97.4 0.00021 4.6E-09   38.4   2.6   39   34-76    118-156 (160)
 39 PF12171 zf-C2H2_jaz:  Zinc-fin  97.2 0.00015 3.2E-09   27.3   0.7   20    1-20      2-21  (27)
 40 COG5189 SFP1 Putative transcri  97.1 0.00014   3E-09   43.0   0.4   20    1-20    350-371 (423)
 41 PF12874 zf-met:  Zinc-finger o  97.1 0.00051 1.1E-08   25.2   1.6   20   37-56      2-21  (25)
 42 COG5189 SFP1 Putative transcri  97.0 0.00013 2.8E-09   43.0  -0.3   51   33-83    347-418 (423)
 43 PF13909 zf-H2C2_5:  C2H2-type   96.4  0.0058 1.3E-07   22.1   2.3   19   64-83      1-19  (24)
 44 PF13913 zf-C2HC_2:  zinc-finge  96.4  0.0052 1.1E-07   22.7   2.1   20   36-56      3-22  (25)
 45 cd00350 rubredoxin_like Rubred  95.2   0.015 3.2E-07   22.9   1.3   24   36-71      2-25  (33)
 46 KOG2186|consensus               95.1   0.012 2.5E-07   34.0   1.2   46   35-83      3-48  (276)
 47 PRK04860 hypothetical protein;  95.0  0.0038 8.3E-08   33.7  -0.8   37    1-48    120-156 (160)
 48 KOG2893|consensus               94.8  0.0078 1.7E-07   34.5  -0.1   39   40-82     15-53  (341)
 49 COG2888 Predicted Zn-ribbon RN  94.5   0.039 8.4E-07   24.7   1.8   33   34-71     26-58  (61)
 50 smart00451 ZnF_U1 U1-like zinc  94.5   0.051 1.1E-06   21.3   2.1   21   63-83      3-23  (35)
 51 PF13717 zinc_ribbon_4:  zinc-r  94.3   0.033 7.1E-07   22.4   1.3   32    2-45      4-35  (36)
 52 PF09986 DUF2225:  Uncharacteri  94.3    0.03 6.5E-07   31.7   1.5   48    1-48      6-61  (214)
 53 PF12756 zf-C2H2_2:  C2H2 type   93.9   0.084 1.8E-06   25.6   2.6   25   35-59     50-74  (100)
 54 TIGR02098 MJ0042_CXXC MJ0042 f  93.8   0.035 7.5E-07   22.4   0.9   14    2-15      4-17  (38)
 55 COG5048 FOG: Zn-finger [Genera  93.8   0.031 6.7E-07   34.0   1.1   59    2-67    291-355 (467)
 56 COG4049 Uncharacterized protei  93.5   0.049 1.1E-06   24.1   1.2   26   31-56     13-38  (65)
 57 PF13719 zinc_ribbon_5:  zinc-r  93.5   0.047   1E-06   22.1   1.0   14    2-15      4-17  (37)
 58 KOG2893|consensus               93.3  0.0077 1.7E-07   34.5  -1.9   43    3-56     13-55  (341)
 59 COG5048 FOG: Zn-finger [Genera  93.2  0.0099 2.1E-07   36.1  -1.7   57   34-91    288-350 (467)
 60 PF09538 FYDLN_acid:  Protein o  93.2    0.14   3E-06   26.0   2.6   30   36-76     10-39  (108)
 61 PRK14890 putative Zn-ribbon RN  93.1    0.22 4.7E-06   22.4   2.9   34   33-71     23-56  (59)
 62 KOG1146|consensus               91.8   0.093   2E-06   37.0   1.3   22    1-22    466-487 (1406)
 63 KOG1146|consensus               91.6    0.18 3.8E-06   35.7   2.4   54   31-84    461-539 (1406)
 64 cd00729 rubredoxin_SM Rubredox  91.6    0.16 3.4E-06   20.2   1.4   25   35-71      2-26  (34)
 65 smart00531 TFIIE Transcription  91.5   0.098 2.1E-06   27.9   0.9   38   32-73     96-133 (147)
 66 COG1198 PriA Primosomal protei  91.4    0.21 4.6E-06   33.4   2.5   12   33-44    473-484 (730)
 67 TIGR00373 conserved hypothetic  91.2    0.24 5.2E-06   26.8   2.3   34   31-73    105-138 (158)
 68 COG1592 Rubrerythrin [Energy p  91.2     0.2 4.4E-06   27.4   2.0   25   34-71    133-157 (166)
 69 PHA00626 hypothetical protein   91.1    0.31 6.8E-06   21.6   2.1   14   34-47     22-35  (59)
 70 PRK00398 rpoP DNA-directed RNA  90.5    0.19   4E-06   21.3   1.2   11   35-45     21-31  (46)
 71 PF09723 Zn-ribbon_8:  Zinc rib  90.3    0.14   3E-06   21.3   0.7   15    1-15      6-20  (42)
 72 PRK00464 nrdR transcriptional   90.2    0.29 6.3E-06   26.4   2.0   17   34-50     27-43  (154)
 73 PRK06266 transcription initiat  89.4    0.38 8.2E-06   26.6   2.1   34   32-74    114-147 (178)
 74 PRK09678 DNA-binding transcrip  89.3    0.26 5.6E-06   23.1   1.2   40    1-49      2-43  (72)
 75 PF07754 DUF1610:  Domain of un  88.4     0.8 1.7E-05   16.7   2.0    9   34-42     15-23  (24)
 76 TIGR02300 FYDLN_acid conserved  88.3    0.41 8.9E-06   25.0   1.6   14   35-48     26-39  (129)
 77 PF02892 zf-BED:  BED zinc fing  88.3    0.68 1.5E-05   19.2   2.1   22   63-84     16-41  (45)
 78 cd00730 rubredoxin Rubredoxin;  88.1    0.83 1.8E-05   19.8   2.3   13    1-13      2-14  (50)
 79 KOG4173|consensus               87.8    0.15 3.3E-06   28.8  -0.1   51   37-87    108-170 (253)
 80 TIGR02605 CxxC_CxxC_SSSS putat  87.8    0.27 5.9E-06   21.2   0.7   13    1-13      6-18  (52)
 81 PF04959 ARS2:  Arsenite-resist  86.9     0.5 1.1E-05   27.0   1.6   24   64-87     78-101 (214)
 82 smart00614 ZnF_BED BED zinc fi  86.6     0.9 1.9E-05   19.5   2.0   10   36-45     19-28  (50)
 83 smart00659 RPOLCX RNA polymera  85.7    0.76 1.6E-05   19.4   1.5   10   36-45      3-12  (44)
 84 PF00301 Rubredoxin:  Rubredoxi  85.0    0.55 1.2E-05   20.1   0.9   15    1-15      2-16  (47)
 85 TIGR00595 priA primosomal prot  84.1     1.3 2.9E-05   28.5   2.7   10   34-43    252-261 (505)
 86 KOG2593|consensus               84.1     0.5 1.1E-05   29.7   0.8   19   34-52    127-145 (436)
 87 PF08790 zf-LYAR:  LYAR-type C2  83.9    0.27 5.8E-06   18.7  -0.2   18    1-19      1-18  (28)
 88 PRK14873 primosome assembly pr  83.4     1.2 2.6E-05   29.8   2.3   10   35-44    422-431 (665)
 89 COG1773 Rubredoxin [Energy pro  82.4     1.8 3.9E-05   19.2   2.0   15    1-15      4-18  (55)
 90 smart00734 ZnF_Rad18 Rad18-lik  82.3       2 4.3E-05   15.8   1.9   18   37-55      3-20  (26)
 91 KOG2186|consensus               79.8    0.48   1E-05   27.7  -0.3   50    1-60      4-53  (276)
 92 PF10571 UPF0547:  Uncharacteri  79.1     1.1 2.3E-05   16.6   0.7    8    3-10     17-24  (26)
 93 PF01096 TFIIS_C:  Transcriptio  77.9     1.8 3.8E-05   17.6   1.2   36    1-45      1-38  (39)
 94 TIGR03831 YgiT_finger YgiT-typ  77.3    0.89 1.9E-05   18.8   0.2   14   34-47     31-44  (46)
 95 PF14446 Prok-RING_1:  Prokaryo  77.0     1.3 2.9E-05   19.6   0.7   16    2-17      7-22  (54)
 96 smart00834 CxxC_CXXC_SSSS Puta  76.9    0.86 1.9E-05   18.4   0.1   13    1-13      6-18  (41)
 97 COG0068 HypF Hydrogenase matur  76.6    0.91   2E-05   30.5   0.2   31   37-73    153-183 (750)
 98 PF03811 Zn_Tnp_IS1:  InsA N-te  76.6     3.6 7.8E-05   16.5   1.9   14   28-41     22-35  (36)
 99 PF04959 ARS2:  Arsenite-resist  76.4     3.1 6.6E-05   23.9   2.2   26   32-57     74-99  (214)
100 KOG3408|consensus               75.5     2.4 5.3E-05   22.0   1.5   25   33-57     55-79  (129)
101 PRK05580 primosome assembly pr  75.4     3.8 8.2E-05   27.6   2.7   11   34-44    420-430 (679)
102 PF13878 zf-C2H2_3:  zinc-finge  75.3     1.4   3E-05   18.2   0.5   10    3-12     16-25  (41)
103 smart00661 RPOL9 RNA polymeras  75.2     4.3 9.4E-05   17.2   2.2   12   35-46     20-31  (52)
104 PF15269 zf-C2H2_7:  Zinc-finge  75.2     2.9 6.4E-05   17.7   1.5   20   64-83     21-40  (54)
105 COG1997 RPL43A Ribosomal prote  75.0     2.9 6.3E-05   20.4   1.6   30   35-74     35-64  (89)
106 TIGR00622 ssl1 transcription f  75.0       5 0.00011   20.6   2.6   84    2-88     17-105 (112)
107 PF08274 PhnA_Zn_Ribbon:  PhnA   74.7     1.6 3.5E-05   16.8   0.6    9   34-42     18-26  (30)
108 smart00440 ZnF_C2C2 C2C2 Zinc   74.4       5 0.00011   16.4   2.1   12   34-45     27-38  (40)
109 COG1198 PriA Primosomal protei  74.0     3.4 7.4E-05   28.1   2.3   47    3-72    438-484 (730)
110 PF05443 ROS_MUCR:  ROS/MUCR tr  73.6     2.6 5.7E-05   22.3   1.4   24   35-61     72-95  (132)
111 COG4530 Uncharacterized protei  73.0     2.8   6E-05   21.4   1.4   14   34-47     25-38  (129)
112 PF01286 XPA_N:  XPA protein N-  73.0     1.6 3.5E-05   17.3   0.4   16    2-17      5-20  (34)
113 smart00132 LIM Zinc-binding do  72.1     4.8  0.0001   15.5   1.8   12    2-13      1-12  (39)
114 PF10083 DUF2321:  Uncharacteri  71.7     3.5 7.5E-05   22.5   1.6   17   34-50     67-83  (158)
115 PF04606 Ogr_Delta:  Ogr/Delta-  71.4     1.4 3.1E-05   18.7   0.1   14    2-15      1-14  (47)
116 TIGR03830 CxxCG_CxxCG_HTH puta  71.1     3.5 7.5E-05   21.1   1.5   22   32-53     28-49  (127)
117 COG4306 Uncharacterized protei  70.4     5.1 0.00011   21.0   2.0   42    2-49     41-82  (160)
118 COG1996 RPC10 DNA-directed RNA  70.1     2.1 4.7E-05   18.5   0.5   10    1-10      7-16  (49)
119 PF12013 DUF3505:  Protein of u  70.0       7 0.00015   19.6   2.5   23   36-58     81-107 (109)
120 KOG1842|consensus               69.6     3.4 7.3E-05   26.4   1.5   26   34-59     14-39  (505)
121 PF04423 Rad50_zn_hook:  Rad50   68.7     1.7 3.6E-05   19.0   0.0    9   38-46     23-31  (54)
122 PF06524 NOA36:  NOA36 protein;  68.7     1.2 2.6E-05   26.3  -0.5   23   61-83    207-229 (314)
123 COG1779 C4-type Zn-finger prot  68.3     2.4 5.1E-05   24.0   0.6   35    2-46     16-54  (201)
124 COG3677 Transposase and inacti  67.9     2.4 5.3E-05   22.3   0.6   17    1-17     54-70  (129)
125 PTZ00255 60S ribosomal protein  67.5     3.2   7E-05   20.4   0.9   12   63-74     54-65  (90)
126 PF14353 CpXC:  CpXC protein     67.5     2.3 4.9E-05   22.1   0.4   18    1-18     39-56  (128)
127 PF09963 DUF2197:  Uncharacteri  67.4     1.1 2.4E-05   19.9  -0.6   36    2-43      4-39  (56)
128 TIGR01206 lysW lysine biosynth  67.3     3.1 6.8E-05   18.4   0.8   30    1-45      3-32  (54)
129 PF04780 DUF629:  Protein of un  67.1     6.4 0.00014   25.4   2.3   25   64-88     58-82  (466)
130 PF13824 zf-Mss51:  Zinc-finger  66.8       6 0.00013   17.6   1.6   10   34-43     13-22  (55)
131 PF07800 DUF1644:  Protein of u  65.8      17 0.00037   20.0   3.5   56   35-92     80-137 (162)
132 KOG2907|consensus               65.3       6 0.00013   20.3   1.6   39   34-74     73-113 (116)
133 COG4896 Uncharacterized protei  64.6       2 4.2E-05   19.5  -0.1   37    2-45      4-41  (68)
134 PF03604 DNA_RNApol_7kD:  DNA d  64.3       3 6.5E-05   16.3   0.4   11    1-11      1-11  (32)
135 KOG2785|consensus               64.2      16 0.00035   23.0   3.5   50   35-84    166-241 (390)
136 PRK03824 hypA hydrogenase nick  63.4     2.5 5.5E-05   22.3   0.1   15   34-48     69-83  (135)
137 TIGR00280 L37a ribosomal prote  62.4     3.3 7.3E-05   20.4   0.4   12   63-74     53-64  (91)
138 PF13451 zf-trcl:  Probable zin  62.4     2.7   6E-05   18.2   0.1   17   62-78      3-19  (49)
139 PRK12380 hydrogenase nickel in  61.7     4.3 9.4E-05   20.7   0.8   14   35-48     70-83  (113)
140 PF15135 UPF0515:  Uncharacteri  61.7     2.9 6.2E-05   24.6   0.1   12   35-46    155-166 (278)
141 COG3091 SprT Zn-dependent meta  61.0     4.5 9.8E-05   22.0   0.8   34   34-72    116-149 (156)
142 TIGR00340 zpr1_rel ZPR1-relate  59.4     4.8 0.00011   22.1   0.8   11   34-44     27-37  (163)
143 PF14369 zf-RING_3:  zinc-finge  58.9     4.4 9.6E-05   16.1   0.4   10    3-12     24-33  (35)
144 PF10013 DUF2256:  Uncharacteri  58.9     8.6 0.00019   16.1   1.3   12   65-76     10-21  (42)
145 KOG4167|consensus               58.0       2 4.4E-05   29.1  -0.9   26   35-60    792-817 (907)
146 smart00154 ZnF_AN1 AN1-like Zi  57.9     4.3 9.4E-05   16.5   0.3   13    1-13     13-25  (39)
147 PF04810 zf-Sec23_Sec24:  Sec23  57.7      13 0.00029   15.1   1.8   14   31-44     20-33  (40)
148 smart00709 Zpr1 Duplicated dom  57.0     5.6 0.00012   21.8   0.8   11   35-45     29-39  (160)
149 COG4957 Predicted transcriptio  56.4     8.5 0.00018   20.5   1.3   26   36-64     77-102 (148)
150 PF12156 ATPase-cat_bd:  Putati  56.1     5.7 0.00012   19.3   0.6   33    2-43      2-34  (88)
151 PF04780 DUF629:  Protein of un  55.7      13 0.00028   24.1   2.2   26   35-60     57-83  (466)
152 PRK12496 hypothetical protein;  55.6     8.6 0.00019   21.1   1.3   10   36-45    128-137 (164)
153 PF14311 DUF4379:  Domain of un  55.6      14 0.00031   16.0   1.8   14   35-48     28-41  (55)
154 PF05876 Terminase_GpA:  Phage   55.4      17 0.00037   24.1   2.8   40    2-48    202-242 (557)
155 KOG1280|consensus               55.3      21 0.00046   22.3   2.9   38   33-70     77-116 (381)
156 COG4888 Uncharacterized Zn rib  54.8     6.7 0.00015   19.8   0.8   11   34-44     21-31  (104)
157 COG4847 Uncharacterized protei  53.7     2.8   6E-05   20.8  -0.7   17    1-17      7-23  (103)
158 COG5236 Uncharacterized conser  53.4       8 0.00017   24.1   1.1   17    3-19    223-239 (493)
159 PF13821 DUF4187:  Domain of un  53.3     3.8 8.2E-05   18.2  -0.2   16    3-18     30-45  (55)
160 TIGR00100 hypA hydrogenase nic  53.1     6.5 0.00014   20.2   0.6   26   34-71     69-94  (115)
161 PF07975 C1_4:  TFIIH C1-like d  52.3       8 0.00017   16.9   0.7   20   33-52     19-38  (51)
162 COG1571 Predicted DNA-binding   51.3      13 0.00029   23.7   1.8   12   35-46    367-378 (421)
163 COG5151 SSL1 RNA polymerase II  51.0      28  0.0006   21.6   2.9   22   62-83    387-408 (421)
164 KOG2482|consensus               50.6      14  0.0003   23.1   1.7   21   64-84    196-216 (423)
165 PF02176 zf-TRAF:  TRAF-type zi  50.4     5.4 0.00012   17.5   0.0   38   35-73      9-52  (60)
166 PRK05452 anaerobic nitric oxid  50.2      14  0.0003   24.0   1.8   40   31-71    421-466 (479)
167 PF03107 C1_2:  C1 domain;  Int  49.9      10 0.00023   14.2   0.8    8   35-42     15-22  (30)
168 PF01428 zf-AN1:  AN1-like Zinc  49.8     4.6  0.0001   16.7  -0.2   12    2-13     15-26  (43)
169 TIGR00310 ZPR1_znf ZPR1 zinc f  48.5      21 0.00045   20.3   2.1   36    1-45      1-40  (192)
170 KOG2231|consensus               47.8      23 0.00051   24.2   2.5   16    3-18    185-200 (669)
171 PF06397 Desulfoferrod_N:  Desu  47.5     5.1 0.00011   16.1  -0.2    9    1-9       7-15  (36)
172 PF09943 DUF2175:  Uncharacteri  46.3       4 8.6E-05   20.6  -0.8   17    1-17      3-19  (101)
173 KOG0402|consensus               46.1     6.7 0.00014   19.0  -0.0    9    1-9      37-45  (92)
174 PF13240 zinc_ribbon_2:  zinc-r  46.0      14 0.00031   13.0   0.9    7    3-9       2-8   (23)
175 PF13696 zf-CCHC_2:  Zinc knuck  45.9     8.7 0.00019   15.0   0.3    6    2-7      10-15  (32)
176 KOG0801|consensus               45.6      12 0.00025   20.7   0.8   13    1-13    139-151 (205)
177 PF08792 A2L_zn_ribbon:  A2L zi  45.2     8.1 0.00018   15.1   0.2    8    3-10     24-31  (33)
178 PF00412 LIM:  LIM domain;  Int  45.0      14 0.00031   15.8   1.0   14    1-14     27-40  (58)
179 PF07503 zf-HYPF:  HypF finger;  44.5      12 0.00027   14.9   0.6   10   36-45     22-31  (35)
180 PRK00564 hypA hydrogenase nick  43.2      12 0.00026   19.3   0.7   14   34-47     70-83  (117)
181 TIGR00515 accD acetyl-CoA carb  42.9     8.8 0.00019   23.1   0.1   11   35-45     26-36  (285)
182 COG1675 TFA1 Transcription ini  42.5      31 0.00068   19.3   2.2   33   32-73    110-142 (176)
183 COG1594 RPB9 DNA-directed RNA   42.5      22 0.00047   18.3   1.5   38   35-74     72-111 (113)
184 PF11494 Ta0938:  Ta0938;  Inte  42.4      15 0.00033   18.4   0.9   35    2-48     16-50  (105)
185 PF08271 TF_Zn_Ribbon:  TFIIB z  42.4      10 0.00022   15.6   0.3    9    1-9       1-9   (43)
186 PLN02294 cytochrome c oxidase   42.2      17 0.00036   20.3   1.1   15   33-47    139-153 (174)
187 PF05741 zf-nanos:  Nanos RNA b  42.0       5 0.00011   17.8  -0.7   10   34-43     32-41  (55)
188 PF14803 Nudix_N_2:  Nudix N-te  41.7      17 0.00036   14.4   0.8   13   32-44     19-31  (34)
189 PF06689 zf-C4_ClpX:  ClpX C4-t  41.2      17 0.00038   14.9   0.9   16    2-17      3-18  (41)
190 PF07282 OrfB_Zn_ribbon:  Putat  41.1      38 0.00083   15.3   2.7   14   61-74     44-57  (69)
191 COG4338 Uncharacterized protei  40.8      12 0.00026   16.1   0.4   13   65-77     14-26  (54)
192 TIGR00319 desulf_FeS4 desulfof  40.7     9.1  0.0002   14.8  -0.0   10    1-10      8-17  (34)
193 cd00974 DSRD Desulforedoxin (D  40.7     9.3  0.0002   14.8   0.0   10    1-10      5-14  (34)
194 CHL00174 accD acetyl-CoA carbo  40.7      10 0.00022   23.0   0.2   11   36-46     58-68  (296)
195 KOG2231|consensus               40.5      31 0.00067   23.6   2.3   21   37-57    184-204 (669)
196 KOG3507|consensus               40.1      27 0.00057   15.8   1.4   30   33-73     18-47  (62)
197 PF01780 Ribosomal_L37ae:  Ribo  40.1      10 0.00023   18.7   0.1   11   35-45     53-63  (90)
198 PF13248 zf-ribbon_3:  zinc-rib  39.5      20 0.00044   12.9   0.9    7    2-8       4-10  (26)
199 PF03119 DNA_ligase_ZBD:  NAD-d  39.1      12 0.00027   13.9   0.3   13    2-14      1-13  (28)
200 PRK05654 acetyl-CoA carboxylas  38.6      21 0.00045   21.7   1.2   11   64-74     47-57  (292)
201 PRK01343 zinc-binding protein;  37.8      17 0.00036   16.3   0.6    9    2-10     11-19  (57)
202 PF05129 Elf1:  Transcription e  37.8      12 0.00026   18.0   0.2   13   35-47     46-58  (81)
203 PF10276 zf-CHCC:  Zinc-finger   37.7      24 0.00051   14.6   1.0   12   34-45     28-39  (40)
204 KOG3214|consensus               37.6      18 0.00038   18.3   0.7   14   63-76     47-60  (109)
205 cd00924 Cyt_c_Oxidase_Vb Cytoc  37.5      22 0.00047   17.8   1.0   13   34-46     78-90  (97)
206 TIGR00244 transcriptional regu  37.5      15 0.00033   19.9   0.5   16    2-17     30-45  (147)
207 PF11781 RRN7:  RNA polymerase   37.4      18 0.00039   14.4   0.6    7    3-9      11-17  (36)
208 KOG4602|consensus               36.8      17 0.00036   21.7   0.6    9   35-43    268-276 (318)
209 COG3364 Zn-ribbon containing p  35.6      26 0.00057   17.8   1.1   26   35-70      2-27  (112)
210 PF01844 HNH:  HNH endonuclease  35.6      17 0.00036   14.8   0.4   16    3-18      1-16  (47)
211 PRK03976 rpl37ae 50S ribosomal  35.4      18 0.00038   17.9   0.5   12   35-46     54-65  (90)
212 PHA02998 RNA polymerase subuni  34.9      50  0.0011   18.7   2.2   12   64-75    172-183 (195)
213 PF14255 Cys_rich_CPXG:  Cystei  34.7      20 0.00044   15.7   0.6   15    1-15      1-15  (52)
214 TIGR03829 YokU_near_AblA uncha  34.1      14 0.00031   18.2   0.1   15   38-52     38-52  (89)
215 PF10367 Vps39_2:  Vacuolar sor  34.0      23 0.00049   17.4   0.8   12    2-13     80-91  (109)
216 smart00504 Ubox Modified RING   33.1      28 0.00061   15.1   1.0   12    1-12      2-13  (63)
217 PRK05978 hypothetical protein;  33.1      37 0.00081   18.5   1.5   16   37-52     35-50  (148)
218 PF03367 zf-ZPR1:  ZPR1 zinc-fi  32.7     5.6 0.00012   21.8  -1.6   10   35-44     30-39  (161)
219 PF10272 Tmpp129:  Putative tra  32.6      16 0.00034   22.9   0.1   10   36-45    341-350 (358)
220 TIGR01384 TFS_arch transcripti  32.5      54  0.0012   16.2   2.0   38   35-74     62-101 (104)
221 PRK00420 hypothetical protein;  32.0      50  0.0011   17.1   1.8   12   35-46     40-51  (112)
222 smart00507 HNHc HNH nucleases.  32.0      42 0.00091   13.5   1.4   11    2-12     12-22  (52)
223 smart00064 FYVE Protein presen  31.8      58  0.0013   14.6   2.0    9   37-45     12-20  (68)
224 TIGR00143 hypF [NiFe] hydrogen  31.5      12 0.00026   25.6  -0.5   31   37-73    120-150 (711)
225 PF04981 NMD3:  NMD3 family ;    31.2      52  0.0011   19.2   2.0   13   34-46     34-46  (236)
226 KOG0978|consensus               31.0      17 0.00037   24.9   0.1   21   58-78    673-693 (698)
227 PF05191 ADK_lid:  Adenylate ki  30.9      20 0.00042   14.3   0.2   13    2-14      3-15  (36)
228 KOG2906|consensus               30.6      29 0.00062   17.5   0.8   13   34-46     20-32  (105)
229 PF14375 Cys_rich_CWC:  Cystein  30.4      27 0.00058   14.9   0.6   11    3-13      1-11  (50)
230 COG1326 Uncharacterized archae  30.3      74  0.0016   18.3   2.4   10   63-72     30-39  (201)
231 PF06170 DUF983:  Protein of un  30.2      29 0.00063   16.9   0.8   12    2-13     10-21  (86)
232 PF14787 zf-CCHC_5:  GAG-polypr  30.2      18 0.00038   14.6   0.0   13   65-77      4-16  (36)
233 cd01410 SIRT7 SIRT7: Eukaryoti  30.0 1.1E+02  0.0025   17.4   3.6   43   27-72     87-129 (206)
234 KOG2636|consensus               29.8      47   0.001   21.7   1.8   28   30-57    396-424 (497)
235 KOG2272|consensus               29.8      20 0.00044   21.4   0.2   21   27-47    213-233 (332)
236 PF05766 NinG:  Bacteriophage L  29.7      30 0.00065   19.7   0.9   16    2-17      8-23  (189)
237 COG1327 Predicted transcriptio  29.6      25 0.00054   19.2   0.5   17    2-18     30-46  (156)
238 COG5112 UFD2 U1-like Zn-finger  29.5      29 0.00063   17.8   0.7   25   32-56     52-76  (126)
239 PRK14138 NAD-dependent deacety  29.4 1.3E+02  0.0027   17.8   3.5   42   27-72    111-152 (244)
240 PF09845 DUF2072:  Zn-ribbon co  28.7      40 0.00087   18.0   1.2   17    1-17      2-18  (131)
241 PF03884 DUF329:  Domain of unk  28.2      20 0.00043   16.1   0.0   11    2-12      4-14  (57)
242 cd01413 SIR2_Af2 SIR2_Af2: Arc  28.1 1.2E+02  0.0027   17.4   3.2   41   27-72    105-145 (222)
243 PF14149 YhfH:  YhfH-like prote  27.7     6.3 0.00014   16.0  -1.4    8    3-10     16-23  (37)
244 PF08209 Sgf11:  Sgf11 (transcr  27.6      34 0.00073   13.5   0.6   21   35-56      4-24  (33)
245 PF02891 zf-MIZ:  MIZ/SP-RING z  27.4      53  0.0011   14.1   1.3    9   63-71     41-49  (50)
246 PF14599 zinc_ribbon_6:  Zinc-r  27.3      18 0.00039   16.5  -0.2   22    3-24     33-54  (61)
247 PLN02748 tRNA dimethylallyltra  27.3      65  0.0014   21.2   2.1   25   34-58    417-442 (468)
248 COG3024 Uncharacterized protei  27.2      29 0.00063   16.0   0.5    8    2-9       9-16  (65)
249 COG4391 Uncharacterized protei  27.0      44 0.00095   15.3   1.0   13   34-46     47-59  (62)
250 COG1655 Uncharacterized protei  26.6      27 0.00058   20.6   0.4   18    1-18     20-37  (267)
251 PF01194 RNA_pol_N:  RNA polyme  26.5      57  0.0012   14.8   1.3   18   62-79      3-20  (60)
252 PF10263 SprT-like:  SprT-like   26.3      32  0.0007   18.3   0.6   33   34-74    122-154 (157)
253 PF04216 FdhE:  Protein involve  26.2      28 0.00061   20.9   0.4   36   34-70    210-245 (290)
254 TIGR00686 phnA alkylphosphonat  26.1      59  0.0013   16.7   1.5   13   34-46     18-30  (109)
255 KOG0717|consensus               26.1      58  0.0013   21.4   1.7   22   36-57    293-314 (508)
256 COG1644 RPB10 DNA-directed RNA  26.0      65  0.0014   14.8   1.4   12   35-46      4-15  (63)
257 PF08996 zf-DNA_Pol:  DNA Polym  25.7      44 0.00095   18.8   1.1   38    1-46     19-56  (188)
258 PF01927 Mut7-C:  Mut7-C RNAse   25.7      33 0.00071   18.4   0.6   13   63-75    124-136 (147)
259 TIGR01385 TFSII transcription   25.6      83  0.0018   19.3   2.3   37   35-73    258-296 (299)
260 COG0777 AccD Acetyl-CoA carbox  25.3      58  0.0013   19.9   1.5    8   36-43     29-36  (294)
261 KOG2879|consensus               25.3      51  0.0011   20.1   1.3   12   62-73    275-286 (298)
262 KOG1088|consensus               25.2      38 0.00082   17.7   0.7   21   28-48     91-111 (124)
263 smart00746 TRASH metallochaper  25.0      47   0.001   11.7   0.9    9    3-11      1-9   (39)
264 PRK00481 NAD-dependent deacety  24.7 1.2E+02  0.0027   17.7   2.8   38   27-72    114-151 (242)
265 PF14122 YokU:  YokU-like prote  24.5      24 0.00052   17.3  -0.1   14    2-15     37-50  (87)
266 PRK08222 hydrogenase 4 subunit  24.5      73  0.0016   17.8   1.8   19   62-80    113-131 (181)
267 COG3357 Predicted transcriptio  24.4      41 0.00089   16.7   0.7   14   62-75     57-70  (97)
268 COG1885 Uncharacterized protei  24.3      39 0.00085   17.2   0.7   11    2-12     51-61  (115)
269 PF14354 Lar_restr_allev:  Rest  24.2      36 0.00079   14.9   0.5    8    2-9       5-12  (61)
270 PLN03238 probable histone acet  24.1 1.5E+02  0.0032   18.3   3.0   25   33-57     46-70  (290)
271 PF10537 WAC_Acf1_DNA_bd:  ATP-  24.0 1.1E+02  0.0025   15.4   3.8   35   36-71      4-38  (102)
272 PRK10220 hypothetical protein;  24.0   1E+02  0.0022   16.0   2.0   14   34-47     19-32  (111)
273 PF02146 SIR2:  Sir2 family;  I  23.9      24 0.00052   19.4  -0.1   43   27-73     97-139 (178)
274 PF09779 Ima1_N:  Ima1 N-termin  23.9 1.2E+02  0.0027   15.9   2.5    9   35-43     20-28  (131)
275 PF13408 Zn_ribbon_recom:  Reco  23.8      29 0.00063   14.8   0.1   11    2-12      7-17  (58)
276 PHA02446 hypothetical protein   23.7      37  0.0008   17.7   0.5   20   26-45     79-98  (166)
277 KOG3399|consensus               23.7   1E+02  0.0022   16.3   2.0   18    1-18     16-33  (122)
278 COG0675 Transposase and inacti  23.6      91   0.002   18.7   2.3   12   62-73    321-332 (364)
279 PF09297 zf-NADH-PPase:  NADH p  23.6      27 0.00059   13.2   0.0   10   34-43     20-29  (32)
280 TIGR00570 cdk7 CDK-activating   23.6 1.1E+02  0.0023   19.0   2.5    9    1-9       4-12  (309)
281 PRK04016 DNA-directed RNA poly  23.4      94   0.002   14.3   1.8   13   35-47      4-16  (62)
282 PHA02942 putative transposase;  22.9 1.1E+02  0.0023   19.5   2.4   12   62-73    341-352 (383)
283 PF03966 Trm112p:  Trm112p-like  22.8      31 0.00068   15.7   0.1   18   29-46     47-64  (68)
284 PF07295 DUF1451:  Protein of u  22.7      17 0.00037   19.6  -0.8   29   33-71    110-138 (146)
285 PTZ00448 hypothetical protein;  22.3      90  0.0019   19.9   2.0   23   35-57    314-336 (373)
286 PF01363 FYVE:  FYVE zinc finge  22.3      54  0.0012   14.7   0.9   10    2-11     11-20  (69)
287 smart00731 SprT SprT homologue  22.0      48   0.001   17.7   0.8   33   34-73    111-143 (146)
288 PF15616 TerY-C:  TerY-C metal   22.0      71  0.0015   17.1   1.4   13   60-72    102-114 (131)
289 PRK00418 DNA gyrase inhibitor;  22.0      45 0.00098   15.3   0.6    9    2-10      8-16  (62)
290 TIGR00627 tfb4 transcription f  21.8 1.1E+02  0.0025   18.6   2.3   12   35-46    255-266 (279)
291 PTZ00043 cytochrome c oxidase   21.7      52  0.0011   19.5   0.9   16   32-47    178-193 (268)
292 PF13445 zf-RING_UBOX:  RING-ty  21.7      44 0.00095   13.9   0.5   14   35-49     14-27  (43)
293 PRK12860 transcriptional activ  21.5      61  0.0013   18.5   1.1   29   34-70    133-161 (189)
294 cd00065 FYVE FYVE domain; Zinc  21.5      83  0.0018   13.4   1.4   10    3-12      5-14  (57)
295 KOG1994|consensus               21.4      55  0.0012   19.3   0.9   23   60-82    236-258 (268)
296 TIGR03826 YvyF flagellar opero  20.8      32 0.00069   18.5  -0.0   11    2-12      5-15  (137)
297 TIGR03655 anti_R_Lar restricti  20.8      44 0.00096   14.4   0.4   12   36-47     27-38  (53)
298 PRK12722 transcriptional activ  20.7      64  0.0014   18.4   1.1   29   35-71    134-162 (187)
299 PF01396 zf-C4_Topoisom:  Topoi  20.7      39 0.00084   13.6   0.2    7    2-8       3-9   (39)
300 COG0846 SIR2 NAD-dependent pro  20.2      83  0.0018   18.8   1.5   41   27-71    114-154 (250)
301 COG2995 PqiA Uncharacterized p  20.2 1.1E+02  0.0023   19.9   2.0   16    2-18     20-35  (418)

No 1  
>KOG2462|consensus
Probab=99.90  E-value=3.4e-24  Score=119.34  Aligned_cols=89  Identities=25%  Similarity=0.428  Sum_probs=62.8

Q ss_pred             CcccccccccccccccccccccCC------------------------CCCCCCCCCCceeCCCCCccCCCHHHHHHHHH
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRC------------------------SNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIR   56 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~------------------------~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~   56 (92)
                      |+|.+|++.+.+.++|-.|..-.+                        .|.++|+  .++.|.+||+.|.....|+.|+|
T Consensus       131 ~~c~eCgk~ysT~snLsrHkQ~H~~~~s~ka~~C~~C~K~YvSmpALkMHirTH~--l~c~C~iCGKaFSRPWLLQGHiR  208 (279)
T KOG2462|consen  131 YKCPECGKSYSTSSNLSRHKQTHRSLDSKKAFSCKYCGKVYVSMPALKMHIRTHT--LPCECGICGKAFSRPWLLQGHIR  208 (279)
T ss_pred             eeccccccccccccccchhhcccccccccccccCCCCCceeeehHHHhhHhhccC--CCcccccccccccchHHhhcccc
Confidence            356666666666666665521111                        3444444  46778888888888888888888


Q ss_pred             HhhCCCCccCCcCccccCChHHHHHHHHHhccCCCC
Q psy5652          57 THTGERPFKCEFCAHSATSKSNLKMHIMVKHQNDFV   92 (92)
Q Consensus        57 ~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~h~~~~p   92 (92)
                      +|+|||||.|+.|+++|...+||..|+ ++|.+.|+
T Consensus       209 THTGEKPF~C~hC~kAFADRSNLRAHm-QTHS~~K~  243 (279)
T KOG2462|consen  209 THTGEKPFSCPHCGKAFADRSNLRAHM-QTHSDVKK  243 (279)
T ss_pred             cccCCCCccCCcccchhcchHHHHHHH-HhhcCCcc
Confidence            888888888888888888888888888 88877653


No 2  
>KOG2462|consensus
Probab=99.87  E-value=9.7e-23  Score=113.60  Aligned_cols=76  Identities=20%  Similarity=0.404  Sum_probs=70.6

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccCChHHHH
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSATSKSNLK   80 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~   80 (92)
                      ++|.+|||.|.+.=.|+       .|.++|+++|||.|+.|+++|.+.++|..|+++|.+.|+|+|..|+|.|...+-|.
T Consensus       188 c~C~iCGKaFSRPWLLQ-------GHiRTHTGEKPF~C~hC~kAFADRSNLRAHmQTHS~~K~~qC~~C~KsFsl~SyLn  260 (279)
T KOG2462|consen  188 CECGICGKAFSRPWLLQ-------GHIRTHTGEKPFSCPHCGKAFADRSNLRAHMQTHSDVKKHQCPRCGKSFALKSYLN  260 (279)
T ss_pred             cccccccccccchHHhh-------cccccccCCCCccCCcccchhcchHHHHHHHHhhcCCccccCcchhhHHHHHHHHH
Confidence            36788888888887777       68999999999999999999999999999999999999999999999999999999


Q ss_pred             HHH
Q psy5652          81 MHI   83 (92)
Q Consensus        81 ~h~   83 (92)
                      +|.
T Consensus       261 KH~  263 (279)
T KOG2462|consen  261 KHS  263 (279)
T ss_pred             Hhh
Confidence            997


No 3  
>KOG3576|consensus
Probab=99.72  E-value=2.1e-19  Score=96.97  Aligned_cols=81  Identities=27%  Similarity=0.547  Sum_probs=76.5

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccCChHHHH
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSATSKSNLK   80 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~   80 (92)
                      |.|.+|++.|....-|.+       |+..|.+.+.+-|..||++|-..-.|++|+++|+|.+||+|..|+++|.+.-.|.
T Consensus       118 ftCrvCgK~F~lQRmlnr-------h~kch~~vkr~lct~cgkgfndtfdlkrh~rthtgvrpykc~~c~kaftqrcsle  190 (267)
T KOG3576|consen  118 FTCRVCGKKFGLQRMLNR-------HLKCHSDVKRHLCTFCGKGFNDTFDLKRHTRTHTGVRPYKCSLCEKAFTQRCSLE  190 (267)
T ss_pred             eeeehhhhhhhHHHHHHH-------HhhhccHHHHHHHhhccCcccchhhhhhhhccccCccccchhhhhHHHHhhccHH
Confidence            579999999999999984       7899999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhcc
Q psy5652          81 MHIMVKHQ   88 (92)
Q Consensus        81 ~h~~~~h~   88 (92)
                      .|+++.|.
T Consensus       191 shl~kvhg  198 (267)
T KOG3576|consen  191 SHLKKVHG  198 (267)
T ss_pred             HHHHHHcC
Confidence            99987774


No 4  
>KOG3623|consensus
Probab=99.65  E-value=8.7e-18  Score=104.13  Aligned_cols=76  Identities=20%  Similarity=0.493  Sum_probs=72.4

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccCChHHHH
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSATSKSNLK   80 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~   80 (92)
                      |.|..|++.|...+.|.+       |...|++.+||.|.+|.++|..+-.|..|.|.|.|+|||+|..|+|.|..++...
T Consensus       895 yaCDqCDK~FqKqSSLaR-------HKYEHsGqRPyqC~iCkKAFKHKHHLtEHkRLHSGEKPfQCdKClKRFSHSGSYS  967 (1007)
T KOG3623|consen  895 YACDQCDKAFQKQSSLAR-------HKYEHSGQRPYQCIICKKAFKHKHHLTEHKRLHSGEKPFQCDKCLKRFSHSGSYS  967 (1007)
T ss_pred             chHHHHHHHHHhhHHHHH-------hhhhhcCCCCcccchhhHhhhhhhhhhhhhhhccCCCcchhhhhhhhcccccchH
Confidence            679999999999999995       7889999999999999999999999999999999999999999999999999998


Q ss_pred             HHH
Q psy5652          81 MHI   83 (92)
Q Consensus        81 ~h~   83 (92)
                      .|+
T Consensus       968 QHM  970 (1007)
T KOG3623|consen  968 QHM  970 (1007)
T ss_pred             hhh
Confidence            886


No 5  
>KOG3623|consensus
Probab=99.46  E-value=6.2e-15  Score=91.81  Aligned_cols=83  Identities=19%  Similarity=0.490  Sum_probs=68.8

Q ss_pred             CcccccccccccccccccccccC--CC----CCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccC
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKR--CS----NMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSAT   74 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~--~~----~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   74 (92)
                      |.|..|...|.+...|.+|+...  +.    +...-...+.|.|.+||++|..+-.|+.|+|+|.|+|||.|+.|+|.|.
T Consensus       241 fsC~lCsytFAyRtQLErhm~~hkpg~dqa~sltqsa~lRKFKCtECgKAFKfKHHLKEHlRIHSGEKPfeCpnCkKRFS  320 (1007)
T KOG3623|consen  241 FSCMLCSYTFAYRTQLERHMQLHKPGGDQAISLTQSALLRKFKCTECGKAFKFKHHLKEHLRIHSGEKPFECPNCKKRFS  320 (1007)
T ss_pred             CcchhhhhhhhhHHHHHHHHHhhcCCCcccccccchhhhccccccccchhhhhHHHHHhhheeecCCCCcCCcccccccc
Confidence            57999999999999998875332  11    1122233468999999999999999999999999999999999999999


Q ss_pred             ChHHHHHHH
Q psy5652          75 SKSNLKMHI   83 (92)
Q Consensus        75 ~~~~l~~h~   83 (92)
                      .++.+..|+
T Consensus       321 HSGSySSHm  329 (1007)
T KOG3623|consen  321 HSGSYSSHM  329 (1007)
T ss_pred             cCCcccccc
Confidence            999888886


No 6  
>PHA00733 hypothetical protein
Probab=99.40  E-value=5.7e-13  Score=68.65  Aligned_cols=83  Identities=19%  Similarity=0.233  Sum_probs=66.6

Q ss_pred             cccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccCChHHHHH
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSATSKSNLKM   81 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~   81 (92)
                      .|.+|.+.|.....|..+..-. .++..++ .++|.|+.|++.|.....|..|++.+  ..+|.|..|++.|.....|..
T Consensus        42 ~~~~~~~~~~~~~~l~~~~~l~-~~~~~~~-~kPy~C~~Cgk~Fss~s~L~~H~r~h--~~~~~C~~CgK~F~~~~sL~~  117 (128)
T PHA00733         42 IRAVVKTLIYNPQLLDESSYLY-KLLTSKA-VSPYVCPLCLMPFSSSVSLKQHIRYT--EHSKVCPVCGKEFRNTDSTLD  117 (128)
T ss_pred             HHHHHhhhccChhhhcchHHHH-hhcccCC-CCCccCCCCCCcCCCHHHHHHHHhcC--CcCccCCCCCCccCCHHHHHH
Confidence            5888999988887777542111 2334444 67999999999999999999999876  457999999999999999999


Q ss_pred             HHHHhcc
Q psy5652          82 HIMVKHQ   88 (92)
Q Consensus        82 h~~~~h~   88 (92)
                      |+...|.
T Consensus       118 H~~~~h~  124 (128)
T PHA00733        118 HVCKKHN  124 (128)
T ss_pred             HHHHhcC
Confidence            9977775


No 7  
>PHA02768 hypothetical protein; Provisional
Probab=99.28  E-value=2.2e-12  Score=56.59  Aligned_cols=43  Identities=23%  Similarity=0.400  Sum_probs=39.3

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccCChHHH
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSATSKSNL   79 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l   79 (92)
                      .|.|+.||+.|...+.|..|++.|+  ++++|..|++.|.+.+.|
T Consensus         5 ~y~C~~CGK~Fs~~~~L~~H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          5 GYECPICGEIYIKRKSMITHLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             ccCcchhCCeeccHHHHHHHHHhcC--CcccCCcccceeccccee
Confidence            5899999999999999999999998  789999999999877665


No 8  
>KOG3576|consensus
Probab=99.23  E-value=6.3e-12  Score=68.48  Aligned_cols=79  Identities=18%  Similarity=0.401  Sum_probs=67.5

Q ss_pred             cccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhC-----------CCCccCCcCc
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTG-----------ERPFKCEFCA   70 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~-----------~~~~~c~~c~   70 (92)
                      -|..||+.|.+--||.+       |+++|++.+||.|..|+++|...-.|..|.+.-.|           ++-|.|.+||
T Consensus       147 lct~cgkgfndtfdlkr-------h~rthtgvrpykc~~c~kaftqrcsleshl~kvhgv~~~yaykerr~kl~vcedcg  219 (267)
T KOG3576|consen  147 LCTFCGKGFNDTFDLKR-------HTRTHTGVRPYKCSLCEKAFTQRCSLESHLKKVHGVQHQYAYKERRAKLYVCEDCG  219 (267)
T ss_pred             HHhhccCcccchhhhhh-------hhccccCccccchhhhhHHHHhhccHHHHHHHHcCchHHHHHHHhhhheeeecccC
Confidence            48899999999999994       89999999999999999999999999988874333           4679999999


Q ss_pred             cccCChHHHHHHHHHhc
Q psy5652          71 HSATSKSNLKMHIMVKH   87 (92)
Q Consensus        71 ~~~~~~~~l~~h~~~~h   87 (92)
                      ..-.....+..|+..-|
T Consensus       220 ~t~~~~e~~~~h~~~~h  236 (267)
T KOG3576|consen  220 YTSERPEVYYLHLKLHH  236 (267)
T ss_pred             CCCCChhHHHHHHHhcC
Confidence            88888888888884333


No 9  
>KOG3608|consensus
Probab=99.17  E-value=2.5e-11  Score=70.86  Aligned_cols=83  Identities=16%  Similarity=0.419  Sum_probs=42.6

Q ss_pred             cccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCc--CccccCChHHH
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEF--CAHSATSKSNL   79 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~--c~~~~~~~~~l   79 (92)
                      +|+.|++.....+.|..|+      +..|...++|.|..|+..+...+.|++|...|. +..|+|..  |...+++...+
T Consensus       265 kCplCdmtc~~~ssL~~H~------r~rHs~dkpfKCd~Cd~~c~~esdL~kH~~~HS-~~~y~C~h~~C~~s~r~~~q~  337 (467)
T KOG3608|consen  265 KCPLCDMTCSSASSLTTHI------RYRHSKDKPFKCDECDTRCVRESDLAKHVQVHS-KTVYQCEHPDCHYSVRTYTQM  337 (467)
T ss_pred             cccccccCCCChHHHHHHH------HhhhccCCCccccchhhhhccHHHHHHHHHhcc-ccceecCCCCCcHHHHHHHHH
Confidence            3444444444444444332      344555566666666666666666666666554 33455543  55555555555


Q ss_pred             HHHHHHhccCCC
Q psy5652          80 KMHIMVKHQNDF   91 (92)
Q Consensus        80 ~~h~~~~h~~~~   91 (92)
                      .+|....|.|..
T Consensus       338 ~~H~~evhEg~n  349 (467)
T KOG3608|consen  338 RRHFLEVHEGNN  349 (467)
T ss_pred             HHHHHHhccCCC
Confidence            555544444433


No 10 
>KOG1074|consensus
Probab=99.17  E-value=2.2e-12  Score=81.53  Aligned_cols=80  Identities=23%  Similarity=0.488  Sum_probs=67.2

Q ss_pred             cccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCC----CCccCC---cCccccC
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGE----RPFKCE---FCAHSAT   74 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~----~~~~c~---~c~~~~~   74 (92)
                      .|-+|.+.+...+.|++       |.++|++++||.|.+||++|..+.+|+.|+.+|...    ..+.|+   .|.+-|.
T Consensus       607 qCiiC~rVlSC~saLqm-------HyrtHtGERPFkCKiCgRAFtTkGNLkaH~~vHka~p~~R~q~ScP~~~ic~~kft  679 (958)
T KOG1074|consen  607 QCIICLRVLSCPSALQM-------HYRTHTGERPFKCKICGRAFTTKGNLKAHMSVHKAKPPARVQFSCPSTFICQKKFT  679 (958)
T ss_pred             ceeeeeecccchhhhhh-------hhhcccCcCccccccccchhccccchhhcccccccCccccccccCCchhhhccccc
Confidence            48889999999999996       678999999999999999999999999999888754    347788   7888888


Q ss_pred             ChHHHHHHHHHhccC
Q psy5652          75 SKSNLKMHIMVKHQN   89 (92)
Q Consensus        75 ~~~~l~~h~~~~h~~   89 (92)
                      ..-.|..|+ ++|++
T Consensus       680 n~V~lpQhI-riH~~  693 (958)
T KOG1074|consen  680 NAVTLPQHI-RIHLG  693 (958)
T ss_pred             ccccccceE-EeecC
Confidence            888888888 88873


No 11 
>KOG3608|consensus
Probab=99.11  E-value=1.4e-11  Score=71.89  Aligned_cols=60  Identities=28%  Similarity=0.602  Sum_probs=50.0

Q ss_pred             CCCCCCCCCceeCCCCCccCCCHHHHHHHHHH-hhCCCCccCCcCccccCChHHHHHHHHHhcc
Q psy5652          26 NMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRT-HTGERPFKCEFCAHSATSKSNLKMHIMVKHQ   88 (92)
Q Consensus        26 ~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~-~~~~~~~~c~~c~~~~~~~~~l~~h~~~~h~   88 (92)
                      |++.|..  .|.|+.|+.+....+.|..|++. |...+||+|..|.+.+.+.+.|.+|. ..|.
T Consensus       256 Hv~rHvn--~ykCplCdmtc~~~ssL~~H~r~rHs~dkpfKCd~Cd~~c~~esdL~kH~-~~HS  316 (467)
T KOG3608|consen  256 HVVRHVN--CYKCPLCDMTCSSASSLTTHIRYRHSKDKPFKCDECDTRCVRESDLAKHV-QVHS  316 (467)
T ss_pred             HHHHhhh--cccccccccCCCChHHHHHHHHhhhccCCCccccchhhhhccHHHHHHHH-Hhcc
Confidence            3444443  58999999999999999999987 66679999999999999999999998 6775


No 12 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=99.03  E-value=2.4e-10  Score=43.30  Aligned_cols=26  Identities=50%  Similarity=1.210  Sum_probs=23.3

Q ss_pred             HHHHHHHHhhCCCCccCCcCccccCC
Q psy5652          50 RMKRHIRTHTGERPFKCEFCAHSATS   75 (92)
Q Consensus        50 ~l~~h~~~~~~~~~~~c~~c~~~~~~   75 (92)
                      +|..|++.|++++||.|..|++.|.+
T Consensus         1 ~l~~H~~~H~~~k~~~C~~C~k~F~~   26 (26)
T PF13465_consen    1 NLRRHMRTHTGEKPYKCPYCGKSFSN   26 (26)
T ss_dssp             HHHHHHHHHSSSSSEEESSSSEEESS
T ss_pred             CHHHHhhhcCCCCCCCCCCCcCeeCc
Confidence            47899999999999999999998863


No 13 
>KOG1074|consensus
Probab=99.00  E-value=2e-10  Score=73.03  Aligned_cols=54  Identities=41%  Similarity=0.752  Sum_probs=50.6

Q ss_pred             eeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccCChHHHHHHHHHhccCC
Q psy5652          36 YVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSATSKSNLKMHIMVKHQND   90 (92)
Q Consensus        36 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~h~~~   90 (92)
                      ..|.+||+.|.+.+.|+.|+++|+++|||.|..|++.|....+|..|+ .+|...
T Consensus       880 h~C~vCgk~FsSSsALqiH~rTHtg~KPF~C~fC~~aFttrgnLKvHM-gtH~w~  933 (958)
T KOG1074|consen  880 HVCNVCGKQFSSSAALEIHMRTHTGPKPFFCHFCEEAFTTRGNLKVHM-GTHMWV  933 (958)
T ss_pred             hhhccchhcccchHHHHHhhhcCCCCCCccchhhhhhhhhhhhhhhhh-cccccc
Confidence            679999999999999999999999999999999999999999999999 788644


No 14 
>PHA02768 hypothetical protein; Provisional
Probab=98.85  E-value=1.5e-10  Score=50.81  Aligned_cols=42  Identities=10%  Similarity=0.240  Sum_probs=35.9

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHH
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRM   51 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l   51 (92)
                      |.|+.||+.|...+.|..       |+++|+  +++.|..|++.|...+.|
T Consensus         6 y~C~~CGK~Fs~~~~L~~-------H~r~H~--k~~kc~~C~k~f~~~s~l   47 (55)
T PHA02768          6 YECPICGEIYIKRKSMIT-------HLRKHN--TNLKLSNCKRISLRTGEY   47 (55)
T ss_pred             cCcchhCCeeccHHHHHH-------HHHhcC--CcccCCcccceeccccee
Confidence            689999999999999995       678888  588999999988765544


No 15 
>KOG3993|consensus
Probab=98.76  E-value=1.2e-09  Score=65.19  Aligned_cols=80  Identities=21%  Similarity=0.425  Sum_probs=63.0

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhC--------CC----------
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTG--------ER----------   62 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~--------~~----------   62 (92)
                      |+|..|...|.+--.|.+|.|.+=       ....|.|++|++.|.-..+|..|.|+|.-        ..          
T Consensus       268 yiCqLCK~kYeD~F~LAQHrC~RI-------V~vEYrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~ra  340 (500)
T KOG3993|consen  268 YICQLCKEKYEDAFALAQHRCPRI-------VHVEYRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRA  340 (500)
T ss_pred             HHHHHHHHhhhhHHHHhhccCCee-------EEeeecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhh
Confidence            578899999999988988765221       22468999999999999999999887631        11          


Q ss_pred             ---------------CccCCcCccccCChHHHHHHHHHhcc
Q psy5652          63 ---------------PFKCEFCAHSATSKSNLKMHIMVKHQ   88 (92)
Q Consensus        63 ---------------~~~c~~c~~~~~~~~~l~~h~~~~h~   88 (92)
                                     -|.|..|++.|.+...|.+|+ .+|.
T Consensus       341 e~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKHq-lthq  380 (500)
T KOG3993|consen  341 EVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKHQ-LTHQ  380 (500)
T ss_pred             hhhhccccCCcccCceeecHHhhhhhHHHHHHHHhH-Hhhh
Confidence                           278999999999999999998 6663


No 16 
>PHA00616 hypothetical protein
Probab=98.70  E-value=1.1e-08  Score=42.99  Aligned_cols=34  Identities=18%  Similarity=0.490  Sum_probs=28.2

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCc
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEF   68 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~   68 (92)
                      +|.|+.||..|.....+..|++.|+|++++.+..
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~r~~hg~~~~~~~~   34 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHLLSVHKQNKLTLEY   34 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHHHHhcCCCccceeE
Confidence            5788888888888888888888888888887653


No 17 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.69  E-value=1.9e-08  Score=62.67  Aligned_cols=61  Identities=21%  Similarity=0.413  Sum_probs=39.2

Q ss_pred             cccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccC
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSAT   74 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   74 (92)
                      .|..|++.|. ..+|..|       +.++.  +++.|+ |+..+ ....|..|+..+...+++.|..|+..+.
T Consensus       455 ~C~~Cgk~f~-~s~LekH-------~~~~H--kpv~Cp-Cg~~~-~R~~L~~H~~thCp~Kpi~C~fC~~~v~  515 (567)
T PLN03086        455 HCEKCGQAFQ-QGEMEKH-------MKVFH--EPLQCP-CGVVL-EKEQMVQHQASTCPLRLITCRFCGDMVQ  515 (567)
T ss_pred             cCCCCCCccc-hHHHHHH-------HHhcC--CCccCC-CCCCc-chhHHHhhhhccCCCCceeCCCCCCccc
Confidence            4677777774 4556643       33332  567777 77544 4566777777777777777777777663


No 18 
>PHA00616 hypothetical protein
Probab=98.69  E-value=1e-08  Score=43.05  Aligned_cols=29  Identities=14%  Similarity=0.287  Sum_probs=24.6

Q ss_pred             CccCCcCccccCChHHHHHHHHHhccCCCC
Q psy5652          63 PFKCEFCAHSATSKSNLKMHIMVKHQNDFV   92 (92)
Q Consensus        63 ~~~c~~c~~~~~~~~~l~~h~~~~h~~~~p   92 (92)
                      ||+|+.||+.|...+++..|+ ..|++++|
T Consensus         1 pYqC~~CG~~F~~~s~l~~H~-r~~hg~~~   29 (44)
T PHA00616          1 MYQCLRCGGIFRKKKEVIEHL-LSVHKQNK   29 (44)
T ss_pred             CCccchhhHHHhhHHHHHHHH-HHhcCCCc
Confidence            688999999999999999998 77777765


No 19 
>PLN03086 PRLI-interacting factor K; Provisional
Probab=98.57  E-value=1.3e-07  Score=59.09  Aligned_cols=77  Identities=23%  Similarity=0.438  Sum_probs=60.1

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCC----------HHHHHHHHHHhhCCCCccCCcCc
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYN----------SDRMKRHIRTHTGERPFKCEFCA   70 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~----------~~~l~~h~~~~~~~~~~~c~~c~   70 (92)
                      +.|+ |++.+ ...+|..       |..+|-..+++.|..|+..+..          .+.|..|.... |.+++.|..|+
T Consensus       479 v~Cp-Cg~~~-~R~~L~~-------H~~thCp~Kpi~C~fC~~~v~~g~~~~d~~d~~s~Lt~HE~~C-G~rt~~C~~Cg  548 (567)
T PLN03086        479 LQCP-CGVVL-EKEQMVQ-------HQASTCPLRLITCRFCGDMVQAGGSAMDVRDRLRGMSEHESIC-GSRTAPCDSCG  548 (567)
T ss_pred             ccCC-CCCCc-chhHHHh-------hhhccCCCCceeCCCCCCccccCccccchhhhhhhHHHHHHhc-CCcceEccccC
Confidence            4699 99765 5577774       6778888899999999988742          35788998875 88999999999


Q ss_pred             cccCChHHHHHHHHHhcc
Q psy5652          71 HSATSKSNLKMHIMVKHQ   88 (92)
Q Consensus        71 ~~~~~~~~l~~h~~~~h~   88 (92)
                      +.+... .+..|+...|.
T Consensus       549 k~Vrlr-dm~~H~~~~h~  565 (567)
T PLN03086        549 RSVMLK-EMDIHQIAVHQ  565 (567)
T ss_pred             Ceeeeh-hHHHHHHHhhc
Confidence            987554 67778756554


No 20 
>PHA00732 hypothetical protein
Probab=98.54  E-value=9.2e-08  Score=45.46  Aligned_cols=44  Identities=11%  Similarity=0.147  Sum_probs=25.7

Q ss_pred             CcccccccccccccccccccccCCCCCC-CCCCCCceeCCCCCccCCCHHHHHHHHHH
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMP-RPDSSHLYVCFKCGYHQYNSDRMKRHIRT   57 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~-~~~~~~~~~c~~c~~~~~~~~~l~~h~~~   57 (92)
                      |.|..|++.|.....|..|       +. .|.+   +.|+.|++.|.+   +..|.++
T Consensus         2 y~C~~Cgk~F~s~s~Lk~H-------~r~~H~~---~~C~~CgKsF~~---l~~H~~~   46 (79)
T PHA00732          2 FKCPICGFTTVTLFALKQH-------ARRNHTL---TKCPVCNKSYRR---LNQHFYS   46 (79)
T ss_pred             ccCCCCCCccCCHHHHHHH-------hhcccCC---CccCCCCCEeCC---hhhhhcc
Confidence            4677777777777777753       32 2322   357777777663   4555543


No 21 
>PHA00733 hypothetical protein
Probab=98.47  E-value=1.6e-07  Score=48.58  Aligned_cols=50  Identities=22%  Similarity=0.347  Sum_probs=41.7

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhh
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHT   59 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~   59 (92)
                      |.|..|++.|.....|..|+       ..+  ..++.|.+|++.|.....|..|+....
T Consensus        74 y~C~~Cgk~Fss~s~L~~H~-------r~h--~~~~~C~~CgK~F~~~~sL~~H~~~~h  123 (128)
T PHA00733         74 YVCPLCLMPFSSSVSLKQHI-------RYT--EHSKVCPVCGKEFRNTDSTLDHVCKKH  123 (128)
T ss_pred             ccCCCCCCcCCCHHHHHHHH-------hcC--CcCccCCCCCCccCCHHHHHHHHHHhc
Confidence            67999999999999999654       433  246899999999999999999987644


No 22 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.35  E-value=2.1e-06  Score=38.00  Aligned_cols=50  Identities=24%  Similarity=0.587  Sum_probs=37.0

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHH-hhC-CCCccCCcCccccCChHHHHHHHHHhc
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRT-HTG-ERPFKCEFCAHSATSKSNLKMHIMVKH   87 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~-~~~-~~~~~c~~c~~~~~~~~~l~~h~~~~h   87 (92)
                      .|.|+.|++ ..+...|..|... |.. .+.+.|+.|...+.  .+|..|+...|
T Consensus         2 ~f~CP~C~~-~~~~~~L~~H~~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~H   53 (54)
T PF05605_consen    2 SFTCPYCGK-GFSESSLVEHCEDEHRSESKNVVCPICSSRVT--DNLIRHLNSQH   53 (54)
T ss_pred             CcCCCCCCC-ccCHHHHHHHHHhHCcCCCCCccCCCchhhhh--hHHHHHHHHhc
Confidence            478999999 5667789988765 544 35799999987543  48888885444


No 23 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.26  E-value=1.3e-06  Score=31.79  Aligned_cols=20  Identities=35%  Similarity=0.682  Sum_probs=9.5

Q ss_pred             eCCCCCccCCCHHHHHHHHH
Q psy5652          37 VCFKCGYHQYNSDRMKRHIR   56 (92)
Q Consensus        37 ~c~~c~~~~~~~~~l~~h~~   56 (92)
                      .|+.|++.|.....|..|++
T Consensus         2 ~C~~C~~~f~~~~~l~~H~~   21 (23)
T PF00096_consen    2 KCPICGKSFSSKSNLKRHMR   21 (23)
T ss_dssp             EETTTTEEESSHHHHHHHHH
T ss_pred             CCCCCCCccCCHHHHHHHHh
Confidence            44444444444444444444


No 24 
>PF00096 zf-C2H2:  Zinc finger, C2H2 type;  InterPro: IPR007087 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger: #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C], where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter []. This entry represents the classical C2H2 zinc finger domain.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9H_A 2EPC_A 1SP1_A 1VA3_A 2WBT_B 2ELR_A 2YTP_A 2YTT_A 1VA1_A 2ELO_A ....
Probab=98.13  E-value=2.2e-06  Score=31.14  Aligned_cols=23  Identities=52%  Similarity=0.961  Sum_probs=20.4

Q ss_pred             ccCCcCccccCChHHHHHHHHHhc
Q psy5652          64 FKCEFCAHSATSKSNLKMHIMVKH   87 (92)
Q Consensus        64 ~~c~~c~~~~~~~~~l~~h~~~~h   87 (92)
                      |.|..|++.|.....|..|+ ..|
T Consensus         1 y~C~~C~~~f~~~~~l~~H~-~~H   23 (23)
T PF00096_consen    1 YKCPICGKSFSSKSNLKRHM-RRH   23 (23)
T ss_dssp             EEETTTTEEESSHHHHHHHH-HHH
T ss_pred             CCCCCCCCccCCHHHHHHHH-hHC
Confidence            68999999999999999999 444


No 25 
>KOG3993|consensus
Probab=98.07  E-value=2.3e-06  Score=51.70  Aligned_cols=59  Identities=19%  Similarity=0.355  Sum_probs=43.6

Q ss_pred             CcccccccccccccccccccccC----------CCC----------------CCCCCCCCceeCCCCCccCCCHHHHHHH
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKR----------CSN----------------MPRPDSSHLYVCFKCGYHQYNSDRMKRH   54 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~----------~~~----------------~~~~~~~~~~~c~~c~~~~~~~~~l~~h   54 (92)
                      |+|++|+|.|....+|..|..-.          ...                .+......-|.|.+|++.|.....|.+|
T Consensus       296 YrCPEC~KVFsCPANLASHRRWHKPR~eaa~a~~~P~k~~~~~rae~~ea~rsg~dss~gi~~C~~C~KkFrRqAYLrKH  375 (500)
T KOG3993|consen  296 YRCPECDKVFSCPANLASHRRWHKPRPEAAKAGSPPPKQAVETRAEVQEAERSGDDSSSGIFSCHTCGKKFRRQAYLRKH  375 (500)
T ss_pred             ecCCcccccccCchhhhhhhcccCCchhhhhcCCCChhhhhhhhhhhhhccccCCcccCceeecHHhhhhhHHHHHHHHh
Confidence            78999999999999999984211          000                0001223369999999999999999999


Q ss_pred             HHHhh
Q psy5652          55 IRTHT   59 (92)
Q Consensus        55 ~~~~~   59 (92)
                      +.+|.
T Consensus       376 qlthq  380 (500)
T KOG3993|consen  376 QLTHQ  380 (500)
T ss_pred             HHhhh
Confidence            87664


No 26 
>PF05605 zf-Di19:  Drought induced 19 protein (Di19), zinc-binding;  InterPro: IPR008598 This entry consists of several drought induced 19 (Di19) like and RING finger 114 proteins. Di19 has been found to be strongly expressed in both the roots and leaves of Arabidopsis thaliana during progressive drought [], whilst RING finger proteins are thought to play a role in spermatogenesis. The precise function is unknown.
Probab=98.06  E-value=2e-06  Score=38.04  Aligned_cols=49  Identities=20%  Similarity=0.392  Sum_probs=35.0

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCC-CCceeCCCCCccCCCHHHHHHHHHHh
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDS-SHLYVCFKCGYHQYNSDRMKRHIRTH   58 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~-~~~~~c~~c~~~~~~~~~l~~h~~~~   58 (92)
                      |.|+.|++. .+...|..|.      ...|.. .+.+.|++|...+.  ..|..|+...
T Consensus         3 f~CP~C~~~-~~~~~L~~H~------~~~H~~~~~~v~CPiC~~~~~--~~l~~Hl~~~   52 (54)
T PF05605_consen    3 FTCPYCGKG-FSESSLVEHC------EDEHRSESKNVVCPICSSRVT--DNLIRHLNSQ   52 (54)
T ss_pred             cCCCCCCCc-cCHHHHHHHH------HhHCcCCCCCccCCCchhhhh--hHHHHHHHHh
Confidence            789999995 5567788764      445543 35789999998644  3788887754


No 27 
>PF13465 zf-H2C2_2:  Zinc-finger double domain; PDB: 2EN7_A 1TF6_A 1TF3_A 2ELT_A 2EOS_A 2EN2_A 2DMD_A 2WBS_A 2WBU_A 2EM5_A ....
Probab=98.05  E-value=8.5e-08  Score=36.17  Aligned_cols=21  Identities=24%  Similarity=0.401  Sum_probs=18.8

Q ss_pred             CCCCCCCCCceeCCCCCccCC
Q psy5652          26 NMPRPDSSHLYVCFKCGYHQY   46 (92)
Q Consensus        26 ~~~~~~~~~~~~c~~c~~~~~   46 (92)
                      |+.+|.++++|.|+.|++.|.
T Consensus         5 H~~~H~~~k~~~C~~C~k~F~   25 (26)
T PF13465_consen    5 HMRTHTGEKPYKCPYCGKSFS   25 (26)
T ss_dssp             HHHHHSSSSSEEESSSSEEES
T ss_pred             HhhhcCCCCCCCCCCCcCeeC
Confidence            677899999999999999885


No 28 
>PHA00732 hypothetical protein
Probab=97.90  E-value=3.5e-06  Score=40.08  Aligned_cols=43  Identities=33%  Similarity=0.660  Sum_probs=36.2

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHH-hhCCCCccCCcCccccCChHHHHHHH
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRT-HTGERPFKCEFCAHSATSKSNLKMHI   83 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~-~~~~~~~~c~~c~~~~~~~~~l~~h~   83 (92)
                      +|.|..|++.|.....|..|++. |.   ++.|..|++.|.   .+..|.
T Consensus         1 py~C~~Cgk~F~s~s~Lk~H~r~~H~---~~~C~~CgKsF~---~l~~H~   44 (79)
T PHA00732          1 MFKCPICGFTTVTLFALKQHARRNHT---LTKCPVCNKSYR---RLNQHF   44 (79)
T ss_pred             CccCCCCCCccCCHHHHHHHhhcccC---CCccCCCCCEeC---Chhhhh
Confidence            57899999999999999999984 65   368999999997   466665


No 29 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.86  E-value=2.6e-05  Score=28.22  Aligned_cols=19  Identities=42%  Similarity=0.850  Sum_probs=7.9

Q ss_pred             cCCcCccccCChHHHHHHH
Q psy5652          65 KCEFCAHSATSKSNLKMHI   83 (92)
Q Consensus        65 ~c~~c~~~~~~~~~l~~h~   83 (92)
                      .|..|++.|.....|..|+
T Consensus         2 ~C~~C~~~~~~~~~l~~H~   20 (24)
T PF13894_consen    2 QCPICGKSFRSKSELRQHM   20 (24)
T ss_dssp             E-SSTS-EESSHHHHHHHH
T ss_pred             CCcCCCCcCCcHHHHHHHH
Confidence            3444444444444444444


No 30 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=97.83  E-value=2.6e-05  Score=38.30  Aligned_cols=19  Identities=21%  Similarity=0.590  Sum_probs=0.0

Q ss_pred             ccccccccccccccccccc
Q psy5652           2 VCIFCRQLLPMDADFILGH   20 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~   20 (92)
                      .|.+|+..|.+...|..|+
T Consensus         1 ~C~~C~~~f~~~~~l~~H~   19 (100)
T PF12756_consen    1 QCLFCDESFSSVDDLLQHM   19 (100)
T ss_dssp             -------------------
T ss_pred             Ccccccccccccccccccc
Confidence            4899999999999999765


No 31 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.78  E-value=1.5e-05  Score=30.03  Aligned_cols=21  Identities=24%  Similarity=0.569  Sum_probs=10.2

Q ss_pred             eeCCCCCccCCCHHHHHHHHH
Q psy5652          36 YVCFKCGYHQYNSDRMKRHIR   56 (92)
Q Consensus        36 ~~c~~c~~~~~~~~~l~~h~~   56 (92)
                      |.|..|++.|.+...|..|++
T Consensus         2 ~~C~~C~~~F~~~~~l~~H~~   22 (27)
T PF13912_consen    2 FECDECGKTFSSLSALREHKR   22 (27)
T ss_dssp             EEETTTTEEESSHHHHHHHHC
T ss_pred             CCCCccCCccCChhHHHHHhH
Confidence            444455555555444444443


No 32 
>PF13894 zf-C2H2_4:  C2H2-type zinc finger; PDB: 2ELX_A 2EPP_A 2DLK_A 1X6H_A 2EOU_A 2EMB_A 2GQJ_A 2CSH_A 2WBT_B 2ELM_A ....
Probab=97.76  E-value=4.1e-05  Score=27.67  Aligned_cols=23  Identities=30%  Similarity=0.742  Sum_probs=19.3

Q ss_pred             eeCCCCCccCCCHHHHHHHHHHh
Q psy5652          36 YVCFKCGYHQYNSDRMKRHIRTH   58 (92)
Q Consensus        36 ~~c~~c~~~~~~~~~l~~h~~~~   58 (92)
                      |.|+.|+..|.+...|..|+..+
T Consensus         1 ~~C~~C~~~~~~~~~l~~H~~~~   23 (24)
T PF13894_consen    1 FQCPICGKSFRSKSELRQHMRTH   23 (24)
T ss_dssp             EE-SSTS-EESSHHHHHHHHHHH
T ss_pred             CCCcCCCCcCCcHHHHHHHHHhh
Confidence            68999999999999999999865


No 33 
>PF13912 zf-C2H2_6:  C2H2-type zinc finger; PDB: 1JN7_A 1FU9_A 2L1O_A 1NJQ_A 2EN8_A 2EMM_A 1FV5_A 1Y0J_B 2L6Z_B.
Probab=97.71  E-value=2.4e-05  Score=29.46  Aligned_cols=25  Identities=36%  Similarity=0.689  Sum_probs=22.3

Q ss_pred             CccCCcCccccCChHHHHHHHHHhcc
Q psy5652          63 PFKCEFCAHSATSKSNLKMHIMVKHQ   88 (92)
Q Consensus        63 ~~~c~~c~~~~~~~~~l~~h~~~~h~   88 (92)
                      ||.|..|++.|.....|..|+ +.|.
T Consensus         1 ~~~C~~C~~~F~~~~~l~~H~-~~h~   25 (27)
T PF13912_consen    1 PFECDECGKTFSSLSALREHK-RSHC   25 (27)
T ss_dssp             SEEETTTTEEESSHHHHHHHH-CTTT
T ss_pred             CCCCCccCCccCChhHHHHHh-HHhc
Confidence            689999999999999999999 6663


No 34 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.49  E-value=0.00019  Score=26.19  Aligned_cols=19  Identities=42%  Similarity=0.705  Sum_probs=9.7

Q ss_pred             cCCcCccccCChHHHHHHH
Q psy5652          65 KCEFCAHSATSKSNLKMHI   83 (92)
Q Consensus        65 ~c~~c~~~~~~~~~l~~h~   83 (92)
                      .|..|++.|.....|..|+
T Consensus         2 ~C~~C~~~f~~~~~l~~H~   20 (26)
T smart00355        2 RCPECGKVFKSKSALKEHM   20 (26)
T ss_pred             CCCCCcchhCCHHHHHHHH
Confidence            3445555555555555554


No 35 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.49  E-value=0.00018  Score=31.14  Aligned_cols=33  Identities=24%  Similarity=0.446  Sum_probs=17.1

Q ss_pred             CCCCceeCCCCCccCCCHHHHHHHHHHhhCCCC
Q psy5652          31 DSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERP   63 (92)
Q Consensus        31 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~   63 (92)
                      ..+.|..|++|+.......+|.+|+....+.+|
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHle~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHLEIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHHHHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHHHHHhcccC
Confidence            344566777777777777777777665555443


No 36 
>smart00355 ZnF_C2H2 zinc finger.
Probab=97.48  E-value=0.0002  Score=26.14  Aligned_cols=24  Identities=38%  Similarity=0.686  Sum_probs=18.4

Q ss_pred             eeCCCCCccCCCHHHHHHHHHHhh
Q psy5652          36 YVCFKCGYHQYNSDRMKRHIRTHT   59 (92)
Q Consensus        36 ~~c~~c~~~~~~~~~l~~h~~~~~   59 (92)
                      +.|..|++.|.....+..|++.|.
T Consensus         1 ~~C~~C~~~f~~~~~l~~H~~~H~   24 (26)
T smart00355        1 YRCPECGKVFKSKSALKEHMRTHX   24 (26)
T ss_pred             CCCCCCcchhCCHHHHHHHHHHhc
Confidence            467888888888888888877553


No 37 
>PF09237 GAGA:  GAGA factor;  InterPro: IPR015318 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Members of this entry bind to a 5'-GAGAG-3' DNA consensus binding site, and contain a Cys2-His2 zinc finger core as well as an N-terminal extension containing two highly basic regions. The zinc finger core binds in the DNA major groove and recognises the first three GAG bases of the consensus in a manner similar to that seen in other classical zinc finger-DNA complexes. The second basic region forms a helix that interacts in the major groove recognising the last G of the consensus, while the first basic region wraps around the DNA in the minor groove and recognises the A in the fourth position of the consensus sequence [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1YUI_A 1YUJ_A.
Probab=97.40  E-value=0.00082  Score=29.11  Aligned_cols=33  Identities=21%  Similarity=0.404  Sum_probs=21.7

Q ss_pred             hCCCCccCCcCccccCChHHHHHHHHHhccCCCC
Q psy5652          59 TGERPFKCEFCAHSATSKSNLKMHIMVKHQNDFV   92 (92)
Q Consensus        59 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~h~~~~p   92 (92)
                      ..+.|-.|+.|+..+.+..+|.+|+ .++.+.||
T Consensus        20 ~S~~PatCP~C~a~~~~srnLrRHl-e~~H~~k~   52 (54)
T PF09237_consen   20 QSEQPATCPICGAVIRQSRNLRRHL-EIRHFKKP   52 (54)
T ss_dssp             TTS--EE-TTT--EESSHHHHHHHH-HHHTTTS-
T ss_pred             ccCCCCCCCcchhhccchhhHHHHH-HHHhcccC
Confidence            4567999999999999999999999 44444443


No 38 
>PRK04860 hypothetical protein; Provisional
Probab=97.36  E-value=0.00021  Score=38.44  Aligned_cols=39  Identities=28%  Similarity=0.588  Sum_probs=32.8

Q ss_pred             CceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccCCh
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSATSK   76 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~   76 (92)
                      -+|.|. |+.   ....+..|.++++++++|.|..|+..|...
T Consensus       118 ~~Y~C~-C~~---~~~~~rrH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        118 FPYRCK-CQE---HQLTVRRHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEEEcC-CCC---eeCHHHHHHHHhcCCccEECCCCCceeEEe
Confidence            379997 987   556689999999999999999999877543


No 39 
>PF12171 zf-C2H2_jaz:  Zinc-finger double-stranded RNA-binding;  InterPro: IPR022755  This zinc finger is found in archaea and eukaryotes, and is approximately 30 amino acids in length. The mammalian members of this group occur multiple times along the protein, joined by flexible linkers, and are referred to as JAZ - dsRNA-binding ZF protein - zinc-fingers. The JAZ proteins are expressed in all tissues tested and localise in the nucleus, particularly the nucleolus []. JAZ preferentially binds to double-stranded (ds) RNA or RNA/DNA hybrids rather than DNA. In addition to binding double-stranded RNA, these zinc-fingers are required for nucleolar localisation.   This entry represents the multiple-adjacent-C2H2 zinc finger, JAZ. ; PDB: 4DGW_A 1ZR9_A.
Probab=97.19  E-value=0.00015  Score=27.32  Aligned_cols=20  Identities=10%  Similarity=0.310  Sum_probs=14.6

Q ss_pred             Cccccccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDADFILGH   20 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~   20 (92)
                      |.|.+|++.|.++..+..|+
T Consensus         2 ~~C~~C~k~f~~~~~~~~H~   21 (27)
T PF12171_consen    2 FYCDACDKYFSSENQLKQHM   21 (27)
T ss_dssp             CBBTTTTBBBSSHHHHHCCT
T ss_pred             CCcccCCCCcCCHHHHHHHH
Confidence            56777888888877777654


No 40 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.13  E-value=0.00014  Score=42.95  Aligned_cols=20  Identities=10%  Similarity=0.225  Sum_probs=17.0

Q ss_pred             Ccccc--ccccccccccccccc
Q psy5652           1 MVCIF--CRQLLPMDADFILGH   20 (92)
Q Consensus         1 ~~C~~--C~~~f~~~~~l~~h~   20 (92)
                      |+|++  |++.+.....|..|+
T Consensus       350 ykCpV~gC~K~YknqnGLKYH~  371 (423)
T COG5189         350 YKCPVEGCNKKYKNQNGLKYHM  371 (423)
T ss_pred             ecCCCCCchhhhccccchhhhh
Confidence            67877  999999999999875


No 41 
>PF12874 zf-met:  Zinc-finger of C2H2 type; PDB: 1ZU1_A 2KVG_A.
Probab=97.06  E-value=0.00051  Score=25.17  Aligned_cols=20  Identities=20%  Similarity=0.542  Sum_probs=9.9

Q ss_pred             eCCCCCccCCCHHHHHHHHH
Q psy5652          37 VCFKCGYHQYNSDRMKRHIR   56 (92)
Q Consensus        37 ~c~~c~~~~~~~~~l~~h~~   56 (92)
                      .|..|+..|.+...+..|++
T Consensus         2 ~C~~C~~~f~s~~~~~~H~~   21 (25)
T PF12874_consen    2 YCDICNKSFSSENSLRQHLR   21 (25)
T ss_dssp             EETTTTEEESSHHHHHHHHT
T ss_pred             CCCCCCCCcCCHHHHHHHHC
Confidence            44555555555555554443


No 42 
>COG5189 SFP1 Putative transcriptional repressor regulating G2/M transition [Transcription / Cell division and chromosome partitioning]
Probab=97.03  E-value=0.00013  Score=43.04  Aligned_cols=51  Identities=27%  Similarity=0.618  Sum_probs=41.7

Q ss_pred             CCceeCCC--CCccCCCHHHHHHHHHH-h------------------hCCCCccCCcCccccCChHHHHHHH
Q psy5652          33 SHLYVCFK--CGYHQYNSDRMKRHIRT-H------------------TGERPFKCEFCAHSATSKSNLKMHI   83 (92)
Q Consensus        33 ~~~~~c~~--c~~~~~~~~~l~~h~~~-~------------------~~~~~~~c~~c~~~~~~~~~l~~h~   83 (92)
                      ++||.|++  |.+.|.+...|+-|+.. |                  ...|||.|..|+|.+.....|.-|+
T Consensus       347 ~KpykCpV~gC~K~YknqnGLKYH~lhGH~~~~~~~~p~p~~~~~F~~~~KPYrCevC~KRYKNlNGLKYHr  418 (423)
T COG5189         347 GKPYKCPVEGCNKKYKNQNGLKYHMLHGHQNQKLHENPSPEKMNIFSAKDKPYRCEVCDKRYKNLNGLKYHR  418 (423)
T ss_pred             CceecCCCCCchhhhccccchhhhhhccccCcccCCCCCccccccccccCCceeccccchhhccCccceecc
Confidence            58999976  77999999999988763 2                  1248999999999999988887776


No 43 
>PF13909 zf-H2C2_5:  C2H2-type zinc-finger domain; PDB: 1X5W_A.
Probab=96.39  E-value=0.0058  Score=22.07  Aligned_cols=19  Identities=53%  Similarity=1.006  Sum_probs=9.3

Q ss_pred             ccCCcCccccCChHHHHHHH
Q psy5652          64 FKCEFCAHSATSKSNLKMHI   83 (92)
Q Consensus        64 ~~c~~c~~~~~~~~~l~~h~   83 (92)
                      |+|..|..... ...|..|+
T Consensus         1 y~C~~C~y~t~-~~~l~~H~   19 (24)
T PF13909_consen    1 YKCPHCSYSTS-KSNLKRHL   19 (24)
T ss_dssp             EE-SSSS-EES-HHHHHHHH
T ss_pred             CCCCCCCCcCC-HHHHHHHH
Confidence            34555555444 55565555


No 44 
>PF13913 zf-C2HC_2:  zinc-finger of a C2HC-type
Probab=96.37  E-value=0.0052  Score=22.68  Aligned_cols=20  Identities=35%  Similarity=0.722  Sum_probs=13.0

Q ss_pred             eeCCCCCccCCCHHHHHHHHH
Q psy5652          36 YVCFKCGYHQYNSDRMKRHIR   56 (92)
Q Consensus        36 ~~c~~c~~~~~~~~~l~~h~~   56 (92)
                      ..|+.||+.| ..+.|..|+.
T Consensus         3 ~~C~~CgR~F-~~~~l~~H~~   22 (25)
T PF13913_consen    3 VPCPICGRKF-NPDRLEKHEK   22 (25)
T ss_pred             CcCCCCCCEE-CHHHHHHHHH
Confidence            3577777777 5556666654


No 45 
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=95.21  E-value=0.015  Score=22.93  Aligned_cols=24  Identities=38%  Similarity=0.984  Sum_probs=13.1

Q ss_pred             eeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcc
Q psy5652          36 YVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAH   71 (92)
Q Consensus        36 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   71 (92)
                      |.|.+||..+....            .++.|+.|+.
T Consensus         2 ~~C~~CGy~y~~~~------------~~~~CP~Cg~   25 (33)
T cd00350           2 YVCPVCGYIYDGEE------------APWVCPVCGA   25 (33)
T ss_pred             EECCCCCCEECCCc------------CCCcCcCCCC
Confidence            55666665543321            4666666653


No 46 
>KOG2186|consensus
Probab=95.09  E-value=0.012  Score=33.98  Aligned_cols=46  Identities=20%  Similarity=0.480  Sum_probs=27.9

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccCChHHHHHHH
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSATSKSNLKMHI   83 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h~   83 (92)
                      -|.|.+||....-+ .+..|+..-++ ..|.|..|++.|.. .....|.
T Consensus         3 ~FtCnvCgEsvKKp-~vekH~srCrn-~~fSCIDC~k~F~~-~sYknH~   48 (276)
T KOG2186|consen    3 FFTCNVCGESVKKP-QVEKHMSRCRN-AYFSCIDCGKTFER-VSYKNHT   48 (276)
T ss_pred             EEehhhhhhhcccc-chHHHHHhccC-CeeEEeeccccccc-chhhhhh
Confidence            36677777765443 35556665555 56777777777755 3444444


No 47 
>PRK04860 hypothetical protein; Provisional
Probab=95.05  E-value=0.0038  Score=33.71  Aligned_cols=37  Identities=16%  Similarity=0.358  Sum_probs=27.3

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCH
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNS   48 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~   48 (92)
                      |.|. |+.   ....+.       .|..++.++++|.|..|+..+...
T Consensus       120 Y~C~-C~~---~~~~~r-------rH~ri~~g~~~YrC~~C~~~l~~~  156 (160)
T PRK04860        120 YRCK-CQE---HQLTVR-------RHNRVVRGEAVYRCRRCGETLVFK  156 (160)
T ss_pred             EEcC-CCC---eeCHHH-------HHHHHhcCCccEECCCCCceeEEe
Confidence            4576 775   444555       477889999999999999877543


No 48 
>KOG2893|consensus
Probab=94.77  E-value=0.0078  Score=34.51  Aligned_cols=39  Identities=23%  Similarity=0.511  Sum_probs=18.9

Q ss_pred             CCCccCCCHHHHHHHHHHhhCCCCccCCcCccccCChHHHHHH
Q psy5652          40 KCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSATSKSNLKMH   82 (92)
Q Consensus        40 ~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~~~l~~h   82 (92)
                      +|.+.|....-|..|++    .+.|+|..|-+..-+...|..|
T Consensus        15 ycnrefddekiliqhqk----akhfkchichkkl~sgpglsih   53 (341)
T KOG2893|consen   15 YCNREFDDEKILIQHQK----AKHFKCHICHKKLFSGPGLSIH   53 (341)
T ss_pred             ecccccchhhhhhhhhh----hccceeeeehhhhccCCCceee
Confidence            45555555555554443    3445555555444344444444


No 49 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=94.54  E-value=0.039  Score=24.73  Aligned_cols=33  Identities=18%  Similarity=0.520  Sum_probs=22.9

Q ss_pred             CceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcc
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAH   71 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   71 (92)
                      ..|.|+.||+.....     ..+......+|.|+.||.
T Consensus        26 v~F~CPnCGe~~I~R-----c~~CRk~g~~Y~Cp~CGF   58 (61)
T COG2888          26 VKFPCPNCGEVEIYR-----CAKCRKLGNPYRCPKCGF   58 (61)
T ss_pred             eEeeCCCCCceeeeh-----hhhHHHcCCceECCCcCc
Confidence            479999999654332     233444467999999983


No 50 
>smart00451 ZnF_U1 U1-like zinc finger. Family of C2H2-type zinc fingers, present in matrin, U1 small nuclear ribonucleoprotein C and other RNA-binding proteins.
Probab=94.53  E-value=0.051  Score=21.30  Aligned_cols=21  Identities=24%  Similarity=0.648  Sum_probs=15.7

Q ss_pred             CccCCcCccccCChHHHHHHH
Q psy5652          63 PFKCEFCAHSATSKSNLKMHI   83 (92)
Q Consensus        63 ~~~c~~c~~~~~~~~~l~~h~   83 (92)
                      +|.|..|+..|.....+..|+
T Consensus         3 ~~~C~~C~~~~~~~~~~~~H~   23 (35)
T smart00451        3 GFYCKLCNVTFTDEISVEAHL   23 (35)
T ss_pred             CeEccccCCccCCHHHHHHHH
Confidence            467777888777777777776


No 51 
>PF13717 zinc_ribbon_4:  zinc-ribbon domain
Probab=94.35  E-value=0.033  Score=22.44  Aligned_cols=32  Identities=28%  Similarity=0.545  Sum_probs=18.6

Q ss_pred             cccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccC
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQ   45 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~   45 (92)
                      .|+.|+..|...++..            ........|..|+..|
T Consensus         4 ~Cp~C~~~y~i~d~~i------------p~~g~~v~C~~C~~~f   35 (36)
T PF13717_consen    4 TCPNCQAKYEIDDEKI------------PPKGRKVRCSKCGHVF   35 (36)
T ss_pred             ECCCCCCEEeCCHHHC------------CCCCcEEECCCCCCEe
Confidence            4677777766665533            1333456677776554


No 52 
>PF09986 DUF2225:  Uncharacterized protein conserved in bacteria (DUF2225);  InterPro: IPR018708 This conserved bacterial family has no known function.
Probab=94.28  E-value=0.03  Score=31.74  Aligned_cols=48  Identities=17%  Similarity=0.325  Sum_probs=27.1

Q ss_pred             CcccccccccccccccccccccC--CCCCCCC-CCC-----CceeCCCCCccCCCH
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKR--CSNMPRP-DSS-----HLYVCFKCGYHQYNS   48 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~--~~~~~~~-~~~-----~~~~c~~c~~~~~~~   48 (92)
                      ++|++|++.|.++.-......-.  -.....+ .+.     ..+.|+.||.++...
T Consensus         6 ~~CPvC~~~F~~~~vrs~~~r~~~~d~D~~~~Y~~vnP~~Y~V~vCP~CgyA~~~~   61 (214)
T PF09986_consen    6 ITCPVCGKEFKTKKVRSGKIRVIRRDSDFCPRYKGVNPLFYEVWVCPHCGYAAFEE   61 (214)
T ss_pred             eECCCCCCeeeeeEEEcCCceEeeecCCCccccCCCCCeeeeEEECCCCCCccccc
Confidence            46999999999886554322110  0000111 111     147899999877644


No 53 
>PF12756 zf-C2H2_2:  C2H2 type zinc-finger (2 copies); PDB: 2DMI_A.
Probab=93.90  E-value=0.084  Score=25.65  Aligned_cols=25  Identities=16%  Similarity=0.457  Sum_probs=21.7

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhh
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHT   59 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~   59 (92)
                      .+.|..|+..|.+...|..|++.+.
T Consensus        50 ~~~C~~C~~~f~s~~~l~~Hm~~~~   74 (100)
T PF12756_consen   50 SFRCPYCNKTFRSREALQEHMRSKH   74 (100)
T ss_dssp             SEEBSSSS-EESSHHHHHHHHHHTT
T ss_pred             CCCCCccCCCCcCHHHHHHHHcCcc
Confidence            6899999999999999999999753


No 54 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=93.83  E-value=0.035  Score=22.42  Aligned_cols=14  Identities=14%  Similarity=0.392  Sum_probs=8.8

Q ss_pred             cccccccccccccc
Q psy5652           2 VCIFCRQLLPMDAD   15 (92)
Q Consensus         2 ~C~~C~~~f~~~~~   15 (92)
                      .|+.|+..|....+
T Consensus         4 ~CP~C~~~~~v~~~   17 (38)
T TIGR02098         4 QCPNCKTSFRVVDS   17 (38)
T ss_pred             ECCCCCCEEEeCHH
Confidence            46777766666554


No 55 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.81  E-value=0.031  Score=33.98  Aligned_cols=59  Identities=22%  Similarity=0.332  Sum_probs=37.2

Q ss_pred             cccccccccccccccccccccCCCCCC--CCCCC--CceeCC--CCCccCCCHHHHHHHHHHhhCCCCccCC
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMP--RPDSS--HLYVCF--KCGYHQYNSDRMKRHIRTHTGERPFKCE   67 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~--~~~~~--~~~~c~--~c~~~~~~~~~l~~h~~~~~~~~~~~c~   67 (92)
                      .|..|...|.....+..       +..  .|..+  +++.|+  .|+..|.....+..|...+.+..++.+.
T Consensus       291 ~~~~~~~~~s~~~~l~~-------~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  355 (467)
T COG5048         291 KSKQCNISFSRSSPLTR-------HLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHILLHTSISPAKEK  355 (467)
T ss_pred             CCccccCCccccccccc-------cccccccccccCCceeeeccCCCccccccccccCCcccccCCCccccc
Confidence            45666666777766664       333  56666  677776  5777777776666666666665555443


No 56 
>COG4049 Uncharacterized protein containing archaeal-type C2H2 Zn-finger [General function prediction only]
Probab=93.51  E-value=0.049  Score=24.08  Aligned_cols=26  Identities=23%  Similarity=0.510  Sum_probs=14.2

Q ss_pred             CCCCceeCCCCCccCCCHHHHHHHHH
Q psy5652          31 DSSHLYVCFKCGYHQYNSDRMKRHIR   56 (92)
Q Consensus        31 ~~~~~~~c~~c~~~~~~~~~l~~h~~   56 (92)
                      .++.-+.|+-|+..|........|.-
T Consensus        13 DGE~~lrCPRC~~~FR~~K~Y~RHVN   38 (65)
T COG4049          13 DGEEFLRCPRCGMVFRRRKDYIRHVN   38 (65)
T ss_pred             CCceeeeCCchhHHHHHhHHHHHHhh
Confidence            34445566666666655555555543


No 57 
>PF13719 zinc_ribbon_5:  zinc-ribbon domain
Probab=93.49  E-value=0.047  Score=22.08  Aligned_cols=14  Identities=21%  Similarity=0.548  Sum_probs=7.9

Q ss_pred             cccccccccccccc
Q psy5652           2 VCIFCRQLLPMDAD   15 (92)
Q Consensus         2 ~C~~C~~~f~~~~~   15 (92)
                      .|+.|+..|...++
T Consensus         4 ~CP~C~~~f~v~~~   17 (37)
T PF13719_consen    4 TCPNCQTRFRVPDD   17 (37)
T ss_pred             ECCCCCceEEcCHH
Confidence            36666666555544


No 58 
>KOG2893|consensus
Probab=93.33  E-value=0.0077  Score=34.54  Aligned_cols=43  Identities=14%  Similarity=0.417  Sum_probs=32.2

Q ss_pred             ccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHH
Q psy5652           3 CIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIR   56 (92)
Q Consensus         3 C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~   56 (92)
                      |..|++.|.++.-|.+|+       .    .+.|.|.+|-+...+-..|..|..
T Consensus        13 cwycnrefddekiliqhq-------k----akhfkchichkkl~sgpglsihcm   55 (341)
T KOG2893|consen   13 CWYCNREFDDEKILIQHQ-------K----AKHFKCHICHKKLFSGPGLSIHCM   55 (341)
T ss_pred             eeecccccchhhhhhhhh-------h----hccceeeeehhhhccCCCceeehh
Confidence            889999999999988643       2    367888888877666666665543


No 59 
>COG5048 FOG: Zn-finger [General function prediction only]
Probab=93.22  E-value=0.0099  Score=36.09  Aligned_cols=57  Identities=30%  Similarity=0.562  Sum_probs=49.8

Q ss_pred             CceeCCCCCccCCCHHHHHHHHH--HhhCC--CCccCC--cCccccCChHHHHHHHHHhccCCC
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIR--THTGE--RPFKCE--FCAHSATSKSNLKMHIMVKHQNDF   91 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~--~~~~~--~~~~c~--~c~~~~~~~~~l~~h~~~~h~~~~   91 (92)
                      .++.|..|...+.....+..|.+  .|.++  +++.|+  .|++.|.+...+..|. ..|.+.+
T Consensus       288 ~~~~~~~~~~~~s~~~~l~~~~~~~~h~~~~~~~~~~p~~~~~~~~~~~~~~~~~~-~~~~~~~  350 (467)
T COG5048         288 LPIKSKQCNISFSRSSPLTRHLRSVNHSGESLKPFSCPYSLCGKLFSRNDALKRHI-LLHTSIS  350 (467)
T ss_pred             cCCCCccccCCccccccccccccccccccccCCceeeeccCCCccccccccccCCc-ccccCCC
Confidence            36889999999999999999999  89999  999999  7999999999988888 7776543


No 60 
>PF09538 FYDLN_acid:  Protein of unknown function (FYDLN_acid);  InterPro: IPR012644 Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=93.17  E-value=0.14  Score=25.98  Aligned_cols=30  Identities=23%  Similarity=0.611  Sum_probs=21.2

Q ss_pred             eeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccCCh
Q psy5652          36 YVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSATSK   76 (92)
Q Consensus        36 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~   76 (92)
                      ..|+.||..|...           ...|..|++||..|...
T Consensus        10 R~Cp~CG~kFYDL-----------nk~PivCP~CG~~~~~~   39 (108)
T PF09538_consen   10 RTCPSCGAKFYDL-----------NKDPIVCPKCGTEFPPE   39 (108)
T ss_pred             ccCCCCcchhccC-----------CCCCccCCCCCCccCcc
Confidence            4788888877553           23578888888877644


No 61 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=93.12  E-value=0.22  Score=22.39  Aligned_cols=34  Identities=18%  Similarity=0.514  Sum_probs=22.5

Q ss_pred             CCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcc
Q psy5652          33 SHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAH   71 (92)
Q Consensus        33 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   71 (92)
                      ...|.|+.||+.....     ..+-.....+|.|+.||.
T Consensus        23 ~~~F~CPnCG~~~I~R-----C~~CRk~~~~Y~CP~CGF   56 (59)
T PRK14890         23 AVKFLCPNCGEVIIYR-----CEKCRKQSNPYTCPKCGF   56 (59)
T ss_pred             cCEeeCCCCCCeeEee-----chhHHhcCCceECCCCCC
Confidence            4579999999762222     223334457899999984


No 62 
>KOG1146|consensus
Probab=91.85  E-value=0.093  Score=36.99  Aligned_cols=22  Identities=9%  Similarity=0.155  Sum_probs=18.7

Q ss_pred             Cccccccccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDADFILGHCK   22 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~   22 (92)
                      ++|+.|+..|+....|..|++.
T Consensus       466 ~~cpkc~~~yk~a~~L~vhmRs  487 (1406)
T KOG1146|consen  466 LKCPKCNWHYKLAQTLGVHMRS  487 (1406)
T ss_pred             ccCCccchhhhhHHHhhhcccc
Confidence            5799999999999999987644


No 63 
>KOG1146|consensus
Probab=91.63  E-value=0.18  Score=35.73  Aligned_cols=54  Identities=26%  Similarity=0.569  Sum_probs=44.5

Q ss_pred             CCCCceeCCCCCccCCCHHHHHHHHHHh-------------------------hCCCCccCCcCccccCChHHHHHHHH
Q psy5652          31 DSSHLYVCFKCGYHQYNSDRMKRHIRTH-------------------------TGERPFKCEFCAHSATSKSNLKMHIM   84 (92)
Q Consensus        31 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~-------------------------~~~~~~~c~~c~~~~~~~~~l~~h~~   84 (92)
                      ...+.+.|+.|.+.|.....|-.|+|..                         -+.++|.|..|...+....+|..|++
T Consensus       461 S~~kt~~cpkc~~~yk~a~~L~vhmRskhp~~~~~~c~~gq~~~~~arg~~~~~~~~p~~C~~C~~stttng~Lsihlq  539 (1406)
T KOG1146|consen  461 SFFKTLKCPKCNWHYKLAQTLGVHMRSKHPESQSAYCKAGQNHPRLARGEVYRCPGKPYPCRACNYSTTTNGNLSIHLQ  539 (1406)
T ss_pred             cccccccCCccchhhhhHHHhhhcccccccccchhHhHhccccccccccccccCCCCcccceeeeeeeecchHHHHHHH
Confidence            3347899999999999999999999870                         01356888999999999999999985


No 64 
>cd00729 rubredoxin_SM Rubredoxin, Small Modular nonheme iron binding domain containing a [Fe(SCys)4] center, present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), and  believed to be involved in electron transfer. Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain. Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=91.57  E-value=0.16  Score=20.16  Aligned_cols=25  Identities=40%  Similarity=0.949  Sum_probs=14.3

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcc
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAH   71 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   71 (92)
                      .|.|.+||..+...            ..|..|+.|+.
T Consensus         2 ~~~C~~CG~i~~g~------------~~p~~CP~Cg~   26 (34)
T cd00729           2 VWVCPVCGYIHEGE------------EAPEKCPICGA   26 (34)
T ss_pred             eEECCCCCCEeECC------------cCCCcCcCCCC
Confidence            36677777554332            14567777764


No 65 
>smart00531 TFIIE Transcription initiation factor IIE.
Probab=91.47  E-value=0.098  Score=27.90  Aligned_cols=38  Identities=16%  Similarity=0.363  Sum_probs=25.2

Q ss_pred             CCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcccc
Q psy5652          32 SSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSA   73 (92)
Q Consensus        32 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   73 (92)
                      +...|.|+.|+..|.....+..-   .. ...|.|+.|+...
T Consensus        96 ~~~~Y~Cp~C~~~y~~~ea~~~~---d~-~~~f~Cp~Cg~~l  133 (147)
T smart00531       96 NNAYYKCPNCQSKYTFLEANQLL---DM-DGTFTCPRCGEEL  133 (147)
T ss_pred             CCcEEECcCCCCEeeHHHHHHhc---CC-CCcEECCCCCCEE
Confidence            44578999999888866544321   11 3349999998654


No 66 
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=91.45  E-value=0.21  Score=33.43  Aligned_cols=12  Identities=25%  Similarity=0.520  Sum_probs=6.8

Q ss_pred             CCceeCCCCCcc
Q psy5652          33 SHLYVCFKCGYH   44 (92)
Q Consensus        33 ~~~~~c~~c~~~   44 (92)
                      ..|..|+.||..
T Consensus       473 ~~p~~Cp~Cgs~  484 (730)
T COG1198         473 PIPQSCPECGSE  484 (730)
T ss_pred             CCCCCCCCCCCC
Confidence            345566666653


No 67 
>TIGR00373 conserved hypothetical protein TIGR00373. This family of proteins is, so far, restricted to archaeal genomes. The family appears to be distantly related to the N-terminal region of the eukaryotic transcription initiation factor IIE alpha chain.
Probab=91.23  E-value=0.24  Score=26.83  Aligned_cols=34  Identities=15%  Similarity=0.365  Sum_probs=26.4

Q ss_pred             CCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcccc
Q psy5652          31 DSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSA   73 (92)
Q Consensus        31 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   73 (92)
                      .+..-|.|+.|+..|.....+.         -.|.|+.||...
T Consensus       105 ~~~~~Y~Cp~c~~r~tf~eA~~---------~~F~Cp~Cg~~L  138 (158)
T TIGR00373       105 TNNMFFICPNMCVRFTFNEAME---------LNFTCPRCGAML  138 (158)
T ss_pred             cCCCeEECCCCCcEeeHHHHHH---------cCCcCCCCCCEe
Confidence            3456799999999888777664         269999999754


No 68 
>COG1592 Rubrerythrin [Energy production and conversion]
Probab=91.23  E-value=0.2  Score=27.37  Aligned_cols=25  Identities=44%  Similarity=1.095  Sum_probs=19.9

Q ss_pred             CceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcc
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAH   71 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   71 (92)
                      +.|.|++||..             +.|+.|.+||.|+.
T Consensus       133 ~~~vC~vCGy~-------------~~ge~P~~CPiCga  157 (166)
T COG1592         133 KVWVCPVCGYT-------------HEGEAPEVCPICGA  157 (166)
T ss_pred             CEEEcCCCCCc-------------ccCCCCCcCCCCCC
Confidence            37999999864             35578999999983


No 69 
>PHA00626 hypothetical protein
Probab=91.11  E-value=0.31  Score=21.63  Aligned_cols=14  Identities=43%  Similarity=1.087  Sum_probs=10.4

Q ss_pred             CceeCCCCCccCCC
Q psy5652          34 HLYVCFKCGYHQYN   47 (92)
Q Consensus        34 ~~~~c~~c~~~~~~   47 (92)
                      ..|.|+.||..|..
T Consensus        22 nrYkCkdCGY~ft~   35 (59)
T PHA00626         22 DDYVCCDCGYNDSK   35 (59)
T ss_pred             cceEcCCCCCeech
Confidence            46888888876654


No 70 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=90.47  E-value=0.19  Score=21.26  Aligned_cols=11  Identities=36%  Similarity=0.688  Sum_probs=7.0

Q ss_pred             ceeCCCCCccC
Q psy5652          35 LYVCFKCGYHQ   45 (92)
Q Consensus        35 ~~~c~~c~~~~   45 (92)
                      ...|+.||..+
T Consensus        21 ~~~Cp~CG~~~   31 (46)
T PRK00398         21 GVRCPYCGYRI   31 (46)
T ss_pred             ceECCCCCCeE
Confidence            45777777544


No 71 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=90.31  E-value=0.14  Score=21.28  Aligned_cols=15  Identities=13%  Similarity=0.246  Sum_probs=9.0

Q ss_pred             Ccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDAD   15 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~   15 (92)
                      |.|..||..|.....
T Consensus         6 y~C~~Cg~~fe~~~~   20 (42)
T PF09723_consen    6 YRCEECGHEFEVLQS   20 (42)
T ss_pred             EEeCCCCCEEEEEEE
Confidence            467777766654433


No 72 
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=90.21  E-value=0.29  Score=26.44  Aligned_cols=17  Identities=24%  Similarity=0.491  Sum_probs=12.4

Q ss_pred             CceeCCCCCccCCCHHH
Q psy5652          34 HLYVCFKCGYHQYNSDR   50 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~   50 (92)
                      +.+.|+.||..|.....
T Consensus        27 ~~~~c~~c~~~f~~~e~   43 (154)
T PRK00464         27 RRRECLACGKRFTTFER   43 (154)
T ss_pred             eeeeccccCCcceEeEe
Confidence            34889999988866543


No 73 
>PRK06266 transcription initiation factor E subunit alpha; Validated
Probab=89.45  E-value=0.38  Score=26.63  Aligned_cols=34  Identities=18%  Similarity=0.502  Sum_probs=25.7

Q ss_pred             CCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccC
Q psy5652          32 SSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSAT   74 (92)
Q Consensus        32 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   74 (92)
                      +..-|.|+.|+..|.....+.         -.|.|+.||....
T Consensus       114 ~~~~Y~Cp~C~~rytf~eA~~---------~~F~Cp~Cg~~L~  147 (178)
T PRK06266        114 NNMFFFCPNCHIRFTFDEAME---------YGFRCPQCGEMLE  147 (178)
T ss_pred             CCCEEECCCCCcEEeHHHHhh---------cCCcCCCCCCCCe
Confidence            345799999998888776542         3699999996553


No 74 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=89.26  E-value=0.26  Score=23.14  Aligned_cols=40  Identities=10%  Similarity=0.286  Sum_probs=23.9

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCC--CCCccCCCHH
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCF--KCGYHQYNSD   49 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~--~c~~~~~~~~   49 (92)
                      +.|+.|+......+.-.         ......+.-++|.  +||..|....
T Consensus         2 m~CP~Cg~~a~irtSr~---------~s~~~~~~Y~qC~N~eCg~tF~t~e   43 (72)
T PRK09678          2 FHCPLCQHAAHARTSRY---------ITDTTKERYHQCQNVNCSATFITYE   43 (72)
T ss_pred             ccCCCCCCccEEEEChh---------cChhhheeeeecCCCCCCCEEEEEE
Confidence            46888887654443322         1222455677887  8888776543


No 75 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=88.39  E-value=0.8  Score=16.71  Aligned_cols=9  Identities=33%  Similarity=0.947  Sum_probs=6.1

Q ss_pred             CceeCCCCC
Q psy5652          34 HLYVCFKCG   42 (92)
Q Consensus        34 ~~~~c~~c~   42 (92)
                      ..|.|+.||
T Consensus        15 v~f~CPnCG   23 (24)
T PF07754_consen   15 VPFPCPNCG   23 (24)
T ss_pred             ceEeCCCCC
Confidence            467777776


No 76 
>TIGR02300 FYDLN_acid conserved hypothetical protein TIGR02300. Members of this family are bacterial proteins with a conserved motif [KR]FYDLN, sometimes flanked by a pair of CXXC motifs, followed by a long region of low complexity sequence in which roughly half the residues are Asp and Glu, including multiple runs of five or more acidic residues. The function of members of this family is unknown.
Probab=88.28  E-value=0.41  Score=24.99  Aligned_cols=14  Identities=14%  Similarity=-0.204  Sum_probs=8.3

Q ss_pred             ceeCCCCCccCCCH
Q psy5652          35 LYVCFKCGYHQYNS   48 (92)
Q Consensus        35 ~~~c~~c~~~~~~~   48 (92)
                      |-.|+.||..|...
T Consensus        26 p~vcP~cg~~~~~~   39 (129)
T TIGR02300        26 PAVSPYTGEQFPPE   39 (129)
T ss_pred             CccCCCcCCccCcc
Confidence            45666666665544


No 77 
>PF02892 zf-BED:  BED zinc finger;  InterPro: IPR003656 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents predicted BED-type zinc finger domains. The BED finger which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain []. Some proteins known to contain a BED domain include animal, plant and fungi AC1 and Hobo-like transposases; Caenorhabditis elegans Dpy-20 protein, a predicted cuticular gene transcriptional regulator; Drosophila BEAF (boundary element-associated factor), thought to be involved in chromatin insulation; Drosophila DREF, a transcriptional regulator for S-phase genes; and tobacco 3AF1 and tomato E4/E8-BP1, light- and ethylene-regulated DNA binding proteins that contain two BED fingers. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding; PDB: 2DJR_A 2CT5_A.
Probab=88.27  E-value=0.68  Score=19.18  Aligned_cols=22  Identities=36%  Similarity=0.699  Sum_probs=8.8

Q ss_pred             CccCCcCccccCC----hHHHHHHHH
Q psy5652          63 PFKCEFCAHSATS----KSNLKMHIM   84 (92)
Q Consensus        63 ~~~c~~c~~~~~~----~~~l~~h~~   84 (92)
                      ...|..|++.+..    .++|..|+.
T Consensus        16 ~a~C~~C~~~~~~~~~~ts~l~~HL~   41 (45)
T PF02892_consen   16 KAKCKYCGKVIKYSSGGTSNLKRHLK   41 (45)
T ss_dssp             -EEETTTTEE-----SSTHHHHHHHH
T ss_pred             eEEeCCCCeEEeeCCCcHHHHHHhhh
Confidence            3445555544433    245555553


No 78 
>cd00730 rubredoxin Rubredoxin; nonheme iron binding domains containing a [Fe(SCys)4] center. Rubredoxins are small nonheme iron proteins. The iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc. They are believed to be involved in electron transfer.
Probab=88.15  E-value=0.83  Score=19.84  Aligned_cols=13  Identities=15%  Similarity=0.416  Sum_probs=8.9

Q ss_pred             Ccccccccccccc
Q psy5652           1 MVCIFCRQLLPMD   13 (92)
Q Consensus         1 ~~C~~C~~~f~~~   13 (92)
                      |+|.+|+..+.-.
T Consensus         2 y~C~~CgyiYd~~   14 (50)
T cd00730           2 YECRICGYIYDPA   14 (50)
T ss_pred             cCCCCCCeEECCC
Confidence            5688888666544


No 79 
>KOG4173|consensus
Probab=87.83  E-value=0.15  Score=28.79  Aligned_cols=51  Identities=20%  Similarity=0.411  Sum_probs=35.8

Q ss_pred             eCCCCCccCCCHHHHHHHHHH----------hhCCCCccCCc--CccccCChHHHHHHHHHhc
Q psy5652          37 VCFKCGYHQYNSDRMKRHIRT----------HTGERPFKCEF--CAHSATSKSNLKMHIMVKH   87 (92)
Q Consensus        37 ~c~~c~~~~~~~~~l~~h~~~----------~~~~~~~~c~~--c~~~~~~~~~l~~h~~~~h   87 (92)
                      .|.+|.+.|+..-.|..|+..          -.|.--|+|..  |+..|.+......|+-.+|
T Consensus       108 sCs~C~r~~Pt~hLLd~HI~E~HDs~Fqa~veRG~dMy~ClvEgCt~KFkT~r~RkdH~I~~H  170 (253)
T KOG4173|consen  108 SCSFCKRAFPTGHLLDAHILEWHDSLFQALVERGQDMYQCLVEGCTEKFKTSRDRKDHMIRMH  170 (253)
T ss_pred             hhHHHHHhCCchhhhhHHHHHHHHHHHHHHHHcCccHHHHHHHhhhhhhhhhhhhhhHHHHhc
Confidence            678888888888777777752          23334477765  8877888777777765555


No 80 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=87.83  E-value=0.27  Score=21.21  Aligned_cols=13  Identities=15%  Similarity=0.386  Sum_probs=8.8

Q ss_pred             Ccccccccccccc
Q psy5652           1 MVCIFCRQLLPMD   13 (92)
Q Consensus         1 ~~C~~C~~~f~~~   13 (92)
                      |+|..|+..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (52)
T TIGR02605         6 YRCTACGHRFEVL   18 (52)
T ss_pred             EEeCCCCCEeEEE
Confidence            5677888776643


No 81 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=86.91  E-value=0.5  Score=26.99  Aligned_cols=24  Identities=25%  Similarity=0.642  Sum_probs=12.2

Q ss_pred             ccCCcCccccCChHHHHHHHHHhc
Q psy5652          64 FKCEFCAHSATSKSNLKMHIMVKH   87 (92)
Q Consensus        64 ~~c~~c~~~~~~~~~l~~h~~~~h   87 (92)
                      |.|..|+|.|.-..-+.+|+...|
T Consensus        78 ~~C~lc~KlFkg~eFV~KHI~nKH  101 (214)
T PF04959_consen   78 WRCPLCGKLFKGPEFVRKHIFNKH  101 (214)
T ss_dssp             EEE-SSS-EESSHHHHHHHHHHH-
T ss_pred             ECCCCCCcccCChHHHHHHHhhcC
Confidence            555556666665555555555554


No 82 
>smart00614 ZnF_BED BED zinc finger. DNA-binding domain in chromatin-boundary-element-binding proteins and transposases
Probab=86.56  E-value=0.9  Score=19.48  Aligned_cols=10  Identities=30%  Similarity=0.574  Sum_probs=5.0

Q ss_pred             eeCCCCCccC
Q psy5652          36 YVCFKCGYHQ   45 (92)
Q Consensus        36 ~~c~~c~~~~   45 (92)
                      ..|..|++.+
T Consensus        19 a~C~~C~~~l   28 (50)
T smart00614       19 AKCKYCGKKL   28 (50)
T ss_pred             EEecCCCCEe
Confidence            4455555544


No 83 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=85.74  E-value=0.76  Score=19.36  Aligned_cols=10  Identities=40%  Similarity=1.192  Sum_probs=5.4

Q ss_pred             eeCCCCCccC
Q psy5652          36 YVCFKCGYHQ   45 (92)
Q Consensus        36 ~~c~~c~~~~   45 (92)
                      |.|..||..+
T Consensus         3 Y~C~~Cg~~~   12 (44)
T smart00659        3 YICGECGREN   12 (44)
T ss_pred             EECCCCCCEe
Confidence            5555555544


No 84 
>PF00301 Rubredoxin:  Rubredoxin;  InterPro: IPR004039 Rubredoxin is a low molecular weight iron-containing bacterial protein involved in electron transfer [, ], sometimes replacing ferredoxin as an electron carrier []. The 3-D structures of a number of rubredoxins have been solved [, ]. The fold belongs to the alpha+beta class, with 2 alpha-helices and 2-3 beta-strands. Its active site contains an iron ion which is co-ordinated by the sulphurs of four conserved cysteine residues forming an almost regular tetrahedron. The conserved cysteines reside on two loops, which are the most conserved regions of the protein. In addition, a ring of acidic residues in the proximity of the [Fe(Cys)4] centre is also well-conserved []. ; GO: 0009055 electron carrier activity, 0046872 metal ion binding; PDB: 2RDV_C 1RDV_A 1S24_A 1T9O_B 1B2J_A 1SMW_A 2PVE_B 1BFY_A 1T9P_C 1C09_C ....
Probab=85.02  E-value=0.55  Score=20.11  Aligned_cols=15  Identities=13%  Similarity=0.383  Sum_probs=9.3

Q ss_pred             Ccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDAD   15 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~   15 (92)
                      |.|.+|+..+.....
T Consensus         2 y~C~~CgyvYd~~~G   16 (47)
T PF00301_consen    2 YQCPVCGYVYDPEKG   16 (47)
T ss_dssp             EEETTTSBEEETTTB
T ss_pred             cCCCCCCEEEcCCcC
Confidence            467777766555543


No 85 
>TIGR00595 priA primosomal protein N'. All proteins in this family for which functions are known are components of the primosome which is involved in replication, repair, and recombination.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=84.09  E-value=1.3  Score=28.51  Aligned_cols=10  Identities=30%  Similarity=0.627  Sum_probs=6.0

Q ss_pred             CceeCCCCCc
Q psy5652          34 HLYVCFKCGY   43 (92)
Q Consensus        34 ~~~~c~~c~~   43 (92)
                      .+..|+.|+.
T Consensus       252 ~~~~Cp~C~s  261 (505)
T TIGR00595       252 IPKTCPQCGS  261 (505)
T ss_pred             CCCCCCCCCC
Confidence            3556666665


No 86 
>KOG2593|consensus
Probab=84.06  E-value=0.5  Score=29.65  Aligned_cols=19  Identities=21%  Similarity=0.441  Sum_probs=9.7

Q ss_pred             CceeCCCCCccCCCHHHHH
Q psy5652          34 HLYVCFKCGYHQYNSDRMK   52 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~   52 (92)
                      ..|.|+.|.+.|.....++
T Consensus       127 ~~Y~Cp~C~kkyt~Lea~~  145 (436)
T KOG2593|consen  127 AGYVCPNCQKKYTSLEALQ  145 (436)
T ss_pred             ccccCCccccchhhhHHHH
Confidence            3455555555555544433


No 87 
>PF08790 zf-LYAR:  LYAR-type C2HC zinc finger ;  InterPro: IPR014898 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This C2HC zinc finger domain is found in LYAR proteins such as Q08288 from SWISSPROT, which are involved in cell growth regulation.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 1WJV_A.
Probab=83.94  E-value=0.27  Score=18.68  Aligned_cols=18  Identities=17%  Similarity=0.357  Sum_probs=11.0

Q ss_pred             Ccccccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDADFILG   19 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h   19 (92)
                      |.|-.|++.| ...+++.|
T Consensus         1 ~sCiDC~~~F-~~~~y~~H   18 (28)
T PF08790_consen    1 FSCIDCSKDF-DGDSYKSH   18 (28)
T ss_dssp             EEETTTTEEE-EGGGTTT-
T ss_pred             CeeecCCCCc-CcCCcCCC
Confidence            4577788888 44555543


No 88 
>PRK14873 primosome assembly protein PriA; Provisional
Probab=83.41  E-value=1.2  Score=29.83  Aligned_cols=10  Identities=30%  Similarity=0.836  Sum_probs=5.4

Q ss_pred             ceeCCCCCcc
Q psy5652          35 LYVCFKCGYH   44 (92)
Q Consensus        35 ~~~c~~c~~~   44 (92)
                      ++.|+.|+..
T Consensus       422 p~~Cp~Cgs~  431 (665)
T PRK14873        422 DWRCPRCGSD  431 (665)
T ss_pred             CccCCCCcCC
Confidence            4556666543


No 89 
>COG1773 Rubredoxin [Energy production and conversion]
Probab=82.38  E-value=1.8  Score=19.24  Aligned_cols=15  Identities=13%  Similarity=0.372  Sum_probs=9.6

Q ss_pred             Ccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDAD   15 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~   15 (92)
                      |+|..|+-.|.-..-
T Consensus         4 ~~C~~CG~vYd~e~G   18 (55)
T COG1773           4 WRCSVCGYVYDPEKG   18 (55)
T ss_pred             eEecCCceEeccccC
Confidence            467777776665543


No 90 
>smart00734 ZnF_Rad18 Rad18-like CCHC zinc finger. Yeast Rad18p functions with Rad5p in error-free post-replicative DNA repair. This zinc finger is likely to bind nucleic-acids.
Probab=82.31  E-value=2  Score=15.83  Aligned_cols=18  Identities=17%  Similarity=0.355  Sum_probs=9.1

Q ss_pred             eCCCCCccCCCHHHHHHHH
Q psy5652          37 VCFKCGYHQYNSDRMKRHI   55 (92)
Q Consensus        37 ~c~~c~~~~~~~~~l~~h~   55 (92)
                      .|++|++.+ ....+..|+
T Consensus         3 ~CPiC~~~v-~~~~in~HL   20 (26)
T smart00734        3 QCPVCFREV-PENLINSHL   20 (26)
T ss_pred             cCCCCcCcc-cHHHHHHHH
Confidence            466666655 333444443


No 91 
>KOG2186|consensus
Probab=79.76  E-value=0.48  Score=27.70  Aligned_cols=50  Identities=20%  Similarity=0.354  Sum_probs=33.4

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhC
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTG   60 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~   60 (92)
                      |.|.+||....-...-+        |+..-.+ .-|.|..|+..|.. .....|...-+.
T Consensus         4 FtCnvCgEsvKKp~vek--------H~srCrn-~~fSCIDC~k~F~~-~sYknH~kCITE   53 (276)
T KOG2186|consen    4 FTCNVCGESVKKPQVEK--------HMSRCRN-AYFSCIDCGKTFER-VSYKNHTKCITE   53 (276)
T ss_pred             EehhhhhhhccccchHH--------HHHhccC-CeeEEeeccccccc-chhhhhhhhcch
Confidence            57888988776655433        3322233 57899999999988 457777765443


No 92 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=79.08  E-value=1.1  Score=16.62  Aligned_cols=8  Identities=25%  Similarity=0.650  Sum_probs=3.8

Q ss_pred             cccccccc
Q psy5652           3 CIFCRQLL   10 (92)
Q Consensus         3 C~~C~~~f   10 (92)
                      |+.||..|
T Consensus        17 Cp~CG~~F   24 (26)
T PF10571_consen   17 CPHCGYDF   24 (26)
T ss_pred             CCCCCCCC
Confidence            44555444


No 93 
>PF01096 TFIIS_C:  Transcription factor S-II (TFIIS);  InterPro: IPR001222 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIs (TFIIS). In eukaryotes the initiation of transcription of protein encoding genes by polymerase II (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least eight different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, -IIH and -IIS []. During mRNA elongation, Pol II can encounter DNA sequences that cause reverse movement of the enzyme. Such backtracking involves extrusion of the RNA 3'-end into the pore, and can lead to transcriptional arrest. Escape from arrest requires cleavage of the extruded RNA with the help of TFIIS, which induces mRNA cleavage by enhancing the intrinsic nuclease activity of RNA polymerase (Pol) II, past template-encoded pause sites []. TFIIS extends from the polymerase surface via a pore to the internal active site. Two essential and invariant acidic residues in a TFIIS loop complement the Pol II active site and could position a metal ion and a water molecule for hydrolytic RNA cleavage. TFIIS also induces extensive structural changes in Pol II that would realign nucleic acids in the active centre.  TFIIS is a protein of about 300 amino acids. It contains three regions: a variable N-terminal domain not required for TFIIS activity; a conserved central domain required for Pol II binding; and a conserved C-terminal C4-type zinc finger essential for RNA cleavage. The zinc finger folds in a conformation termed a zinc ribbon [] characterised by a three-stranded antiparallel beta-sheet and two beta-hairpins. A backbone model for Pol II-TFIIS complex was obtained from X-ray analysis. It shows that a beta hairpin protrudes from the zinc finger and complements the pol II active site [].  Some viral proteins also contain the TFIIS zinc ribbon C-terminal domain. The Vaccinia virus protein, unlike its eukaryotic homologue, is an integral RNA polymerase subunit rather than a readily separable transcription factor []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003676 nucleic acid binding, 0008270 zinc ion binding, 0006351 transcription, DNA-dependent; PDB: 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I 3I4M_I ....
Probab=77.88  E-value=1.8  Score=17.63  Aligned_cols=36  Identities=22%  Similarity=0.444  Sum_probs=16.9

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCC--CceeCCCCCccC
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSS--HLYVCFKCGYHQ   45 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~--~~~~c~~c~~~~   45 (92)
                      ++|+.|+..-.....++         .++..+.  .-|.|..|+..+
T Consensus         1 ~~Cp~Cg~~~a~~~~~Q---------~rsaDE~~T~fy~C~~C~~~w   38 (39)
T PF01096_consen    1 IKCPKCGHNEAVFFQIQ---------TRSADEPMTLFYVCCNCGHRW   38 (39)
T ss_dssp             S--SSS-SSEEEEEEES---------SSSSSSSSEEEEEESSSTEEE
T ss_pred             CCCcCCCCCeEEEEEee---------ccCCCCCCeEEEEeCCCCCee
Confidence            46888876533333322         2222221  357888888654


No 94 
>TIGR03831 YgiT_finger YgiT-type zinc finger domain. This domain model describes a small domain with two copies of a putative zinc-binding motif CXXC (usually CXXCG). Most member proteins consist largely of this domain or else carry an additional C-terminal helix-turn-helix domain, resembling that of the phage protein Cro and modeled by pfam01381.
Probab=77.26  E-value=0.89  Score=18.76  Aligned_cols=14  Identities=29%  Similarity=0.634  Sum_probs=9.5

Q ss_pred             CceeCCCCCccCCC
Q psy5652          34 HLYVCFKCGYHQYN   47 (92)
Q Consensus        34 ~~~~c~~c~~~~~~   47 (92)
                      ..+.|+.||+.+.+
T Consensus        31 p~~~C~~CGE~~~~   44 (46)
T TIGR03831        31 PALVCPQCGEEYLD   44 (46)
T ss_pred             CccccccCCCEeeC
Confidence            34678888876654


No 95 
>PF14446 Prok-RING_1:  Prokaryotic RING finger family 1
Probab=77.04  E-value=1.3  Score=19.57  Aligned_cols=16  Identities=19%  Similarity=0.505  Sum_probs=11.8

Q ss_pred             cccccccccccccccc
Q psy5652           2 VCIFCRQLLPMDADFI   17 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~   17 (92)
                      +|.+|++.|...++..
T Consensus         7 ~C~~Cg~~~~~~dDiV   22 (54)
T PF14446_consen    7 KCPVCGKKFKDGDDIV   22 (54)
T ss_pred             cChhhCCcccCCCCEE
Confidence            5889998888666543


No 96 
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=76.90  E-value=0.86  Score=18.39  Aligned_cols=13  Identities=15%  Similarity=0.299  Sum_probs=8.2

Q ss_pred             Ccccccccccccc
Q psy5652           1 MVCIFCRQLLPMD   13 (92)
Q Consensus         1 ~~C~~C~~~f~~~   13 (92)
                      |.|..|+..|...
T Consensus         6 y~C~~Cg~~fe~~   18 (41)
T smart00834        6 YRCEDCGHTFEVL   18 (41)
T ss_pred             EEcCCCCCEEEEE
Confidence            4677777666543


No 97 
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones]
Probab=76.61  E-value=0.91  Score=30.49  Aligned_cols=31  Identities=23%  Similarity=0.484  Sum_probs=21.3

Q ss_pred             eCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcccc
Q psy5652          37 VCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSA   73 (92)
Q Consensus        37 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   73 (92)
                      -|+.|.+-|.+...-    |.|  ..|..|+.||...
T Consensus       153 lC~~C~~EY~dP~nR----RfH--AQp~aCp~CGP~~  183 (750)
T COG0068         153 LCPFCDKEYKDPLNR----RFH--AQPIACPKCGPHL  183 (750)
T ss_pred             CCHHHHHHhcCcccc----ccc--cccccCcccCCCe
Confidence            488888877776542    334  4588999999633


No 98 
>PF03811 Zn_Tnp_IS1:  InsA N-terminal domain;  InterPro: IPR003220 Insertion elements are mobile elements in DNA, usually encoding proteins required for transposition, for example transposases. Protein InsA is absolutely required for transposition of insertion element 1. This entry represents a short zinc binding domain found in IS1 InsA family protein. It is found at the N terminus of the protein and may be a DNA-binding domain.; GO: 0006313 transposition, DNA-mediated
Probab=76.58  E-value=3.6  Score=16.53  Aligned_cols=14  Identities=29%  Similarity=0.774  Sum_probs=7.0

Q ss_pred             CCCCCCCceeCCCC
Q psy5652          28 PRPDSSHLYVCFKC   41 (92)
Q Consensus        28 ~~~~~~~~~~c~~c   41 (92)
                      ....+...|.|..|
T Consensus        22 ~~~~G~qryrC~~C   35 (36)
T PF03811_consen   22 KSPSGHQRYRCKDC   35 (36)
T ss_pred             CCCCCCEeEecCcC
Confidence            33344445666555


No 99 
>PF04959 ARS2:  Arsenite-resistance protein 2;  InterPro: IPR007042 This entry represents Arsenite-resistance protein 2 (also known as Serrate RNA effector molecule homolog) which is thought to play a role in arsenite resistance [], although does not directly confer arsenite resistance but rather modulates arsenic sensitivity []. Arsenite is a carcinogenic compound which can act as a comutagen by inhibiting DNA repair. It is also involved in cell cycle progression at S phase. ; PDB: 3AX1_A.
Probab=76.43  E-value=3.1  Score=23.92  Aligned_cols=26  Identities=19%  Similarity=0.395  Sum_probs=20.9

Q ss_pred             CCCceeCCCCCccCCCHHHHHHHHHH
Q psy5652          32 SSHLYVCFKCGYHQYNSDRMKRHIRT   57 (92)
Q Consensus        32 ~~~~~~c~~c~~~~~~~~~l~~h~~~   57 (92)
                      ++..|.|..|++.|.....+.+|+..
T Consensus        74 ~~~K~~C~lc~KlFkg~eFV~KHI~n   99 (214)
T PF04959_consen   74 DEDKWRCPLCGKLFKGPEFVRKHIFN   99 (214)
T ss_dssp             SSEEEEE-SSS-EESSHHHHHHHHHH
T ss_pred             cCCEECCCCCCcccCChHHHHHHHhh
Confidence            44569999999999999999999975


No 100
>KOG3408|consensus
Probab=75.49  E-value=2.4  Score=22.03  Aligned_cols=25  Identities=20%  Similarity=0.547  Sum_probs=22.0

Q ss_pred             CCceeCCCCCccCCCHHHHHHHHHH
Q psy5652          33 SHLYVCFKCGYHQYNSDRMKRHIRT   57 (92)
Q Consensus        33 ~~~~~c~~c~~~~~~~~~l~~h~~~   57 (92)
                      ...|.|..|.+-|.+...|+.|.++
T Consensus        55 ~GqfyCi~CaRyFi~~~~l~~H~kt   79 (129)
T KOG3408|consen   55 GGQFYCIECARYFIDAKALKTHFKT   79 (129)
T ss_pred             CceeehhhhhhhhcchHHHHHHHhc
Confidence            3469999999999999999999875


No 101
>PRK05580 primosome assembly protein PriA; Validated
Probab=75.40  E-value=3.8  Score=27.59  Aligned_cols=11  Identities=27%  Similarity=0.555  Sum_probs=7.1

Q ss_pred             CceeCCCCCcc
Q psy5652          34 HLYVCFKCGYH   44 (92)
Q Consensus        34 ~~~~c~~c~~~   44 (92)
                      .+..|+.|+..
T Consensus       420 ~~~~Cp~Cg~~  430 (679)
T PRK05580        420 IPKACPECGST  430 (679)
T ss_pred             CCCCCCCCcCC
Confidence            45667777654


No 102
>PF13878 zf-C2H2_3:  zinc-finger of acetyl-transferase ESCO
Probab=75.34  E-value=1.4  Score=18.22  Aligned_cols=10  Identities=30%  Similarity=0.607  Sum_probs=5.0

Q ss_pred             cccccccccc
Q psy5652           3 CIFCRQLLPM   12 (92)
Q Consensus         3 C~~C~~~f~~   12 (92)
                      |+.|++.|..
T Consensus        16 C~~CgM~Y~~   25 (41)
T PF13878_consen   16 CPTCGMLYSP   25 (41)
T ss_pred             CCCCCCEECC
Confidence            5555555443


No 103
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=75.24  E-value=4.3  Score=17.23  Aligned_cols=12  Identities=50%  Similarity=1.184  Sum_probs=8.8

Q ss_pred             ceeCCCCCccCC
Q psy5652          35 LYVCFKCGYHQY   46 (92)
Q Consensus        35 ~~~c~~c~~~~~   46 (92)
                      .+.|+.||..+.
T Consensus        20 ~~vC~~Cg~~~~   31 (52)
T smart00661       20 RFVCRKCGYEEP   31 (52)
T ss_pred             EEECCcCCCeEE
Confidence            678888886543


No 104
>PF15269 zf-C2H2_7:  Zinc-finger
Probab=75.17  E-value=2.9  Score=17.69  Aligned_cols=20  Identities=35%  Similarity=0.688  Sum_probs=13.8

Q ss_pred             ccCCcCccccCChHHHHHHH
Q psy5652          64 FKCEFCAHSATSKSNLKMHI   83 (92)
Q Consensus        64 ~~c~~c~~~~~~~~~l~~h~   83 (92)
                      |+|.+|.....-.+.|..|+
T Consensus        21 ykcfqcpftc~~kshl~nhm   40 (54)
T PF15269_consen   21 YKCFQCPFTCNEKSHLFNHM   40 (54)
T ss_pred             ceeecCCcccchHHHHHHHH
Confidence            56777766666677777776


No 105
>COG1997 RPL43A Ribosomal protein L37AE/L43A [Translation, ribosomal structure and biogenesis]
Probab=75.00  E-value=2.9  Score=20.44  Aligned_cols=30  Identities=27%  Similarity=0.443  Sum_probs=17.6

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccC
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSAT   74 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   74 (92)
                      .+.|+.|++.        ...+..  ..-|.|..|+..|.
T Consensus        35 ~~~Cp~C~~~--------~VkR~a--~GIW~C~kCg~~fA   64 (89)
T COG1997          35 KHVCPFCGRT--------TVKRIA--TGIWKCRKCGAKFA   64 (89)
T ss_pred             CCcCCCCCCc--------ceeeec--cCeEEcCCCCCeec
Confidence            5778888754        112222  33578888876664


No 106
>TIGR00622 ssl1 transcription factor ssl1. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=74.99  E-value=5  Score=20.64  Aligned_cols=84  Identities=13%  Similarity=0.176  Sum_probs=46.7

Q ss_pred             cccccccccccccccccccccC---CCCCCCCCC--CCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccCCh
Q psy5652           2 VCIFCRQLLPMDADFILGHCKR---CSNMPRPDS--SHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSATSK   76 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~---~~~~~~~~~--~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~~~   76 (92)
                      +|++|+-.+....+|.+-+--.   ....++...  ...-.|--|...|........  ..-.....|.|..|...|=-.
T Consensus        17 ~CpiCgLtLVss~HLARSyHHLfPl~~f~ev~~~~~~~~~~C~~C~~~f~~~~~~~~--~~~~~~~~y~C~~C~~~FC~d   94 (112)
T TIGR00622        17 ECPICGLTLILSTHLARSYHHLFPLKAFQEIPLEEYNGSRFCFGCQGPFPKPPVSPF--DELKDSHRYVCAVCKNVFCVD   94 (112)
T ss_pred             cCCcCCCEEeccchHHHhhhccCCCcccccccccccCCCCcccCcCCCCCCcccccc--cccccccceeCCCCCCccccc
Confidence            5899999988888888642110   001111111  111247777777765421110  001223478999999888777


Q ss_pred             HHHHHHHHHhcc
Q psy5652          77 SNLKMHIMVKHQ   88 (92)
Q Consensus        77 ~~l~~h~~~~h~   88 (92)
                      -+...|. ..|+
T Consensus        95 CD~fiHe-~Lh~  105 (112)
T TIGR00622        95 CDVFVHE-SLHC  105 (112)
T ss_pred             cchhhhh-hccC
Confidence            7777776 5553


No 107
>PF08274 PhnA_Zn_Ribbon:  PhnA Zinc-Ribbon ;  InterPro: IPR013987 The PhnA protein family includes the uncharacterised Escherichia coli protein PhnA and its homologues. The E. coli phnA gene is part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage []. The protein is not related to the characterised phosphonoacetate hydrolase designated PhnA []. This entry represents the N-terminal domain of PhnA, which is predicted to form a zinc-ribbon.; PDB: 2AKL_A.
Probab=74.72  E-value=1.6  Score=16.82  Aligned_cols=9  Identities=56%  Similarity=1.287  Sum_probs=4.8

Q ss_pred             CceeCCCCC
Q psy5652          34 HLYVCFKCG   42 (92)
Q Consensus        34 ~~~~c~~c~   42 (92)
                      ..+.|++|+
T Consensus        18 ~~~vCp~C~   26 (30)
T PF08274_consen   18 ELLVCPECG   26 (30)
T ss_dssp             SSEEETTTT
T ss_pred             CEEeCCccc
Confidence            345565555


No 108
>smart00440 ZnF_C2C2 C2C2 Zinc finger. Nucleic-acid-binding motif in transcriptional elongation factor TFIIS and RNA polymerases.
Probab=74.40  E-value=5  Score=16.40  Aligned_cols=12  Identities=50%  Similarity=1.040  Sum_probs=8.2

Q ss_pred             CceeCCCCCccC
Q psy5652          34 HLYVCFKCGYHQ   45 (92)
Q Consensus        34 ~~~~c~~c~~~~   45 (92)
                      .-|.|..|+..+
T Consensus        27 ~fy~C~~C~~~w   38 (40)
T smart00440       27 VFYVCTKCGHRW   38 (40)
T ss_pred             EEEEeCCCCCEe
Confidence            357888887654


No 109
>COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair]
Probab=74.03  E-value=3.4  Score=28.14  Aligned_cols=47  Identities=19%  Similarity=0.404  Sum_probs=33.5

Q ss_pred             ccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccc
Q psy5652           3 CIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHS   72 (92)
Q Consensus         3 C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~   72 (92)
                      |..||..+.....-.        .+.-|.......|..||..               ...|..|+.|+..
T Consensus       438 C~~Cg~v~~Cp~Cd~--------~lt~H~~~~~L~CH~Cg~~---------------~~~p~~Cp~Cgs~  484 (730)
T COG1198         438 CRDCGYIAECPNCDS--------PLTLHKATGQLRCHYCGYQ---------------EPIPQSCPECGSE  484 (730)
T ss_pred             cccCCCcccCCCCCc--------ceEEecCCCeeEeCCCCCC---------------CCCCCCCCCCCCC
Confidence            777777777766433        4666776678899999842               2468899999854


No 110
>PF05443 ROS_MUCR:  ROS/MUCR transcriptional regulator protein;  InterPro: IPR008807 This family consists of several ROS/MUCR transcriptional regulator proteins. The ros chromosomal gene is present in octopine and nopaline strains of Agrobacterium tumefaciens as well as in Rhizobium meliloti (Sinorhizobium meliloti). This gene encodes a 15.5 kDa protein that specifically represses the virC and virD operons in the virulence region of the Ti plasmid [] and is necessary for succinoglycan production []. S. meliloti can produce two types of acidic exopolysaccharides, succinoglycan and galactoglucan, that are interchangeable for infection of Medicago sativa (Alfalfa) nodules. MucR from S. meliloti acts as a transcriptional repressor that blocks the expression of the exp genes responsible for galactoglucan production therefore allowing the exclusive production of succinoglycan [].; GO: 0003677 DNA binding, 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2JSP_A.
Probab=73.61  E-value=2.6  Score=22.27  Aligned_cols=24  Identities=42%  Similarity=0.912  Sum_probs=15.5

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhCC
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTGE   61 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~~   61 (92)
                      .-.|-+||+.|..   |.+|++.|.|-
T Consensus        72 ~i~clecGk~~k~---LkrHL~~~~gl   95 (132)
T PF05443_consen   72 YIICLECGKKFKT---LKRHLRTHHGL   95 (132)
T ss_dssp             -EE-TBT--EESB---HHHHHHHTT-S
T ss_pred             eeEEccCCcccch---HHHHHHHccCC
Confidence            4689999999887   58899888653


No 111
>COG4530 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=73.01  E-value=2.8  Score=21.44  Aligned_cols=14  Identities=14%  Similarity=-0.133  Sum_probs=8.2

Q ss_pred             CceeCCCCCccCCC
Q psy5652          34 HLYVCFKCGYHQYN   47 (92)
Q Consensus        34 ~~~~c~~c~~~~~~   47 (92)
                      .|..|+.||+.|+.
T Consensus        25 dPiVsPytG~s~P~   38 (129)
T COG4530          25 DPIVSPYTGKSYPR   38 (129)
T ss_pred             CccccCcccccchH
Confidence            35566666666643


No 112
>PF01286 XPA_N:  XPA protein N-terminal;  InterPro: IPR022652 Xeroderma pigmentosum (XP) [] is a human autosomal recessive disease, characterised by a high incidence of sunlight-induced skin cancer. Skin cells of individual's with this condition are hypersensitive to ultraviolet light, due to defects in the incision step of DNA excision repair. There are a minimum of seven genetic complementation groups involved in this pathway: XP-A to XP-G. XP-A is the most severe form of the disease and is due to defects in a 30 kDa nuclear protein called XPA (or XPAC) []. The sequence of the XPA protein is conserved from higher eukaryotes [] to yeast (gene RAD14) []. XPA is a hydrophilic protein of 247 to 296 amino-acid residues which has a C4-type zinc finger motif in its central section. This entry contains the zinc-finger containing region in the XPA protein. It is found N-terminal to PF05181 from PFAM ; PDB: 1D4U_A 1XPA_A.
Probab=72.99  E-value=1.6  Score=17.35  Aligned_cols=16  Identities=13%  Similarity=0.042  Sum_probs=8.5

Q ss_pred             cccccccccccccccc
Q psy5652           2 VCIFCRQLLPMDADFI   17 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~   17 (92)
                      +|.+|++.|.++..+.
T Consensus         5 ~C~eC~~~f~dSyL~~   20 (34)
T PF01286_consen    5 KCDECGKPFMDSYLLN   20 (34)
T ss_dssp             E-TTT--EES-SSCCC
T ss_pred             hHhHhCCHHHHHHHHH
Confidence            4888998888776544


No 113
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=72.09  E-value=4.8  Score=15.47  Aligned_cols=12  Identities=17%  Similarity=0.335  Sum_probs=7.1

Q ss_pred             cccccccccccc
Q psy5652           2 VCIFCRQLLPMD   13 (92)
Q Consensus         2 ~C~~C~~~f~~~   13 (92)
                      +|..|++.+...
T Consensus         1 ~C~~C~~~i~~~   12 (39)
T smart00132        1 KCAGCGKPIRGG   12 (39)
T ss_pred             CccccCCcccCC
Confidence            366677665554


No 114
>PF10083 DUF2321:  Uncharacterized protein conserved in bacteria (DUF2321);  InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=71.72  E-value=3.5  Score=22.46  Aligned_cols=17  Identities=18%  Similarity=0.337  Sum_probs=12.3

Q ss_pred             CceeCCCCCccCCCHHH
Q psy5652          34 HLYVCFKCGYHQYNSDR   50 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~   50 (92)
                      .|..|..||+.|++...
T Consensus        67 ~PsYC~~CGkpyPWt~~   83 (158)
T PF10083_consen   67 APSYCHNCGKPYPWTEN   83 (158)
T ss_pred             CChhHHhCCCCCchHHH
Confidence            57778888888877644


No 115
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=71.41  E-value=1.4  Score=18.68  Aligned_cols=14  Identities=14%  Similarity=0.396  Sum_probs=8.0

Q ss_pred             cccccccccccccc
Q psy5652           2 VCIFCRQLLPMDAD   15 (92)
Q Consensus         2 ~C~~C~~~f~~~~~   15 (92)
                      .|+.||........
T Consensus         1 ~CP~Cg~~a~ir~S   14 (47)
T PF04606_consen    1 RCPHCGSKARIRTS   14 (47)
T ss_pred             CcCCCCCeeEEEEc
Confidence            36777765544443


No 116
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=71.06  E-value=3.5  Score=21.10  Aligned_cols=22  Identities=23%  Similarity=0.465  Sum_probs=16.0

Q ss_pred             CCCceeCCCCCccCCCHHHHHH
Q psy5652          32 SSHLYVCFKCGYHQYNSDRMKR   53 (92)
Q Consensus        32 ~~~~~~c~~c~~~~~~~~~l~~   53 (92)
                      ....+.|+.||..+.+......
T Consensus        28 ~~~~~~C~~CGe~~~~~e~~~~   49 (127)
T TIGR03830        28 GVPGWYCPACGEELLDPEESKR   49 (127)
T ss_pred             eeeeeECCCCCCEEEcHHHHHH
Confidence            3346889999998887765443


No 117
>COG4306 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=70.40  E-value=5.1  Score=21.03  Aligned_cols=42  Identities=17%  Similarity=0.143  Sum_probs=23.3

Q ss_pred             cccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCHH
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNSD   49 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~~   49 (92)
                      .|+.|....+-...+..      ....-+.=+.|..|..||..|++..
T Consensus        41 qcp~csasirgd~~veg------vlglg~dye~psfchncgs~fpwte   82 (160)
T COG4306          41 QCPICSASIRGDYYVEG------VLGLGGDYEPPSFCHNCGSRFPWTE   82 (160)
T ss_pred             cCCccCCcccccceeee------eeccCCCCCCcchhhcCCCCCCcHH
Confidence            36666655544443331      1112223345777889999888764


No 118
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=70.07  E-value=2.1  Score=18.52  Aligned_cols=10  Identities=20%  Similarity=0.554  Sum_probs=7.9

Q ss_pred             Cccccccccc
Q psy5652           1 MVCIFCRQLL   10 (92)
Q Consensus         1 ~~C~~C~~~f   10 (92)
                      |+|..|++.|
T Consensus         7 Y~C~~Cg~~~   16 (49)
T COG1996           7 YKCARCGREV   16 (49)
T ss_pred             EEhhhcCCee
Confidence            5688888887


No 119
>PF12013 DUF3505:  Protein of unknown function (DUF3505);  InterPro: IPR022698  This family of proteins is functionally uncharacterised. This protein is found in eukaryotes. Proteins in this family are typically between 247 to 1018 amino acids in length. This region contains two segments that are likely to be C2H2 zinc binding domains. 
Probab=69.99  E-value=7  Score=19.63  Aligned_cols=23  Identities=35%  Similarity=0.817  Sum_probs=15.2

Q ss_pred             eeC----CCCCccCCCHHHHHHHHHHh
Q psy5652          36 YVC----FKCGYHQYNSDRMKRHIRTH   58 (92)
Q Consensus        36 ~~c----~~c~~~~~~~~~l~~h~~~~   58 (92)
                      |.|    ..|+....+...+..|.+..
T Consensus        81 ~~C~~~~~~C~y~~~~~~~m~~H~~~~  107 (109)
T PF12013_consen   81 YRCQCDPPHCGYITRSKKTMRKHWRKE  107 (109)
T ss_pred             eeeecCCCCCCcEeccHHHHHHHHHHh
Confidence            666    67777666666666666543


No 120
>KOG1842|consensus
Probab=69.62  E-value=3.4  Score=26.43  Aligned_cols=26  Identities=15%  Similarity=0.319  Sum_probs=19.8

Q ss_pred             CceeCCCCCccCCCHHHHHHHHHHhh
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIRTHT   59 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~~~~   59 (92)
                      ..|.|+.|...|.+...|..|.-.-.
T Consensus        14 egflCPiC~~dl~~~~~L~~H~d~eH   39 (505)
T KOG1842|consen   14 EGFLCPICLLDLPNLSALNDHLDVEH   39 (505)
T ss_pred             hcccCchHhhhhhhHHHHHHHHhhhc
Confidence            46788888888888888888876533


No 121
>PF04423 Rad50_zn_hook:  Rad50 zinc hook motif;  InterPro: IPR007517 The Mre11 complex (Mre11 Rad50 Nbs1) is central to chromosomal maintenance and functions in homologous recombination, telomere maintenance and sister chromatid association. The Rad50 coiled-coil region contains a dimer interface at the apex of the coiled coils in which pairs of conserved Cys-X-X-Cys motifs form interlocking hooks that bind one Zn ion. This alignment includes the zinc hook motif and a short stretch of coiled-coil on either side.; GO: 0004518 nuclease activity, 0005524 ATP binding, 0008270 zinc ion binding, 0006281 DNA repair; PDB: 1L8D_B.
Probab=68.68  E-value=1.7  Score=18.97  Aligned_cols=9  Identities=33%  Similarity=0.608  Sum_probs=2.7

Q ss_pred             CCCCCccCC
Q psy5652          38 CFKCGYHQY   46 (92)
Q Consensus        38 c~~c~~~~~   46 (92)
                      ||+|++.|.
T Consensus        23 CPlC~r~l~   31 (54)
T PF04423_consen   23 CPLCGRPLD   31 (54)
T ss_dssp             -TTT--EE-
T ss_pred             CCCCCCCCC
Confidence            555555544


No 122
>PF06524 NOA36:  NOA36 protein;  InterPro: IPR010531 This family consists of several NOA36 proteins which contain 29 highly conserved cysteine residues. The function of this protein is unknown.; GO: 0008270 zinc ion binding, 0005634 nucleus
Probab=68.67  E-value=1.2  Score=26.33  Aligned_cols=23  Identities=22%  Similarity=0.557  Sum_probs=14.5

Q ss_pred             CCCccCCcCccccCChHHHHHHH
Q psy5652          61 ERPFKCEFCAHSATSKSNLKMHI   83 (92)
Q Consensus        61 ~~~~~c~~c~~~~~~~~~l~~h~   83 (92)
                      .+++.|+.|+........|....
T Consensus       207 ~k~~PCPKCg~et~eTkdLSmSt  229 (314)
T PF06524_consen  207 GKPIPCPKCGYETQETKDLSMST  229 (314)
T ss_pred             CCCCCCCCCCCcccccccceeee
Confidence            36788888886655555554443


No 123
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=68.32  E-value=2.4  Score=24.02  Aligned_cols=35  Identities=26%  Similarity=0.466  Sum_probs=19.8

Q ss_pred             cccccccccccccccccccccCCCCCCCC-CCC---CceeCCCCCccCC
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMPRP-DSS---HLYVCFKCGYHQY   46 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~-~~~---~~~~c~~c~~~~~   46 (92)
                      .|+.|+..+.....+.          .++ .++   ..+.|..||+.+.
T Consensus        16 ~CPvCg~~l~~~~~~~----------~IPyFG~V~i~t~~C~~CgYR~~   54 (201)
T COG1779          16 DCPVCGGTLKAHMYLY----------DIPYFGEVLISTGVCERCGYRST   54 (201)
T ss_pred             cCCcccceeeEEEeee----------cCCccceEEEEEEEccccCCccc
Confidence            5899987554444333          222 232   2577888886544


No 124
>COG3677 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=67.89  E-value=2.4  Score=22.25  Aligned_cols=17  Identities=12%  Similarity=0.311  Sum_probs=12.7

Q ss_pred             Ccccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDADFI   17 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~   17 (92)
                      |+|+.|++.|.....-.
T Consensus        54 yrC~~C~~tf~~~~~~~   70 (129)
T COG3677          54 YKCKSCGSTFTVETGSP   70 (129)
T ss_pred             cccCCcCcceeeeccCc
Confidence            67899998887776533


No 125
>PTZ00255 60S ribosomal protein L37a; Provisional
Probab=67.54  E-value=3.2  Score=20.43  Aligned_cols=12  Identities=17%  Similarity=0.697  Sum_probs=7.7

Q ss_pred             CccCCcCccccC
Q psy5652          63 PFKCEFCAHSAT   74 (92)
Q Consensus        63 ~~~c~~c~~~~~   74 (92)
                      .|.|..|++.|.
T Consensus        54 IW~C~~C~~~~A   65 (90)
T PTZ00255         54 IWRCKGCKKTVA   65 (90)
T ss_pred             EEEcCCCCCEEe
Confidence            577777776553


No 126
>PF14353 CpXC:  CpXC protein
Probab=67.48  E-value=2.3  Score=22.05  Aligned_cols=18  Identities=11%  Similarity=0.479  Sum_probs=13.7

Q ss_pred             Cccccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDADFIL   18 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~   18 (92)
                      |.|+.||..|.....+..
T Consensus        39 ~~CP~Cg~~~~~~~p~lY   56 (128)
T PF14353_consen   39 FTCPSCGHKFRLEYPLLY   56 (128)
T ss_pred             EECCCCCCceecCCCEEE
Confidence            468888888887776664


No 127
>PF09963 DUF2197:  Uncharacterized protein conserved in bacteria (DUF2197);  InterPro: IPR019241  This family represents various hypothetical bacterial proteins with no known function. 
Probab=67.45  E-value=1.1  Score=19.95  Aligned_cols=36  Identities=28%  Similarity=0.532  Sum_probs=17.0

Q ss_pred             cccccccccccccccccccccCCCCCCCCCCCCceeCCCCCc
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGY   43 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~   43 (92)
                      +|-+|++.+...++-..      .-....-.-..|-|.+|..
T Consensus         4 kC~lCdk~~~Id~~~~~------aKrLrnrPi~tYmC~eC~~   39 (56)
T PF09963_consen    4 KCILCDKKEEIDEDTPE------AKRLRNRPIHTYMCDECKE   39 (56)
T ss_pred             EEEecCCEEEeccCCHH------HHHhhcCCCcceeChhHHH
Confidence            46677766554432111      0112222334677777754


No 128
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=67.30  E-value=3.1  Score=18.39  Aligned_cols=30  Identities=20%  Similarity=0.523  Sum_probs=18.5

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccC
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQ   45 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~   45 (92)
                      |+|+.|+..+.-..+..              + ....|+.||-.+
T Consensus         3 ~~CP~CG~~iev~~~~~--------------G-eiV~Cp~CGael   32 (54)
T TIGR01206         3 FECPDCGAEIELENPEL--------------G-ELVICDECGAEL   32 (54)
T ss_pred             cCCCCCCCEEecCCCcc--------------C-CEEeCCCCCCEE
Confidence            57999998764433311              1 245888888544


No 129
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=67.09  E-value=6.4  Score=25.43  Aligned_cols=25  Identities=16%  Similarity=0.401  Sum_probs=12.4

Q ss_pred             ccCCcCccccCChHHHHHHHHHhcc
Q psy5652          64 FKCEFCAHSATSKSNLKMHIMVKHQ   88 (92)
Q Consensus        64 ~~c~~c~~~~~~~~~l~~h~~~~h~   88 (92)
                      +.|+.|.+.|.....+..|+...|.
T Consensus        58 WiCp~CskkF~d~~~~~~H~~~eH~   82 (466)
T PF04780_consen   58 WICPRCSKKFSDAESCLSHMEQEHP   82 (466)
T ss_pred             eeCCcccceeCCHHHHHHHHHHhhh
Confidence            3444455555555555555544443


No 130
>PF13824 zf-Mss51:  Zinc-finger of mitochondrial splicing suppressor 51
Probab=66.84  E-value=6  Score=17.60  Aligned_cols=10  Identities=30%  Similarity=0.793  Sum_probs=5.8

Q ss_pred             CceeCCCCCc
Q psy5652          34 HLYVCFKCGY   43 (92)
Q Consensus        34 ~~~~c~~c~~   43 (92)
                      ..|.|+.||-
T Consensus        13 v~~~Cp~cGi   22 (55)
T PF13824_consen   13 VNFECPDCGI   22 (55)
T ss_pred             cCCcCCCCCC
Confidence            4566666664


No 131
>PF07800 DUF1644:  Protein of unknown function (DUF1644);  InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function. The region of interest contains nine highly conserved cysteine residues and is approximately 160 amino acids in length, which probably represent a zinc-binding domain. 
Probab=65.81  E-value=17  Score=19.99  Aligned_cols=56  Identities=16%  Similarity=0.235  Sum_probs=37.5

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCc--CccccCChHHHHHHHHHhccCCCC
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEF--CAHSATSKSNLKMHIMVKHQNDFV   92 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~--c~~~~~~~~~l~~h~~~~h~~~~p   92 (92)
                      ...|+.|........... -.|.+...|+-.|..  |.. ..+...|.+|.+..|...+|
T Consensus        80 ~L~CPLCRG~V~GWtvve-~AR~~LN~K~RsC~~e~C~F-~GtY~eLrKHar~~HP~~rP  137 (162)
T PF07800_consen   80 ELACPLCRGEVKGWTVVE-PARRFLNAKKRSCSQESCSF-SGTYSELRKHARSEHPSARP  137 (162)
T ss_pred             cccCccccCceeceEEch-HHHHHhccCCccCccccccc-ccCHHHHHHHHHhhCCCCCC
Confidence            567888865443332222 245566677878866  543 34778999999999988876


No 132
>KOG2907|consensus
Probab=65.33  E-value=6  Score=20.34  Aligned_cols=39  Identities=23%  Similarity=0.468  Sum_probs=24.7

Q ss_pred             CceeCCCCCccCCCHHHHHHHHHH-hhCCC-CccCCcCccccC
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIRT-HTGER-PFKCEFCAHSAT   74 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~~-~~~~~-~~~c~~c~~~~~   74 (92)
                      ....|+.||..-.....+|.  |+ ..|+- =|.|+.|+..|.
T Consensus        73 I~~kCpkCghe~m~Y~T~Ql--RSADEGQTVFYTC~kC~~k~~  113 (116)
T KOG2907|consen   73 IKHKCPKCGHEEMSYHTLQL--RSADEGQTVFYTCPKCKYKFT  113 (116)
T ss_pred             hhccCcccCCchhhhhhhhc--ccccCCceEEEEcCccceeee
Confidence            44678888876666655553  33 34443 378888886654


No 133
>COG4896 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=64.57  E-value=2  Score=19.52  Aligned_cols=37  Identities=22%  Similarity=0.486  Sum_probs=20.5

Q ss_pred             cccccccc-cccccccccccccCCCCCCCCCCCCceeCCCCCccC
Q psy5652           2 VCIFCRQL-LPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQ   45 (92)
Q Consensus         2 ~C~~C~~~-f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~   45 (92)
                      +|.+|++. +.+...+.       ..+.....-+.|-|++|....
T Consensus         4 kCiiCd~v~~iD~rt~~-------tKrLrN~PIrtymC~eC~~Rv   41 (68)
T COG4896           4 KCIICDRVDEIDNRTFK-------TKRLRNKPIRTYMCPECEHRV   41 (68)
T ss_pred             eEEEecceeeecchhHH-------HHHhhCCCceeEechhhHhhh
Confidence            57788765 33333333       123333444678898886543


No 134
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=64.31  E-value=3  Score=16.29  Aligned_cols=11  Identities=18%  Similarity=0.449  Sum_probs=6.9

Q ss_pred             Ccccccccccc
Q psy5652           1 MVCIFCRQLLP   11 (92)
Q Consensus         1 ~~C~~C~~~f~   11 (92)
                      |+|..|+..+.
T Consensus         1 Y~C~~Cg~~~~   11 (32)
T PF03604_consen    1 YICGECGAEVE   11 (32)
T ss_dssp             EBESSSSSSE-
T ss_pred             CCCCcCCCeeE
Confidence            46777776655


No 135
>KOG2785|consensus
Probab=64.18  E-value=16  Score=23.01  Aligned_cols=50  Identities=20%  Similarity=0.390  Sum_probs=38.0

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhCC-----------------------CCccCCcCc---cccCChHHHHHHHH
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTGE-----------------------RPFKCEFCA---HSATSKSNLKMHIM   84 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~~-----------------------~~~~c~~c~---~~~~~~~~l~~h~~   84 (92)
                      |-.|-.|+..+.....-..|+..+.|-                       +.+.|..|+   +.|........|+.
T Consensus       166 Pt~CLfC~~~~k~~e~~~~HM~~~HgffIPdreYL~D~~GLl~YLgeKV~~~~~CL~CN~~~~~f~sleavr~HM~  241 (390)
T KOG2785|consen  166 PTDCLFCDKKSKSLEENLKHMFKEHGFFIPDREYLTDEKGLLKYLGEKVGIGFICLFCNELGRPFSSLEAVRAHMR  241 (390)
T ss_pred             CcceeecCCCcccHHHHHHHHhhccCCcCCchHhhhchhHHHHHHHHHhccCceEEEeccccCcccccHHHHHHHh
Confidence            467889999988888888888765541                       236888888   78888888888864


No 136
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=63.45  E-value=2.5  Score=22.32  Aligned_cols=15  Identities=20%  Similarity=0.401  Sum_probs=11.1

Q ss_pred             CceeCCCCCccCCCH
Q psy5652          34 HLYVCFKCGYHQYNS   48 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~   48 (92)
                      ..+.|..||..|...
T Consensus        69 ~~~~C~~CG~~~~~~   83 (135)
T PRK03824         69 AVLKCRNCGNEWSLK   83 (135)
T ss_pred             eEEECCCCCCEEecc
Confidence            468899999776553


No 137
>TIGR00280 L37a ribosomal protein L37a. This model finds eukaryotic ribosomal protein L37a and its archaeal orthologs. The nomeclature is tricky because eukaryotes have proteins called both L37 and L37a.
Probab=62.40  E-value=3.3  Score=20.42  Aligned_cols=12  Identities=17%  Similarity=0.537  Sum_probs=7.5

Q ss_pred             CccCCcCccccC
Q psy5652          63 PFKCEFCAHSAT   74 (92)
Q Consensus        63 ~~~c~~c~~~~~   74 (92)
                      .|.|..|++.|.
T Consensus        53 IW~C~~C~~~~A   64 (91)
T TIGR00280        53 IWTCRKCGAKFA   64 (91)
T ss_pred             EEEcCCCCCEEe
Confidence            467777766553


No 138
>PF13451 zf-trcl:  Probable zinc-binding domain
Probab=62.38  E-value=2.7  Score=18.19  Aligned_cols=17  Identities=12%  Similarity=0.413  Sum_probs=11.3

Q ss_pred             CCccCCcCccccCChHH
Q psy5652          62 RPFKCEFCAHSATSKSN   78 (92)
Q Consensus        62 ~~~~c~~c~~~~~~~~~   78 (92)
                      +.+.|..||..|.....
T Consensus         3 k~l~C~dCg~~FvfTa~   19 (49)
T PF13451_consen    3 KTLTCKDCGAEFVFTAG   19 (49)
T ss_pred             eeEEcccCCCeEEEehh
Confidence            45778888877765543


No 139
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=61.74  E-value=4.3  Score=20.75  Aligned_cols=14  Identities=14%  Similarity=0.245  Sum_probs=8.6

Q ss_pred             ceeCCCCCccCCCH
Q psy5652          35 LYVCFKCGYHQYNS   48 (92)
Q Consensus        35 ~~~c~~c~~~~~~~   48 (92)
                      .+.|..|+..|...
T Consensus        70 ~~~C~~Cg~~~~~~   83 (113)
T PRK12380         70 QAWCWDCSQVVEIH   83 (113)
T ss_pred             EEEcccCCCEEecC
Confidence            46677777655543


No 140
>PF15135 UPF0515:  Uncharacterised protein UPF0515
Probab=61.73  E-value=2.9  Score=24.62  Aligned_cols=12  Identities=25%  Similarity=0.454  Sum_probs=7.0

Q ss_pred             ceeCCCCCccCC
Q psy5652          35 LYVCFKCGYHQY   46 (92)
Q Consensus        35 ~~~c~~c~~~~~   46 (92)
                      .|.|+.|+..|.
T Consensus       155 ef~C~~C~h~F~  166 (278)
T PF15135_consen  155 EFHCPKCRHNFR  166 (278)
T ss_pred             eeecccccccch
Confidence            466666665554


No 141
>COG3091 SprT Zn-dependent metalloprotease, SprT family [General function prediction only]
Probab=61.04  E-value=4.5  Score=21.96  Aligned_cols=34  Identities=29%  Similarity=0.656  Sum_probs=23.8

Q ss_pred             CceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccc
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHS   72 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~   72 (92)
                      -+|.|. |+..|...   ..|-..-.|+ .|.|..|+..
T Consensus       116 ~~Y~C~-C~q~~l~~---RRhn~~~~g~-~YrC~~C~gk  149 (156)
T COG3091         116 YPYRCQ-CQQHYLRI---RRHNTVRRGE-VYRCGKCGGK  149 (156)
T ss_pred             eeEEee-cCCccchh---hhcccccccc-eEEeccCCce
Confidence            479998 99886653   4444445566 8999999853


No 142
>TIGR00340 zpr1_rel ZPR1-related zinc finger protein. A model ZPR1_znf (TIGR00310) has been created to describe the domain shared by this protein and ZPR1.
Probab=59.38  E-value=4.8  Score=22.09  Aligned_cols=11  Identities=55%  Similarity=1.413  Sum_probs=8.1

Q ss_pred             CceeCCCCCcc
Q psy5652          34 HLYVCFKCGYH   44 (92)
Q Consensus        34 ~~~~c~~c~~~   44 (92)
                      ..+.|+.||..
T Consensus        27 ~sf~C~~CGyr   37 (163)
T TIGR00340        27 STYICEKCGYR   37 (163)
T ss_pred             EEEECCCCCCc
Confidence            36888888854


No 143
>PF14369 zf-RING_3:  zinc-finger
Probab=58.91  E-value=4.4  Score=16.09  Aligned_cols=10  Identities=20%  Similarity=0.355  Sum_probs=6.4

Q ss_pred             cccccccccc
Q psy5652           3 CIFCRQLLPM   12 (92)
Q Consensus         3 C~~C~~~f~~   12 (92)
                      |+.|+..|..
T Consensus        24 CP~C~~gFvE   33 (35)
T PF14369_consen   24 CPRCHGGFVE   33 (35)
T ss_pred             CcCCCCcEeE
Confidence            6777766643


No 144
>PF10013 DUF2256:  Uncharacterized protein conserved in bacteria (DUF2256);  InterPro: IPR017136 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function.
Probab=58.88  E-value=8.6  Score=16.08  Aligned_cols=12  Identities=25%  Similarity=0.600  Sum_probs=6.1

Q ss_pred             cCCcCccccCCh
Q psy5652          65 KCEFCAHSATSK   76 (92)
Q Consensus        65 ~c~~c~~~~~~~   76 (92)
                      .|+.|++.|.+.
T Consensus        10 ~C~~C~rpf~WR   21 (42)
T PF10013_consen   10 ICPVCGRPFTWR   21 (42)
T ss_pred             cCcccCCcchHH
Confidence            345555555544


No 145
>KOG4167|consensus
Probab=57.97  E-value=2  Score=29.11  Aligned_cols=26  Identities=23%  Similarity=0.621  Sum_probs=22.7

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhC
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTG   60 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~   60 (92)
                      -|.|.+|++.|.-...+..|+++|.-
T Consensus       792 iFpCreC~kvF~KiKSrNAHMK~Hr~  817 (907)
T KOG4167|consen  792 IFPCRECGKVFFKIKSRNAHMKTHRQ  817 (907)
T ss_pred             eeehHHHHHHHHHHhhhhHHHHHHHH
Confidence            59999999999988888999988764


No 146
>smart00154 ZnF_AN1 AN1-like Zinc finger. Zinc finger at the C-terminus of An1, a ubiquitin-like protein in Xenopus laevis.
Probab=57.95  E-value=4.3  Score=16.52  Aligned_cols=13  Identities=23%  Similarity=0.570  Sum_probs=7.1

Q ss_pred             Ccccccccccccc
Q psy5652           1 MVCIFCRQLLPMD   13 (92)
Q Consensus         1 ~~C~~C~~~f~~~   13 (92)
                      |+|..|++.|=.+
T Consensus        13 f~C~~C~~~FC~~   25 (39)
T smart00154       13 FKCRHCGNLFCGE   25 (39)
T ss_pred             eECCccCCccccc
Confidence            3466666665444


No 147
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=57.66  E-value=13  Score=15.07  Aligned_cols=14  Identities=29%  Similarity=0.807  Sum_probs=8.5

Q ss_pred             CCCCceeCCCCCcc
Q psy5652          31 DSSHLYVCFKCGYH   44 (92)
Q Consensus        31 ~~~~~~~c~~c~~~   44 (92)
                      .+.+.|.|+.|+..
T Consensus        20 ~~~~~w~C~~C~~~   33 (40)
T PF04810_consen   20 DGGKTWICNFCGTK   33 (40)
T ss_dssp             TTTTEEEETTT--E
T ss_pred             CCCCEEECcCCCCc
Confidence            35567888888753


No 148
>smart00709 Zpr1 Duplicated domain in the epidermal growth factor- and elongation factor-1alpha-binding protein Zpr1. Also present in archaeal proteins.
Probab=57.03  E-value=5.6  Score=21.76  Aligned_cols=11  Identities=36%  Similarity=1.105  Sum_probs=8.0

Q ss_pred             ceeCCCCCccC
Q psy5652          35 LYVCFKCGYHQ   45 (92)
Q Consensus        35 ~~~c~~c~~~~   45 (92)
                      .+.|+.||...
T Consensus        29 sf~C~~CGyk~   39 (160)
T smart00709       29 SFECEHCGYRN   39 (160)
T ss_pred             EEECCCCCCcc
Confidence            68888888543


No 149
>COG4957 Predicted transcriptional regulator [Transcription]
Probab=56.36  E-value=8.5  Score=20.54  Aligned_cols=26  Identities=35%  Similarity=0.613  Sum_probs=16.5

Q ss_pred             eeCCCCCccCCCHHHHHHHHHHhhCCCCc
Q psy5652          36 YVCFKCGYHQYNSDRMKRHIRTHTGERPF   64 (92)
Q Consensus        36 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~   64 (92)
                      -.|-++|+.|.+   |++|+++|.+--|-
T Consensus        77 IicLEDGkkfKS---LKRHL~t~~gmTPd  102 (148)
T COG4957          77 IICLEDGKKFKS---LKRHLTTHYGLTPD  102 (148)
T ss_pred             EEEeccCcchHH---HHHHHhcccCCCHH
Confidence            456677776644   67777777665444


No 150
>PF12156 ATPase-cat_bd:  Putative metal-binding domain of cation transport ATPase;  InterPro: IPR021993  This domain is found in bacteria, and is approximately 90 amino acids in length. It is found associated with PF00403 from PFAM, PF00122 from PFAM, PF00702 from PFAM. The cysteine-rich nature and composition suggest this might be a cation-binding domain; most members are annotated as being cation transport ATPases. 
Probab=56.09  E-value=5.7  Score=19.33  Aligned_cols=33  Identities=18%  Similarity=0.437  Sum_probs=23.4

Q ss_pred             cccccccccccccccccccccCCCCCCCCCCCCceeCCCCCc
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGY   43 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~   43 (92)
                      .|..|+..+.....+.         ..+....+.|-|.-|..
T Consensus         2 ~C~HCg~~~p~~~~~~---------~~~~g~~~~FCC~GC~~   34 (88)
T PF12156_consen    2 KCYHCGLPVPEGAKIT---------VEIDGEERPFCCPGCQA   34 (88)
T ss_pred             CCCCCCCCCCCCCCee---------eeeCCCccccccHHHHH
Confidence            6899998887665544         45555667888887753


No 151
>PF04780 DUF629:  Protein of unknown function (DUF629);  InterPro: IPR006865 This domain represents a region of several plant proteins of unknown function. A C2H2 zinc finger is predicted in this region in some family members, but the spacing between the cysteine residues is not conserved throughout the family.
Probab=55.65  E-value=13  Score=24.14  Aligned_cols=26  Identities=15%  Similarity=0.560  Sum_probs=22.6

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHH-hhC
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRT-HTG   60 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~-~~~   60 (92)
                      -|.|+.|.+.|.....+..|+.. |.+
T Consensus        57 FWiCp~CskkF~d~~~~~~H~~~eH~~   83 (466)
T PF04780_consen   57 FWICPRCSKKFSDAESCLSHMEQEHPA   83 (466)
T ss_pred             EeeCCcccceeCCHHHHHHHHHHhhhh
Confidence            58899999999999999999974 554


No 152
>PRK12496 hypothetical protein; Provisional
Probab=55.65  E-value=8.6  Score=21.10  Aligned_cols=10  Identities=30%  Similarity=0.521  Sum_probs=4.7

Q ss_pred             eeCCCCCccC
Q psy5652          36 YVCFKCGYHQ   45 (92)
Q Consensus        36 ~~c~~c~~~~   45 (92)
                      +.|.-|++.|
T Consensus       128 ~~C~gC~~~~  137 (164)
T PRK12496        128 KVCKGCKKKY  137 (164)
T ss_pred             EECCCCCccc
Confidence            4444444444


No 153
>PF14311 DUF4379:  Domain of unknown function (DUF4379)
Probab=55.60  E-value=14  Score=16.01  Aligned_cols=14  Identities=36%  Similarity=0.619  Sum_probs=10.2

Q ss_pred             ceeCCCCCccCCCH
Q psy5652          35 LYVCFKCGYHQYNS   48 (92)
Q Consensus        35 ~~~c~~c~~~~~~~   48 (92)
                      -+.|+.|+..+...
T Consensus        28 ~W~C~~Cgh~w~~~   41 (55)
T PF14311_consen   28 WWKCPKCGHEWKAS   41 (55)
T ss_pred             EEECCCCCCeeEcc
Confidence            58889888766554


No 154
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=55.41  E-value=17  Score=24.08  Aligned_cols=40  Identities=18%  Similarity=0.408  Sum_probs=21.4

Q ss_pred             cccccccccccc-cccccccccCCCCCCCCCCCCceeCCCCCccCCCH
Q psy5652           2 VCIFCRQLLPMD-ADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNS   48 (92)
Q Consensus         2 ~C~~C~~~f~~~-~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~   48 (92)
                      .|+.|+..+.-. +++.       .........-.|.|+.||......
T Consensus       202 pCPhCg~~~~l~~~~l~-------w~~~~~~~~a~y~C~~Cg~~i~e~  242 (557)
T PF05876_consen  202 PCPHCGEEQVLEWENLK-------WDKGEAPETARYVCPHCGCEIEEH  242 (557)
T ss_pred             cCCCCCCCcccccccee-------ecCCCCccceEEECCCCcCCCCHH
Confidence            577887776654 3333       111112233467788887665443


No 155
>KOG1280|consensus
Probab=55.28  E-value=21  Score=22.32  Aligned_cols=38  Identities=21%  Similarity=0.602  Sum_probs=26.7

Q ss_pred             CCceeCCCCCccCCCHHHHHHHHHHhhCCC--CccCCcCc
Q psy5652          33 SHLYVCFKCGYHQYNSDRMKRHIRTHTGER--PFKCEFCA   70 (92)
Q Consensus        33 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~--~~~c~~c~   70 (92)
                      ...|.|++|+..-.....++.|...-..+.  ...|+.|.
T Consensus        77 ~qSftCPyC~~~Gfte~~f~~Hv~s~Hpda~~~~icp~c~  116 (381)
T KOG1280|consen   77 PQSFTCPYCGIMGFTERQFGTHVLSQHPEASTSVICPLCA  116 (381)
T ss_pred             cccccCCcccccccchhHHHHHhhhcCcccCcceeeeccc
Confidence            346999999998888889999987633222  34556555


No 156
>COG4888 Uncharacterized Zn ribbon-containing protein [General function prediction only]
Probab=54.81  E-value=6.7  Score=19.76  Aligned_cols=11  Identities=27%  Similarity=0.942  Sum_probs=5.9

Q ss_pred             CceeCCCCCcc
Q psy5652          34 HLYVCFKCGYH   44 (92)
Q Consensus        34 ~~~~c~~c~~~   44 (92)
                      +.|+|+.|+..
T Consensus        21 k~FtCp~Cghe   31 (104)
T COG4888          21 KTFTCPRCGHE   31 (104)
T ss_pred             ceEecCccCCe
Confidence            34556666543


No 157
>COG4847 Uncharacterized protein conserved in archaea [Function unknown]
Probab=53.69  E-value=2.8  Score=20.82  Aligned_cols=17  Identities=18%  Similarity=0.421  Sum_probs=10.6

Q ss_pred             Ccccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDADFI   17 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~   17 (92)
                      |+|.+|+.....-..+.
T Consensus         7 wkC~VCg~~iieGqkFT   23 (103)
T COG4847           7 WKCYVCGGTIIEGQKFT   23 (103)
T ss_pred             eeEeeeCCEeeeccEEE
Confidence            56777777665555444


No 158
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only]
Probab=53.40  E-value=8  Score=24.10  Aligned_cols=17  Identities=29%  Similarity=0.663  Sum_probs=9.5

Q ss_pred             ccccccccccccccccc
Q psy5652           3 CIFCRQLLPMDADFILG   19 (92)
Q Consensus         3 C~~C~~~f~~~~~l~~h   19 (92)
                      |.+|...|.+.+.|..|
T Consensus       223 C~FC~~~FYdDDEL~~H  239 (493)
T COG5236         223 CIFCKIYFYDDDELRRH  239 (493)
T ss_pred             hhhccceecChHHHHHH
Confidence            55555555555555543


No 159
>PF13821 DUF4187:  Domain of unknown function (DUF4187)
Probab=53.34  E-value=3.8  Score=18.16  Aligned_cols=16  Identities=19%  Similarity=0.528  Sum_probs=13.1

Q ss_pred             cccccccccccccccc
Q psy5652           3 CIFCRQLLPMDADFIL   18 (92)
Q Consensus         3 C~~C~~~f~~~~~l~~   18 (92)
                      |..|+..|.+..+|..
T Consensus        30 C~~Cg~~Y~d~~dL~~   45 (55)
T PF13821_consen   30 CFWCGTKYDDEEDLER   45 (55)
T ss_pred             eeeeCCccCCHHHHHh
Confidence            7888888888888764


No 160
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=53.11  E-value=6.5  Score=20.17  Aligned_cols=26  Identities=15%  Similarity=0.319  Sum_probs=17.3

Q ss_pred             CceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcc
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAH   71 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   71 (92)
                      -...|..|+..|....            ..+.|+.|+.
T Consensus        69 ~~~~C~~Cg~~~~~~~------------~~~~CP~Cgs   94 (115)
T TIGR00100        69 VECECEDCSEEVSPEI------------DLYRCPKCHG   94 (115)
T ss_pred             cEEEcccCCCEEecCC------------cCccCcCCcC
Confidence            3578889987665432            1467888874


No 161
>PF07975 C1_4:  TFIIH C1-like domain;  InterPro: IPR004595 All proteins in this domain for which functions are known are components of the TFIIH complex which is involved in the initiation of transcription and nucleotide excision repair. It includes the yeast transcription factor Ssl1 (Suppressor of stem-loop protein 1) that is essential for translation initiation and affects UV resistance. The C-terminal region is essential for transcription activity. This regions binds three zinc atoms through two independent domain. The first contains a C4 zinc finger motif, whereas the second is characterised by a CX(2)CX(2-4)FCADCD motif. The solution structure of the second C-terminal domain revealed homology with the regulatory domain of protein kinase C [].; GO: 0006281 DNA repair, 0005634 nucleus; PDB: 1Z60_A.
Probab=52.25  E-value=8  Score=16.90  Aligned_cols=20  Identities=30%  Similarity=0.350  Sum_probs=8.8

Q ss_pred             CCceeCCCCCccCCCHHHHH
Q psy5652          33 SHLYVCFKCGYHQYNSDRMK   52 (92)
Q Consensus        33 ~~~~~c~~c~~~~~~~~~l~   52 (92)
                      ...|.|+.|...|-..=.+-
T Consensus        19 ~~~y~C~~C~~~FC~dCD~f   38 (51)
T PF07975_consen   19 SSRYRCPKCKNHFCIDCDVF   38 (51)
T ss_dssp             -EEE--TTTT--B-HHHHHT
T ss_pred             CCeEECCCCCCccccCcChh
Confidence            45788888887775544333


No 162
>COG1571 Predicted DNA-binding protein containing a Zn-ribbon domain [General function prediction only]
Probab=51.31  E-value=13  Score=23.75  Aligned_cols=12  Identities=33%  Similarity=0.692  Sum_probs=5.8

Q ss_pred             ceeCCCCCccCC
Q psy5652          35 LYVCFKCGYHQY   46 (92)
Q Consensus        35 ~~~c~~c~~~~~   46 (92)
                      -|.|+.||..+.
T Consensus       367 g~rC~kCg~~~~  378 (421)
T COG1571         367 GFRCKKCGTRAR  378 (421)
T ss_pred             CcccccccccCC
Confidence            455555554443


No 163
>COG5151 SSL1 RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Transcription / DNA replication, recombination, and repair]
Probab=51.00  E-value=28  Score=21.57  Aligned_cols=22  Identities=23%  Similarity=0.617  Sum_probs=13.7

Q ss_pred             CCccCCcCccccCChHHHHHHH
Q psy5652          62 RPFKCEFCAHSATSKSNLKMHI   83 (92)
Q Consensus        62 ~~~~c~~c~~~~~~~~~l~~h~   83 (92)
                      ..|.|..|...|-..-+...|.
T Consensus       387 ~rY~Ce~CK~~FC~dCdvfiHe  408 (421)
T COG5151         387 GRYQCELCKSTFCSDCDVFIHE  408 (421)
T ss_pred             cceechhhhhhhhhhhHHHHHH
Confidence            4577777766666555555554


No 164
>KOG2482|consensus
Probab=50.58  E-value=14  Score=23.11  Aligned_cols=21  Identities=29%  Similarity=0.689  Sum_probs=18.6

Q ss_pred             ccCCcCccccCChHHHHHHHH
Q psy5652          64 FKCEFCAHSATSKSNLKMHIM   84 (92)
Q Consensus        64 ~~c~~c~~~~~~~~~l~~h~~   84 (92)
                      +.|..|.++|+.+..|..|++
T Consensus       196 ~~CLyCekifrdkntLkeHMr  216 (423)
T KOG2482|consen  196 LRCLYCEKIFRDKNTLKEHMR  216 (423)
T ss_pred             heeeeeccccCCcHHHHHHHH
Confidence            688899999999999999985


No 165
>PF02176 zf-TRAF:  TRAF-type zinc finger; PDB: 2EOD_A 2YUC_A 3HCU_A 3HCS_B 3HCT_A.
Probab=50.38  E-value=5.4  Score=17.45  Aligned_cols=38  Identities=18%  Similarity=0.517  Sum_probs=19.2

Q ss_pred             ceeCCC--CCccCCCHHHHHHHHHHhhCCCCccCCc----Ccccc
Q psy5652          35 LYVCFK--CGYHQYNSDRMKRHIRTHTGERPFKCEF----CAHSA   73 (92)
Q Consensus        35 ~~~c~~--c~~~~~~~~~l~~h~~~~~~~~~~~c~~----c~~~~   73 (92)
                      +..|+.  |...+.. ..|..|+...-..++..|..    |...+
T Consensus         9 ~v~C~~~cc~~~i~r-~~l~~H~~~~C~~~~v~C~~~~~GC~~~~   52 (60)
T PF02176_consen    9 PVPCPNGCCNEMIPR-KELDDHLENECPKRPVPCPYSPYGCKERV   52 (60)
T ss_dssp             EEE-TT--S-BEEEC-CCHHHHHHTTSTTSEEE-SS----S--EE
T ss_pred             EeeCCCCCcccceeH-HHHHHHHHccCCCCcEECCCCCCCCCCcc
Confidence            456766  4443433 35777777544556677777    76554


No 166
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional
Probab=50.15  E-value=14  Score=23.97  Aligned_cols=40  Identities=18%  Similarity=0.277  Sum_probs=22.5

Q ss_pred             CCCCceeCCCCCccCCCHHHHHHHHHHhhC------CCCccCCcCcc
Q psy5652          31 DSSHLYVCFKCGYHQYNSDRMKRHIRTHTG------ERPFKCEFCAH   71 (92)
Q Consensus        31 ~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~------~~~~~c~~c~~   71 (92)
                      .....|.|..||..|.-...-.. .....|      ...|.|+.|+.
T Consensus       421 ~~~~~~~c~~c~~~yd~~~g~~~-~~~~~gt~~~~lp~~~~cp~c~~  466 (479)
T PRK05452        421 DLGPRMQCSVCQWIYDPAKGEPM-QDVAPGTPWSEVPDNFLCPECSL  466 (479)
T ss_pred             CCCCeEEECCCCeEECCCCCCcc-cCCCCCCChhhCCCCCcCcCCCC
Confidence            34567999999987764321110 111111      23589999874


No 167
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=49.92  E-value=10  Score=14.24  Aligned_cols=8  Identities=38%  Similarity=1.132  Sum_probs=3.6

Q ss_pred             ceeCCCCC
Q psy5652          35 LYVCFKCG   42 (92)
Q Consensus        35 ~~~c~~c~   42 (92)
                      .|.|..|.
T Consensus        15 ~Y~C~~c~   22 (30)
T PF03107_consen   15 FYHCSECC   22 (30)
T ss_pred             eEEeCCCC
Confidence            44444443


No 168
>PF01428 zf-AN1:  AN1-like Zinc finger;  InterPro: IPR000058 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the AN1-type zinc finger domain, which has a dimetal (zinc)-bound alpha/beta fold. This domain was first identified as a zinc finger at the C terminus of AN1 Q91889 from SWISSPROT, a ubiquitin-like protein in Xenopus laevis []. The AN1-type zinc finger contains six conserved cysteines and two histidines that could potentially coordinate 2 zinc atoms. Certain stress-associated proteins (SAP) contain AN1 domain, often in combination with A20 zinc finger domains (SAP8) or C2H2 domains (SAP16) []. For example, the human protein Znf216 has an A20 zinc-finger at the N terminus and an AN1 zinc-finger at the C terminus, acting to negatively regulate the NFkappaB activation pathway and to interact with components of the immune response like RIP, IKKgamma and TRAF6. The interact of Znf216 with IKK-gamma and RIP is mediated by the A20 zinc-finger domain, while its interaction with TRAF6 is mediated by the AN1 zinc-finger domain; therefore, both zinc-finger domains are involved in regulating the immune response []. The AN1 zinc finger domain is also found in proteins containing a ubiquitin-like domain, which are involved in the ubiquitination pathway []. Proteins containing an AN1-type zinc finger include:   Ascidian posterior end mark 6 (pem-6) protein []. Human AWP1 protein (associated with PRK1), which is expressed during early embryogenesis []. Human immunoglobulin mu binding protein 2 (SMUBP-2), mutations in which cause muscular atrophy with respiratory distress type 1 [].   More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1WFP_A 1WYS_A 1WG2_A 1WFH_A 1X4W_A 1WFE_A 1WFL_A 1X4V_A.
Probab=49.85  E-value=4.6  Score=16.70  Aligned_cols=12  Identities=17%  Similarity=0.548  Sum_probs=5.1

Q ss_pred             cccccccccccc
Q psy5652           2 VCIFCRQLLPMD   13 (92)
Q Consensus         2 ~C~~C~~~f~~~   13 (92)
                      +|..|++.|=.+
T Consensus        15 ~C~~C~~~FC~~   26 (43)
T PF01428_consen   15 KCKHCGKSFCLK   26 (43)
T ss_dssp             E-TTTS-EE-TT
T ss_pred             ECCCCCcccCcc
Confidence            466666665444


No 169
>TIGR00310 ZPR1_znf ZPR1 zinc finger domain.
Probab=48.53  E-value=21  Score=20.29  Aligned_cols=36  Identities=19%  Similarity=0.404  Sum_probs=21.2

Q ss_pred             CcccccccccccccccccccccCCCCCCCCC-CC---CceeCCCCCccC
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPD-SS---HLYVCFKCGYHQ   45 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~-~~---~~~~c~~c~~~~   45 (92)
                      +.|+.|++.......+..       +  ++. ++   ..+.|+.||...
T Consensus         1 ~~Cp~C~~~~~~~~~~~~-------~--IP~F~evii~sf~C~~CGyr~   40 (192)
T TIGR00310         1 IDCPSCGGECETVMKTVN-------D--IPYFGEVLETSTICEHCGYRS   40 (192)
T ss_pred             CcCCCCCCCCEEEEEEEc-------C--CCCcceEEEEEEECCCCCCcc
Confidence            469999876555444441       1  332 22   368899998643


No 170
>KOG2231|consensus
Probab=47.79  E-value=23  Score=24.16  Aligned_cols=16  Identities=25%  Similarity=0.644  Sum_probs=9.4

Q ss_pred             cccccccccccccccc
Q psy5652           3 CIFCRQLLPMDADFIL   18 (92)
Q Consensus         3 C~~C~~~f~~~~~l~~   18 (92)
                      |.+|...|.+...|..
T Consensus       185 C~~C~~~fld~~el~r  200 (669)
T KOG2231|consen  185 CKFCHERFLDDDELYR  200 (669)
T ss_pred             chhhhhhhccHHHHHH
Confidence            5556666666666554


No 171
>PF06397 Desulfoferrod_N:  Desulfoferrodoxin, N-terminal domain;  InterPro: IPR004462 This domain is found as essentially the full length of desulforedoxin, a 37-residue homodimeric non-haem iron protein. It is also found as the N-terminal domain of desulfoferrodoxin (rbo), a homodimeric non-haem iron protein with 2 Fe atoms per monomer in different oxidation states. This domain binds the ferric rather than the ferrous Fe of desulfoferrodoxin. Neelaredoxin, a monomeric blue non-haem iron protein, lacks this domain.; GO: 0005506 iron ion binding; PDB: 1DFX_A 1VZI_B 2JI2_D 1VZH_B 2JI3_C 2JI1_C 1VZG_A 1CFW_A 2LK5_B 1DHG_B ....
Probab=47.50  E-value=5.1  Score=16.14  Aligned_cols=9  Identities=22%  Similarity=0.770  Sum_probs=3.3

Q ss_pred             Ccccccccc
Q psy5652           1 MVCIFCRQL    9 (92)
Q Consensus         1 ~~C~~C~~~    9 (92)
                      |+|..|+..
T Consensus         7 YkC~~CGni   15 (36)
T PF06397_consen    7 YKCEHCGNI   15 (36)
T ss_dssp             EE-TTT--E
T ss_pred             EEccCCCCE
Confidence            456666644


No 172
>PF09943 DUF2175:  Uncharacterized protein conserved in archaea (DUF2175);  InterPro: IPR018686  This family of various hypothetical archaeal proteins has no known function. 
Probab=46.32  E-value=4  Score=20.57  Aligned_cols=17  Identities=18%  Similarity=0.370  Sum_probs=11.9

Q ss_pred             Ccccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDADFI   17 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~   17 (92)
                      |+|.+|++.+.....+.
T Consensus         3 WkC~iCg~~I~~gqlFT   19 (101)
T PF09943_consen    3 WKCYICGKPIYEGQLFT   19 (101)
T ss_pred             eEEEecCCeeeecceEE
Confidence            57888887776666554


No 173
>KOG0402|consensus
Probab=46.08  E-value=6.7  Score=19.03  Aligned_cols=9  Identities=33%  Similarity=0.977  Sum_probs=5.3

Q ss_pred             Ccccccccc
Q psy5652           1 MVCIFCRQL    9 (92)
Q Consensus         1 ~~C~~C~~~    9 (92)
                      |.|++|++.
T Consensus        37 y~CsfCGK~   45 (92)
T KOG0402|consen   37 YTCSFCGKK   45 (92)
T ss_pred             hhhhhcchh
Confidence            456667644


No 174
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=45.96  E-value=14  Score=13.04  Aligned_cols=7  Identities=29%  Similarity=0.634  Sum_probs=3.3

Q ss_pred             ccccccc
Q psy5652           3 CIFCRQL    9 (92)
Q Consensus         3 C~~C~~~    9 (92)
                      |+.|+..
T Consensus         2 Cp~CG~~    8 (23)
T PF13240_consen    2 CPNCGAE    8 (23)
T ss_pred             CcccCCC
Confidence            4445543


No 175
>PF13696 zf-CCHC_2:  Zinc knuckle
Probab=45.85  E-value=8.7  Score=15.05  Aligned_cols=6  Identities=50%  Similarity=1.110  Sum_probs=2.9

Q ss_pred             cccccc
Q psy5652           2 VCIFCR    7 (92)
Q Consensus         2 ~C~~C~    7 (92)
                      +|..|+
T Consensus        10 ~C~~C~   15 (32)
T PF13696_consen   10 VCHRCG   15 (32)
T ss_pred             EeecCC
Confidence            455554


No 176
>KOG0801|consensus
Probab=45.63  E-value=12  Score=20.73  Aligned_cols=13  Identities=38%  Similarity=1.017  Sum_probs=10.0

Q ss_pred             Ccccccccccccc
Q psy5652           1 MVCIFCRQLLPMD   13 (92)
Q Consensus         1 ~~C~~C~~~f~~~   13 (92)
                      ++|++|.|.....
T Consensus       139 ~KCPvC~K~V~sD  151 (205)
T KOG0801|consen  139 MKCPVCHKVVPSD  151 (205)
T ss_pred             ccCCccccccCCC
Confidence            6899999876544


No 177
>PF08792 A2L_zn_ribbon:  A2L zinc ribbon domain;  InterPro: IPR014900 This zinc ribbon protein is found associated with some viral A2L transcription factors []. 
Probab=45.24  E-value=8.1  Score=15.14  Aligned_cols=8  Identities=50%  Similarity=1.377  Sum_probs=3.8

Q ss_pred             cccccccc
Q psy5652           3 CIFCRQLL   10 (92)
Q Consensus         3 C~~C~~~f   10 (92)
                      |.+|+..|
T Consensus        24 C~~Cg~~~   31 (33)
T PF08792_consen   24 CIFCGSSF   31 (33)
T ss_pred             cccCCcEe
Confidence            45555443


No 178
>PF00412 LIM:  LIM domain;  InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents LIM-type zinc finger (Znf) domains. LIM domains coordinate one or more zinc atoms, and are named after the three proteins (LIN-11, Isl1 and MEC-3) in which they were first found. They consist of two zinc-binding motifs that resemble GATA-like Znf's, however the residues holding the zinc atom(s) are variable, involving Cys, His, Asp or Glu residues. LIM domains are involved in proteins with differing functions, including gene expression, and cytoskeleton organisation and development [, ]. Protein containing LIM Znf domains include:    Caenorhabditis elegans mec-3; a protein required for the differentiation of the set of six touch receptor neurons in this nematode. C. elegans. lin-11; a protein required for the asymmetric division of vulval blast cells. Vertebrate insulin gene enhancer binding protein isl-1. Isl-1 binds to one of the two cis-acting protein-binding domains of the insulin gene. Vertebrate homeobox proteins lim-1, lim-2 (lim-5) and lim3. Vertebrate lmx-1, which acts as a transcriptional activator by binding to the FLAT element; a beta-cell-specific transcriptional enhancer found in the insulin gene. Mammalian LH-2, a transcriptional regulatory protein involved in the control of cell differentiation in developing lymphoid and neural cell types.  Drosophila melanogaster (Fruit fly) protein apterous, required for the normal development of the wing and halter imaginal discs. Vertebrate protein kinases LIMK-1 and LIMK-2. Mammalian rhombotins. Rhombotin 1 (RBTN1 or TTG-1) and rhombotin-2 (RBTN2 or TTG-2) are proteins of about 160 amino acids whose genes are disrupted by chromosomal translocations in T-cell leukemia. Mammalian and avian cysteine-rich protein (CRP), a 192 amino-acid protein of unknown function. Seems to interact with zyxin. Mammalian cysteine-rich intestinal protein (CRIP), a small protein which seems to have a role in zinc absorption and may function as an intracellular zinc transport protein. Vertebrate paxillin, a cytoskeletal focal adhesion protein.  Mus musculus (Mouse) testin which should not be confused with rat testin which is a thiol protease homologue (see IPR000169 from INTERPRO).  Helianthus annuus (Common sunflower) pollen specific protein SF3. Chicken zyxin. Zyxin is a low-abundance adhesion plaque protein which has been shown to interact with CRP. Yeast protein LRG1 which is involved in sporulation [].  Saccharomyces cerevisiae (Baker's yeast) rho-type GTPase activating protein RGA1/DBM1. C. elegans homeobox protein ceh-14. C. elegans homeobox protein unc-97. S. cerevisiae hypothetical protein YKR090w. C. elegans hypothetical proteins C28H8.6.   These proteins generally contain two tandem copies of the LIM domain in their N-terminal section. Zyxin and paxillin are exceptions in that they contain respectively three and four LIM domains at their C-terminal extremity. In apterous, isl-1, LH-2, lin-11, lim-1 to lim-3, lmx-1 and ceh-14 and mec-3 there is a homeobox domain some 50 to 95 amino acids after the LIM domains. LIM domains contain seven conserved cysteine residues and a histidine. The arrangement followed by these conserved residues is:  C-x(2)-C-x(16,23)-H-x(2)-[CH]-x(2)-C-x(2)-C-x(16,21)-C-x(2,3)-[CHD]  LIM domains bind two zinc ions []. LIM does not bind DNA, rather it seems to act as an interface for protein-protein interaction. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CO8_A 2EGQ_A 2CUR_A 3IXE_B 1CTL_A 1B8T_A 1X62_A 2DFY_C 1IML_A 2CUQ_A ....
Probab=44.99  E-value=14  Score=15.78  Aligned_cols=14  Identities=21%  Similarity=0.380  Sum_probs=10.1

Q ss_pred             Cccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDA   14 (92)
Q Consensus         1 ~~C~~C~~~f~~~~   14 (92)
                      |+|..|++.+....
T Consensus        27 f~C~~C~~~l~~~~   40 (58)
T PF00412_consen   27 FKCSKCGKPLNDGD   40 (58)
T ss_dssp             SBETTTTCBTTTSS
T ss_pred             cccCCCCCccCCCe
Confidence            56888887776665


No 179
>PF07503 zf-HYPF:  HypF finger;  InterPro: IPR011125 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  Proteins of the HypF family are involved in the maturation and regulation of hydrogenase []. In the N terminus they appear to have two zinc finger domains that are similar to those found in the DnaJ chaperone []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3TTD_A 3TSQ_A 3TTC_A 3TSP_A 3TTF_A 3TSU_A.
Probab=44.46  E-value=12  Score=14.87  Aligned_cols=10  Identities=30%  Similarity=0.743  Sum_probs=4.1

Q ss_pred             eeCCCCCccC
Q psy5652          36 YVCFKCGYHQ   45 (92)
Q Consensus        36 ~~c~~c~~~~   45 (92)
                      -.|..||..+
T Consensus        22 isC~~CGPr~   31 (35)
T PF07503_consen   22 ISCTNCGPRY   31 (35)
T ss_dssp             --BTTCC-SC
T ss_pred             ccCCCCCCCE
Confidence            3566666543


No 180
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=43.17  E-value=12  Score=19.28  Aligned_cols=14  Identities=14%  Similarity=0.100  Sum_probs=9.7

Q ss_pred             CceeCCCCCccCCC
Q psy5652          34 HLYVCFKCGYHQYN   47 (92)
Q Consensus        34 ~~~~c~~c~~~~~~   47 (92)
                      -.+.|..|+..|..
T Consensus        70 ~~~~C~~Cg~~~~~   83 (117)
T PRK00564         70 VELECKDCSHVFKP   83 (117)
T ss_pred             CEEEhhhCCCcccc
Confidence            35788889866544


No 181
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit. The enzyme acetyl-CoA carboxylase contains a biotin carboxyl carrier protein or domain, a biotin carboxylase, and a carboxyl transferase. This model represents the beta chain of the carboxyl transferase for cases in which the architecture of the protein is as in E. coli, in which the carboxyltransferase portion consists of two non-identical subnits, alpha and beta.
Probab=42.88  E-value=8.8  Score=23.13  Aligned_cols=11  Identities=36%  Similarity=0.588  Sum_probs=5.2

Q ss_pred             ceeCCCCCccC
Q psy5652          35 LYVCFKCGYHQ   45 (92)
Q Consensus        35 ~~~c~~c~~~~   45 (92)
                      ...|+.|+...
T Consensus        26 ~~~c~~c~~~~   36 (285)
T TIGR00515        26 WTKCPKCGQVL   36 (285)
T ss_pred             eeECCCCcchh
Confidence            34455555443


No 182
>COG1675 TFA1 Transcription initiation factor IIE, alpha subunit [Transcription]
Probab=42.54  E-value=31  Score=19.33  Aligned_cols=33  Identities=24%  Similarity=0.564  Sum_probs=20.7

Q ss_pred             CCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcccc
Q psy5652          32 SSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSA   73 (92)
Q Consensus        32 ~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   73 (92)
                      +..-|.|+.|...+......      ..   .|.|+.||...
T Consensus       110 ~~~~y~C~~~~~r~sfdeA~------~~---~F~Cp~Cg~~L  142 (176)
T COG1675         110 ENNYYVCPNCHVKYSFDEAM------EL---GFTCPKCGEDL  142 (176)
T ss_pred             cCCceeCCCCCCcccHHHHH------Hh---CCCCCCCCchh
Confidence            34468888887666544322      22   28999998654


No 183
>COG1594 RPB9 DNA-directed RNA polymerase, subunit M/Transcription elongation factor TFIIS [Transcription]
Probab=42.52  E-value=22  Score=18.29  Aligned_cols=38  Identities=26%  Similarity=0.436  Sum_probs=20.0

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHH-hhCC-CCccCCcCccccC
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRT-HTGE-RPFKCEFCAHSAT   74 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~-~~~~-~~~~c~~c~~~~~   74 (92)
                      ...|+.||..=.....+|  .|+ ..+. .=|.|..||..|+
T Consensus        72 ~~~CpkCg~~ea~y~~~Q--tRsaDEp~T~Fy~C~~Cg~~wr  111 (113)
T COG1594          72 KEKCPKCGNKEAYYWQLQ--TRSADEPETRFYKCTRCGYRWR  111 (113)
T ss_pred             cccCCCCCCceeEEEeee--hhccCCCceEEEEecccCCEee
Confidence            357888885433322222  332 2222 2378888887654


No 184
>PF11494 Ta0938:  Ta0938;  InterPro: IPR021585  Ta0938 is a protein of unknown function however the structure has been determined. The protein has a novel fold and a putative Zn-binding motif. The structure has two different parts, one region contains a beta sheet flanked by two alpha helices and the other contains a bundle of loops which contain all cysteines in the protein. ; PDB: 2FQH_A.
Probab=42.38  E-value=15  Score=18.38  Aligned_cols=35  Identities=14%  Similarity=0.228  Sum_probs=13.2

Q ss_pred             cccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCCCH
Q psy5652           2 VCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQYNS   48 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~~~   48 (92)
                      .|..|+..+.+..            ..+.....-|.|..|...|.+.
T Consensus        16 ~CalCG~tWg~~y------------~Ev~G~rLfFCCd~ca~EF~nm   50 (105)
T PF11494_consen   16 GCALCGATWGDYY------------EEVDGERLFFCCDDCAKEFKNM   50 (105)
T ss_dssp             S-SS---S---SS-------------B-TT--BSSS--SSSS-TTS-
T ss_pred             cccccCCcHHHHH------------HhhcCCEEEEEcHHHHHHHHHH
Confidence            3777777766332            3444454567788998888875


No 185
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=42.36  E-value=10  Score=15.59  Aligned_cols=9  Identities=33%  Similarity=0.630  Sum_probs=5.8

Q ss_pred             Ccccccccc
Q psy5652           1 MVCIFCRQL    9 (92)
Q Consensus         1 ~~C~~C~~~    9 (92)
                      |+|+.|+..
T Consensus         1 m~Cp~Cg~~    9 (43)
T PF08271_consen    1 MKCPNCGSK    9 (43)
T ss_dssp             ESBTTTSSS
T ss_pred             CCCcCCcCC
Confidence            467777754


No 186
>PLN02294 cytochrome c oxidase subunit Vb
Probab=42.23  E-value=17  Score=20.30  Aligned_cols=15  Identities=13%  Similarity=0.142  Sum_probs=11.2

Q ss_pred             CCceeCCCCCccCCC
Q psy5652          33 SHLYVCFKCGYHQYN   47 (92)
Q Consensus        33 ~~~~~c~~c~~~~~~   47 (92)
                      +++..|++||.-|.-
T Consensus       139 Gkp~RCpeCG~~fkL  153 (174)
T PLN02294        139 GKSFECPVCTQYFEL  153 (174)
T ss_pred             CCceeCCCCCCEEEE
Confidence            468889999987643


No 187
>PF05741 zf-nanos:  Nanos RNA binding domain;  InterPro: IPR024161 Nanos is a highly conserved RNA-binding protein in higher eukaryotes and functions as a key regulatory protein in translational control using a 3' untranslated region during the development and maintenance of germ cells. Nanos comprises a non-conserved amino-terminus and highly conserved carboxy- terminal regions. The C-terminal region has two conserved Cys-Cys-His-Cys (CCHC)-type zinc-finger motifs that are indispensable for nanos function [, , ]. The structure of the nanos-type zinc finger is composed of two independent zinc-finger (ZF) lobes, the N-terminal ZF1 and the C-terminal ZF2, which are connected by a linker helix []. These lobes create a large cleft. Zinc ions in ZF1 and ZF2 are bound to the CCHC motif by tetrahedral coordination.; PDB: 3ALR_B.
Probab=42.03  E-value=5  Score=17.84  Aligned_cols=10  Identities=50%  Similarity=1.039  Sum_probs=2.9

Q ss_pred             CceeCCCCCc
Q psy5652          34 HLYVCFKCGY   43 (92)
Q Consensus        34 ~~~~c~~c~~   43 (92)
                      +.|.|+.||-
T Consensus        32 r~y~Cp~CgA   41 (55)
T PF05741_consen   32 RKYVCPICGA   41 (55)
T ss_dssp             GG---TTT--
T ss_pred             hcCcCCCCcC
Confidence            3466666664


No 188
>PF14803 Nudix_N_2:  Nudix N-terminal; PDB: 3CNG_C.
Probab=41.69  E-value=17  Score=14.38  Aligned_cols=13  Identities=31%  Similarity=0.774  Sum_probs=7.9

Q ss_pred             CCCceeCCCCCcc
Q psy5652          32 SSHLYVCFKCGYH   44 (92)
Q Consensus        32 ~~~~~~c~~c~~~   44 (92)
                      +...+.|+.|+..
T Consensus        19 ~r~R~vC~~Cg~I   31 (34)
T PF14803_consen   19 DRERLVCPACGFI   31 (34)
T ss_dssp             SS-EEEETTTTEE
T ss_pred             CccceECCCCCCE
Confidence            4456788888753


No 189
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=41.19  E-value=17  Score=14.86  Aligned_cols=16  Identities=25%  Similarity=0.486  Sum_probs=7.6

Q ss_pred             cccccccccccccccc
Q psy5652           2 VCIFCRQLLPMDADFI   17 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~   17 (92)
                      .|++|++.-..-..|.
T Consensus         3 ~CSFCgr~~~~v~~li   18 (41)
T PF06689_consen    3 RCSFCGRPESEVGRLI   18 (41)
T ss_dssp             B-TTT--BTTTSSSEE
T ss_pred             CccCCCCCHHHHhcee
Confidence            5888887755444443


No 190
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=41.15  E-value=38  Score=15.26  Aligned_cols=14  Identities=29%  Similarity=0.679  Sum_probs=8.8

Q ss_pred             CCCccCCcCccccC
Q psy5652          61 ERPFKCEFCAHSAT   74 (92)
Q Consensus        61 ~~~~~c~~c~~~~~   74 (92)
                      .+.|.|+.||..+.
T Consensus        44 ~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   44 GRVFTCPNCGFEMD   57 (69)
T ss_pred             cceEEcCCCCCEEC
Confidence            45677777775543


No 191
>COG4338 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=40.77  E-value=12  Score=16.13  Aligned_cols=13  Identities=15%  Similarity=0.513  Sum_probs=7.1

Q ss_pred             cCCcCccccCChH
Q psy5652          65 KCEFCAHSATSKS   77 (92)
Q Consensus        65 ~c~~c~~~~~~~~   77 (92)
                      .|+.|++.|.+..
T Consensus        14 ICpvCqRPFsWRk   26 (54)
T COG4338          14 ICPVCQRPFSWRK   26 (54)
T ss_pred             hhhhhcCchHHHH
Confidence            4555666555543


No 192
>TIGR00319 desulf_FeS4 desulfoferrodoxin FeS4 iron-binding domain. Neelaredoxin, a monomeric blue non-heme iron protein, lacks this domain.
Probab=40.68  E-value=9.1  Score=14.82  Aligned_cols=10  Identities=20%  Similarity=0.760  Sum_probs=5.5

Q ss_pred             Cccccccccc
Q psy5652           1 MVCIFCRQLL   10 (92)
Q Consensus         1 ~~C~~C~~~f   10 (92)
                      |+|..|+..+
T Consensus         8 ykC~~Cgniv   17 (34)
T TIGR00319         8 YKCEVCGNIV   17 (34)
T ss_pred             EEcCCCCcEE
Confidence            4566666544


No 193
>cd00974 DSRD Desulforedoxin (DSRD) domain; a small non-heme iron domain present in the desulforedoxin (rubredoxin oxidoreductase) and desulfoferrodoxin proteins of some archeael and bacterial methanogens and sulfate/sulfur reducers. Desulforedoxin is a small, single-domain homodimeric protein; each subunit contains an iron atom bound to four cysteinyl sulfur atoms, Fe(S-Cys)4, in a distorted tetrahedral coordination. Its metal center is similar to that found in rubredoxin type proteins. Desulforedoxin is regarded as a potential redox partner for rubredoxin. Desulfoferrodoxin forms a homodimeric protein, with each protomer comprised of two domains, the N-terminal DSRD domain and C-terminal superoxide reductase-like (SORL) domain. Each domain has a distinct iron center: the DSRD iron center I, Fe(S-Cys)4; and the SORL iron center II, Fe[His4Cys(Glu)].
Probab=40.67  E-value=9.3  Score=14.82  Aligned_cols=10  Identities=20%  Similarity=0.790  Sum_probs=5.7

Q ss_pred             Cccccccccc
Q psy5652           1 MVCIFCRQLL   10 (92)
Q Consensus         1 ~~C~~C~~~f   10 (92)
                      |+|..|+..+
T Consensus         5 ykC~~CGniv   14 (34)
T cd00974           5 YKCEICGNIV   14 (34)
T ss_pred             EEcCCCCcEE
Confidence            4566666554


No 194
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed
Probab=40.65  E-value=10  Score=23.03  Aligned_cols=11  Identities=45%  Similarity=1.180  Sum_probs=5.0

Q ss_pred             eeCCCCCccCC
Q psy5652          36 YVCFKCGYHQY   46 (92)
Q Consensus        36 ~~c~~c~~~~~   46 (92)
                      +.|+.|+..|.
T Consensus        58 ~vcp~c~~h~r   68 (296)
T CHL00174         58 NICEQCGYHLK   68 (296)
T ss_pred             CCCCCCCCCcC
Confidence            34455554443


No 195
>KOG2231|consensus
Probab=40.53  E-value=31  Score=23.65  Aligned_cols=21  Identities=29%  Similarity=0.581  Sum_probs=12.8

Q ss_pred             eCCCCCccCCCHHHHHHHHHH
Q psy5652          37 VCFKCGYHQYNSDRMKRHIRT   57 (92)
Q Consensus        37 ~c~~c~~~~~~~~~l~~h~~~   57 (92)
                      .|..|...|.....+..|++.
T Consensus       184 ~C~~C~~~fld~~el~rH~~~  204 (669)
T KOG2231|consen  184 LCKFCHERFLDDDELYRHLRF  204 (669)
T ss_pred             cchhhhhhhccHHHHHHhhcc
Confidence            455666666666666666553


No 196
>KOG3507|consensus
Probab=40.12  E-value=27  Score=15.83  Aligned_cols=30  Identities=23%  Similarity=0.673  Sum_probs=17.3

Q ss_pred             CCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcccc
Q psy5652          33 SHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSA   73 (92)
Q Consensus        33 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   73 (92)
                      ..-|.|.+|+..-    .|+       ..-++.|.+||...
T Consensus        18 ~miYiCgdC~~en----~lk-------~~D~irCReCG~RI   47 (62)
T KOG3507|consen   18 TMIYICGDCGQEN----TLK-------RGDVIRCRECGYRI   47 (62)
T ss_pred             cEEEEeccccccc----ccc-------CCCcEehhhcchHH
Confidence            3468888887421    111       12467888887544


No 197
>PF01780 Ribosomal_L37ae:  Ribosomal L37ae protein family;  InterPro: IPR002674 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This ribosomal protein is found in archaebacteria and eukaryotes []. Ribosomal protein L37 has a single zinc finger-like motif of the C2-C2 type [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005622 intracellular, 0005840 ribosome; PDB: 4A1E_Y 4A17_Y 4A1C_Y 4A1A_Y 3O58_g 3IZS_m 3O5H_g 1S1I_9 3IZR_m 1YSH_D ....
Probab=40.10  E-value=10  Score=18.70  Aligned_cols=11  Identities=36%  Similarity=0.927  Sum_probs=6.7

Q ss_pred             ceeCCCCCccC
Q psy5652          35 LYVCFKCGYHQ   45 (92)
Q Consensus        35 ~~~c~~c~~~~   45 (92)
                      -|.|..|+..|
T Consensus        53 IW~C~~C~~~~   63 (90)
T PF01780_consen   53 IWKCKKCGKKF   63 (90)
T ss_dssp             EEEETTTTEEE
T ss_pred             EeecCCCCCEE
Confidence            36677776544


No 198
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=39.53  E-value=20  Score=12.92  Aligned_cols=7  Identities=29%  Similarity=0.771  Sum_probs=3.8

Q ss_pred             ccccccc
Q psy5652           2 VCIFCRQ    8 (92)
Q Consensus         2 ~C~~C~~    8 (92)
                      .|+.|+.
T Consensus         4 ~Cp~Cg~   10 (26)
T PF13248_consen    4 FCPNCGA   10 (26)
T ss_pred             CCcccCC
Confidence            3555654


No 199
>PF03119 DNA_ligase_ZBD:  NAD-dependent DNA ligase C4 zinc finger domain;  InterPro: IPR004149 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in NAD-dependent DNA ligases. DNA ligases catalyse the crucial step of joining the breaks in duplex DNA during DNA replication, repair and recombination, utilizing either ATP or NAD(+) as a cofactor []. This domain is a small zinc binding motif that is presumably DNA binding. It is found only in NAD-dependent DNA ligases. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003911 DNA ligase (NAD+) activity, 0006260 DNA replication, 0006281 DNA repair; PDB: 1DGS_A 1V9P_B 2OWO_A.
Probab=39.07  E-value=12  Score=13.94  Aligned_cols=13  Identities=23%  Similarity=0.534  Sum_probs=5.1

Q ss_pred             ccccccccccccc
Q psy5652           2 VCIFCRQLLPMDA   14 (92)
Q Consensus         2 ~C~~C~~~f~~~~   14 (92)
                      .|++|+.......
T Consensus         1 ~CP~C~s~l~~~~   13 (28)
T PF03119_consen    1 TCPVCGSKLVREE   13 (28)
T ss_dssp             B-TTT--BEEE-C
T ss_pred             CcCCCCCEeEcCC
Confidence            3777776655433


No 200
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated
Probab=38.64  E-value=21  Score=21.69  Aligned_cols=11  Identities=27%  Similarity=0.600  Sum_probs=6.8

Q ss_pred             ccCCcCccccC
Q psy5652          64 FKCEFCAHSAT   74 (92)
Q Consensus        64 ~~c~~c~~~~~   74 (92)
                      +.|+.|+.-|.
T Consensus        47 ~vc~~c~~h~r   57 (292)
T PRK05654         47 NVCPKCGHHMR   57 (292)
T ss_pred             CCCCCCCCCee
Confidence            56666766554


No 201
>PRK01343 zinc-binding protein; Provisional
Probab=37.84  E-value=17  Score=16.34  Aligned_cols=9  Identities=22%  Similarity=0.401  Sum_probs=6.2

Q ss_pred             ccccccccc
Q psy5652           2 VCIFCRQLL   10 (92)
Q Consensus         2 ~C~~C~~~f   10 (92)
                      .|++|++.+
T Consensus        11 ~CP~C~k~~   19 (57)
T PRK01343         11 PCPECGKPS   19 (57)
T ss_pred             cCCCCCCcC
Confidence            477787664


No 202
>PF05129 Elf1:  Transcription elongation factor Elf1 like;  InterPro: IPR007808 This family of uncharacterised, mostly short, proteins contain a putative zinc binding domain with four conserved cysteines.; PDB: 1WII_A.
Probab=37.79  E-value=12  Score=17.97  Aligned_cols=13  Identities=23%  Similarity=0.508  Sum_probs=6.9

Q ss_pred             ceeCCCCCccCCC
Q psy5652          35 LYVCFKCGYHQYN   47 (92)
Q Consensus        35 ~~~c~~c~~~~~~   47 (92)
                      ...|..|+..|..
T Consensus        46 ~~~C~~Cg~~~~~   58 (81)
T PF05129_consen   46 ILSCRVCGESFQT   58 (81)
T ss_dssp             EEEESSS--EEEE
T ss_pred             EEEecCCCCeEEE
Confidence            4577777765543


No 203
>PF10276 zf-CHCC:  Zinc-finger domain;  InterPro: IPR019401 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.   This entry represents a short conserved zinc-finger domain. It contains the sequence motif Cx8Hx14Cx2C. ; PDB: 2JVM_A 2JRR_A 2JZ8_A.
Probab=37.69  E-value=24  Score=14.55  Aligned_cols=12  Identities=33%  Similarity=0.537  Sum_probs=8.6

Q ss_pred             CceeCCCCCccC
Q psy5652          34 HLYVCFKCGYHQ   45 (92)
Q Consensus        34 ~~~~c~~c~~~~   45 (92)
                      .+..|+.|+..|
T Consensus        28 ~~~~CpYCg~~y   39 (40)
T PF10276_consen   28 GPVVCPYCGTRY   39 (40)
T ss_dssp             CEEEETTTTEEE
T ss_pred             CeEECCCCCCEE
Confidence            467888888655


No 204
>KOG3214|consensus
Probab=37.63  E-value=18  Score=18.30  Aligned_cols=14  Identities=21%  Similarity=0.560  Sum_probs=8.3

Q ss_pred             CccCCcCccccCCh
Q psy5652          63 PFKCEFCAHSATSK   76 (92)
Q Consensus        63 ~~~c~~c~~~~~~~   76 (92)
                      ...|..|+..|...
T Consensus        47 ~~sC~iC~esFqt~   60 (109)
T KOG3214|consen   47 KASCRICEESFQTT   60 (109)
T ss_pred             eeeeeehhhhhccc
Confidence            35666666666543


No 205
>cd00924 Cyt_c_Oxidase_Vb Cytochrome c oxidase subunit Vb.  Cytochrome c oxidase (CcO), the terminal oxidase in the respiratory chains of eukaryotes and most bacteria, is a multi-chain transmembrane protein located in the inner membrane of mitochondria and the cell membrane of prokaryotes.  It catalyzes the reduction of O2 and simultaneously pumps protons across the membrane.  The number of subunits varies from three to five in bacteria and up to 13 in mammalian mitochondria. Subunits I, II, and III of mammalian CcO are encoded within the mitochondrial genome and the remaining 10 subunits are encoded within the nuclear genome.  Found only in eukaryotes, subunit Vb is one of three mammalian subunits that lacks a transmembrane region.  Subunit Vb is located on the matrix side of the membrane and binds the regulatory subunit of protein kinase A.  The abnormally extended conformation is stable only in the CcO assembly.
Probab=37.52  E-value=22  Score=17.83  Aligned_cols=13  Identities=23%  Similarity=0.317  Sum_probs=10.5

Q ss_pred             CceeCCCCCccCC
Q psy5652          34 HLYVCFKCGYHQY   46 (92)
Q Consensus        34 ~~~~c~~c~~~~~   46 (92)
                      ++..|.+||.-|.
T Consensus        78 ~~~rC~eCG~~fk   90 (97)
T cd00924          78 KPKRCPECGHVFK   90 (97)
T ss_pred             CceeCCCCCcEEE
Confidence            6889999997764


No 206
>TIGR00244 transcriptional regulator NrdR. Members of this almost entirely bacterial family contain an ATP cone domain (PFAM:PF03477). There is never more than one member per genome. Common gene symbols given include nrdR, ybaD, ribX and ytcG. The member from Streptomyces coelicolor is found upstream in the operon of the class II oxygen-independent ribonucleotide reductase gene nrdJ and was shown to repress nrdJ expression. Many members of this family are found near genes for riboflavin biosynthesis in Gram-negative bacteria, suggesting a role in that pathway. However, a phylogenetic profiling study associates members of this family with the presence of a palindromic signal with consensus acaCwAtATaTwGtgt, termed the NrdR-box, an upstream element for most operons for ribonucleotide reductase of all three classes in bacterial genomes.
Probab=37.51  E-value=15  Score=19.87  Aligned_cols=16  Identities=13%  Similarity=0.247  Sum_probs=13.6

Q ss_pred             cccccccccccccccc
Q psy5652           2 VCIFCRQLLPMDADFI   17 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~   17 (92)
                      .|..|++.|.+..-+.
T Consensus        30 eC~~C~~RFTTyErve   45 (147)
T TIGR00244        30 ECLECHERFTTFERAE   45 (147)
T ss_pred             cCCccCCccceeeecc
Confidence            4899999999998766


No 207
>PF11781 RRN7:  RNA polymerase I-specific transcription initiation factor Rrn7;  InterPro: IPR021752  Rrn7 is a transcription binding factor that associates strongly with both Rrn6 and Rrn11 to form a complex which itself binds the TATA-binding protein and is required for transcription by the core domain of the RNA PolI promoter [],[]. 
Probab=37.40  E-value=18  Score=14.44  Aligned_cols=7  Identities=29%  Similarity=0.833  Sum_probs=4.3

Q ss_pred             ccccccc
Q psy5652           3 CIFCRQL    9 (92)
Q Consensus         3 C~~C~~~    9 (92)
                      |..|+..
T Consensus        11 C~~C~~~   17 (36)
T PF11781_consen   11 CPVCGSR   17 (36)
T ss_pred             CCCCCCe
Confidence            6666654


No 208
>KOG4602|consensus
Probab=36.84  E-value=17  Score=21.74  Aligned_cols=9  Identities=56%  Similarity=1.132  Sum_probs=5.0

Q ss_pred             ceeCCCCCc
Q psy5652          35 LYVCFKCGY   43 (92)
Q Consensus        35 ~~~c~~c~~   43 (92)
                      .|.|++||-
T Consensus       268 ~YVCPiCGA  276 (318)
T KOG4602|consen  268 SYVCPICGA  276 (318)
T ss_pred             hhcCccccc
Confidence            455666654


No 209
>COG3364 Zn-ribbon containing protein [General function prediction only]
Probab=35.63  E-value=26  Score=17.79  Aligned_cols=26  Identities=19%  Similarity=0.342  Sum_probs=17.1

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCc
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCA   70 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~   70 (92)
                      ++.|..||..|..-+..          .--.|+.||
T Consensus         2 pH~CtrCG~vf~~g~~~----------il~GCp~CG   27 (112)
T COG3364           2 PHQCTRCGEVFDDGSEE----------ILSGCPKCG   27 (112)
T ss_pred             CceecccccccccccHH----------HHccCcccc
Confidence            56788888887764322          136788877


No 210
>PF01844 HNH:  HNH endonuclease;  InterPro: IPR002711 HNH endonuclease is found in bacteria and viruses [, , ]. This family includes pyocins, colicins and anaredoxins.; GO: 0003676 nucleic acid binding, 0004519 endonuclease activity; PDB: 2QGP_C.
Probab=35.58  E-value=17  Score=14.80  Aligned_cols=16  Identities=13%  Similarity=0.453  Sum_probs=6.3

Q ss_pred             cccccccccccccccc
Q psy5652           3 CIFCRQLLPMDADFIL   18 (92)
Q Consensus         3 C~~C~~~f~~~~~l~~   18 (92)
                      |..|++.+.....+..
T Consensus         1 C~~C~~~~~~~~~~~v   16 (47)
T PF01844_consen    1 CQYCGKPGSDNESLHV   16 (47)
T ss_dssp             -TTT--B--GG-GEEE
T ss_pred             CCCCCCcCccCcceEe
Confidence            6778888777644443


No 211
>PRK03976 rpl37ae 50S ribosomal protein L37Ae; Reviewed
Probab=35.37  E-value=18  Score=17.92  Aligned_cols=12  Identities=33%  Similarity=0.783  Sum_probs=6.9

Q ss_pred             ceeCCCCCccCC
Q psy5652          35 LYVCFKCGYHQY   46 (92)
Q Consensus        35 ~~~c~~c~~~~~   46 (92)
                      .|.|..|+..|.
T Consensus        54 IW~C~~C~~~~A   65 (90)
T PRK03976         54 IWECRKCGAKFA   65 (90)
T ss_pred             EEEcCCCCCEEe
Confidence            466666665443


No 212
>PHA02998 RNA polymerase subunit; Provisional
Probab=34.89  E-value=50  Score=18.71  Aligned_cols=12  Identities=17%  Similarity=0.462  Sum_probs=8.0

Q ss_pred             ccCCcCccccCC
Q psy5652          64 FKCEFCAHSATS   75 (92)
Q Consensus        64 ~~c~~c~~~~~~   75 (92)
                      |.|..|+..|..
T Consensus       172 YkC~~CG~~wkp  183 (195)
T PHA02998        172 HACRDCKKHFKP  183 (195)
T ss_pred             EEcCCCCCccCC
Confidence            677777766643


No 213
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=34.67  E-value=20  Score=15.70  Aligned_cols=15  Identities=20%  Similarity=0.658  Sum_probs=9.5

Q ss_pred             Ccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDAD   15 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~   15 (92)
                      +.|+.||..+...-+
T Consensus         1 i~CPyCge~~~~~iD   15 (52)
T PF14255_consen    1 IQCPYCGEPIEILID   15 (52)
T ss_pred             CCCCCCCCeeEEEEe
Confidence            357888877655433


No 214
>TIGR03829 YokU_near_AblA uncharacterized protein, YokU family. Members of this protein family occur in various species of the genus Bacillus, always next to the gene (kamA or ablA) for lysine 2,3-aminomutase. Members have a pair of CXXC motifs, and share homology to the amino-terminal region of a family of putative transcription factors for which the C-terminal is modeled by pfam01381, a helix-turn-helix domain model. This family, however, is shorter and lacks the helix-turn-helix region. The function of this protein family is unknown, but a regulatory role in compatible solute biosynthesis is suggested by local genome context.
Probab=34.14  E-value=14  Score=18.18  Aligned_cols=15  Identities=27%  Similarity=0.700  Sum_probs=7.7

Q ss_pred             CCCCCccCCCHHHHH
Q psy5652          38 CFKCGYHQYNSDRMK   52 (92)
Q Consensus        38 c~~c~~~~~~~~~l~   52 (92)
                      |+.||..|.+.+...
T Consensus        38 C~~CGe~y~~dev~~   52 (89)
T TIGR03829        38 CSHCGMEYQDDTTVK   52 (89)
T ss_pred             ccCCCcEeecHHHHH
Confidence            555555555544433


No 215
>PF10367 Vps39_2:  Vacuolar sorting protein 39 domain 2;  InterPro: IPR019453  This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1. Vps39, a component of the C-Vps complex, is thought to be required for the fusion of endosomes and other types of transport intermediates with the vacuole [, ]. In Saccharomyces cerevisiae (Baker's yeast), Vps39 has been shown to stimulate nucleotide exchange []. Trap1 plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling [, ]. The precise function of this domain has not been characterised In Vps39 this domain is involved in localisation and in mediating the interactions with Vps11 []. 
Probab=34.02  E-value=23  Score=17.37  Aligned_cols=12  Identities=25%  Similarity=0.515  Sum_probs=8.7

Q ss_pred             cccccccccccc
Q psy5652           2 VCIFCRQLLPMD   13 (92)
Q Consensus         2 ~C~~C~~~f~~~   13 (92)
                      .|.+|++.+...
T Consensus        80 ~C~vC~k~l~~~   91 (109)
T PF10367_consen   80 KCSVCGKPLGNS   91 (109)
T ss_pred             CccCcCCcCCCc
Confidence            488888877663


No 216
>smart00504 Ubox Modified RING finger domain. Modified RING finger domain, without the full complement of Zn2+-binding ligands. Probable involvement in E2-dependent ubiquitination.
Probab=33.11  E-value=28  Score=15.15  Aligned_cols=12  Identities=8%  Similarity=0.387  Sum_probs=7.0

Q ss_pred             Cccccccccccc
Q psy5652           1 MVCIFCRQLLPM   12 (92)
Q Consensus         1 ~~C~~C~~~f~~   12 (92)
                      +.|++|+..+.+
T Consensus         2 ~~Cpi~~~~~~~   13 (63)
T smart00504        2 FLCPISLEVMKD   13 (63)
T ss_pred             cCCcCCCCcCCC
Confidence            356777665544


No 217
>PRK05978 hypothetical protein; Provisional
Probab=33.09  E-value=37  Score=18.47  Aligned_cols=16  Identities=25%  Similarity=0.418  Sum_probs=7.3

Q ss_pred             eCCCCCccCCCHHHHH
Q psy5652          37 VCFKCGYHQYNSDRMK   52 (92)
Q Consensus        37 ~c~~c~~~~~~~~~l~   52 (92)
                      .|+.||++-.....|+
T Consensus        35 rCP~CG~G~LF~g~Lk   50 (148)
T PRK05978         35 RCPACGEGKLFRAFLK   50 (148)
T ss_pred             cCCCCCCCcccccccc
Confidence            4555555444443333


No 218
>PF03367 zf-ZPR1:  ZPR1 zinc-finger domain;  InterPro: IPR004457 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZPR1-type zinc finger domains. An orthologous protein found once in each of the completed archaeal genomes corresponds to a zinc finger-containing domain repeated as the N-terminal and C-terminal halves of the mouse protein ZPR1. ZPR1 is an experimentally proven zinc-binding protein that binds the tyrosine kinase domain of the epidermal growth factor receptor (EGFR); binding is inhibited by EGF stimulation and tyrosine phosphorylation, and activation by EGF is followed by some redistribution of ZPR1 to the nucleus. By analogy, other proteins with the ZPR1 zinc finger domain may be regulatory proteins that sense protein phosphorylation state and/or participate in signal transduction (see also IPR004470 from INTERPRO). Deficiencies in ZPR1 may contribute to neurodegenerative disorders. ZPR1 appears to be down-regulated in patients with spinal muscular atrophy (SMA), a disease characterised by degeneration of the alpha-motor neurons in the spinal cord that can arise from mutations affecting the expression of Survival Motor Neurons (SMN) []. ZPR1 interacts with complexes formed by SMN [], and may act as a modifier that effects the severity of SMA. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2QKD_A.
Probab=32.66  E-value=5.6  Score=21.77  Aligned_cols=10  Identities=40%  Similarity=1.192  Sum_probs=4.8

Q ss_pred             ceeCCCCCcc
Q psy5652          35 LYVCFKCGYH   44 (92)
Q Consensus        35 ~~~c~~c~~~   44 (92)
                      .|.|+.||..
T Consensus        30 sf~C~~CGyk   39 (161)
T PF03367_consen   30 SFECEHCGYK   39 (161)
T ss_dssp             EEE-TTT--E
T ss_pred             EeECCCCCCE
Confidence            5778888753


No 219
>PF10272 Tmpp129:  Putative transmembrane protein precursor;  InterPro: IPR018801  This entry consists of proteins conserved from worms to humans. They are purported to be transmembrane protein-precursors but their function is unknown. 
Probab=32.56  E-value=16  Score=22.90  Aligned_cols=10  Identities=20%  Similarity=0.395  Sum_probs=5.6

Q ss_pred             eeCCCCCccC
Q psy5652          36 YVCFKCGYHQ   45 (92)
Q Consensus        36 ~~c~~c~~~~   45 (92)
                      .+|++|...|
T Consensus       341 ~~CPtCRa~F  350 (358)
T PF10272_consen  341 CPCPTCRAKF  350 (358)
T ss_pred             CCCCCCcccc
Confidence            4566665544


No 220
>TIGR01384 TFS_arch transcription factor S, archaeal. There has been an apparent duplication event in the Halobacteriaceae lineage (Haloarcula, Haloferax, Haloquadratum, Halobacterium and Natromonas). There appears to be a separate duplication in Methanosphaera stadtmanae.
Probab=32.55  E-value=54  Score=16.25  Aligned_cols=38  Identities=24%  Similarity=0.343  Sum_probs=19.8

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhh-C-CCCccCCcCccccC
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHT-G-ERPFKCEFCAHSAT   74 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~-~-~~~~~c~~c~~~~~   74 (92)
                      ...|+.||..-..-..++  +++.. + ..-|.|..|+..+.
T Consensus        62 ~~~Cp~Cg~~~a~f~~~Q--~RsadE~~T~fy~C~~C~~~w~  101 (104)
T TIGR01384        62 RVECPKCGHKEAYYWLLQ--TRRADEPETRFYKCTKCGYVWR  101 (104)
T ss_pred             cCCCCCCCCCeeEEEEec--cCCCCCCcEEEEEeCCCCCeeE
Confidence            468888886433222222  22211 1 13478888886553


No 221
>PRK00420 hypothetical protein; Validated
Probab=32.05  E-value=50  Score=17.10  Aligned_cols=12  Identities=25%  Similarity=0.121  Sum_probs=7.9

Q ss_pred             ceeCCCCCccCC
Q psy5652          35 LYVCFKCGYHQY   46 (92)
Q Consensus        35 ~~~c~~c~~~~~   46 (92)
                      ...|+.||....
T Consensus        40 ~~~Cp~Cg~~~~   51 (112)
T PRK00420         40 EVVCPVHGKVYI   51 (112)
T ss_pred             ceECCCCCCeee
Confidence            457888877444


No 222
>smart00507 HNHc HNH nucleases.
Probab=31.99  E-value=42  Score=13.45  Aligned_cols=11  Identities=27%  Similarity=0.791  Sum_probs=6.6

Q ss_pred             ccccccccccc
Q psy5652           2 VCIFCRQLLPM   12 (92)
Q Consensus         2 ~C~~C~~~f~~   12 (92)
                      .|..|+..+..
T Consensus        12 ~C~~C~~~~~~   22 (52)
T smart00507       12 VCAYCGKPASE   22 (52)
T ss_pred             CCcCCcCCCCC
Confidence            56667666543


No 223
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the TIGR00143 hypF [NiFe] hydrogenase maturation protein HypF. A previously described regulatory effect of HypF mutatation is attributable to loss of activity of a regulatory hydrogenase. A zinc finger-like region CXXCX(18)CXXCX(24)CXXCX(18)CXXC region further supported the regulatory hypothesis. However, more recent work (PUBMED:11375153) shows the direct effect is on the activity of expressed hydrogenases with nickel/iron centers, rather than on expression.
Probab=31.48  E-value=12  Score=25.61  Aligned_cols=31  Identities=23%  Similarity=0.520  Sum_probs=18.1

Q ss_pred             eCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcccc
Q psy5652          37 VCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSA   73 (92)
Q Consensus        37 ~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   73 (92)
                      .|+.|.+-+.+...    .|.|  ..+..|..||...
T Consensus       120 ~C~~C~~ey~~p~~----rr~h--~~~~~C~~Cgp~l  150 (711)
T TIGR00143       120 LCPDCAKEYKDPLD----RRFH--AQPIACPRCGPQL  150 (711)
T ss_pred             CCHHHHHHhcCCcc----ccCC--CCCccCCCCCcEE
Confidence            57777666555432    2222  3567888888543


No 225
>PF04981 NMD3:  NMD3 family ;  InterPro: IPR007064 The NMD3 protein is involved in nonsense mediated mRNA decay. This N-terminal region contains four conserved CXXC motifs that could be metal binding. NMD3 is involved in export of the 60S ribosomal subunit is mediated by the adapter protein Nmd3p in a Crm1p-dependent pathway [].
Probab=31.20  E-value=52  Score=19.18  Aligned_cols=13  Identities=31%  Similarity=0.748  Sum_probs=8.6

Q ss_pred             CceeCCCCCccCC
Q psy5652          34 HLYVCFKCGYHQY   46 (92)
Q Consensus        34 ~~~~c~~c~~~~~   46 (92)
                      ....|+.||.-+.
T Consensus        34 ~v~~C~~Cg~~~~   46 (236)
T PF04981_consen   34 EVTICPKCGRYRI   46 (236)
T ss_pred             CceECCCCCCEEC
Confidence            4567888886443


No 226
>KOG0978|consensus
Probab=30.98  E-value=17  Score=24.90  Aligned_cols=21  Identities=19%  Similarity=0.292  Sum_probs=14.6

Q ss_pred             hhCCCCccCCcCccccCChHH
Q psy5652          58 HTGERPFKCEFCAHSATSKSN   78 (92)
Q Consensus        58 ~~~~~~~~c~~c~~~~~~~~~   78 (92)
                      ....+--+||.|+.+|.....
T Consensus       673 r~etRqRKCP~Cn~aFganDv  693 (698)
T KOG0978|consen  673 RYETRQRKCPKCNAAFGANDV  693 (698)
T ss_pred             HHHHhcCCCCCCCCCCCcccc
Confidence            334456789999999876543


No 227
>PF05191 ADK_lid:  Adenylate kinase, active site lid;  InterPro: IPR007862 Adenylate kinases (ADK; 2.7.4.3 from EC) are phosphotransferases that catalyse the Mg-dependent reversible conversion of ATP and AMP to two molecules of ADP, an essential reaction for many processes in living cells. In large variants of adenylate kinase, the AMP and ATP substrates are buried in a domain that undergoes conformational changes from an open to a closed state when bound to substrate; the ligand is then contained within a highly specific environment required for catalysis. Adenylate kinase is a 3-domain protein consisting of a large central CORE domain flanked by a LID domain on one side and the AMP-binding NMPbind domain on the other []. The LID domain binds ATP and covers the phosphates at the active site. The substrates first bind the CORE domain, followed by closure of the active site by the LID and NMPbind domains. Comparisons of adenylate kinases have revealed a particular divergence in the active site lid. In some organisms, particularly the Gram-positive bacteria, residues in the lid domain have been mutated to cysteines and these cysteine residues (two CX(n)C motifs) are responsible for the binding of a zinc ion. The bound zinc ion in the lid domain is clearly structurally homologous to Zinc-finger domains. However, it is unclear whether the adenylate kinase lid is a novel zinc-finger DNA/RNA binding domain, or that the lid bound zinc serves a purely structural function [].; GO: 0004017 adenylate kinase activity; PDB: 3BE4_A 2OSB_B 2ORI_A 2EU8_A 3DL0_A 1P3J_A 2QAJ_A 2OO7_A 2P3S_A 3DKV_A ....
Probab=30.91  E-value=20  Score=14.33  Aligned_cols=13  Identities=15%  Similarity=0.649  Sum_probs=7.6

Q ss_pred             ccccccccccccc
Q psy5652           2 VCIFCRQLLPMDA   14 (92)
Q Consensus         2 ~C~~C~~~f~~~~   14 (92)
                      .|+.|++.|....
T Consensus         3 ~C~~Cg~~Yh~~~   15 (36)
T PF05191_consen    3 ICPKCGRIYHIEF   15 (36)
T ss_dssp             EETTTTEEEETTT
T ss_pred             CcCCCCCcccccc
Confidence            4677776655433


No 228
>KOG2906|consensus
Probab=30.60  E-value=29  Score=17.53  Aligned_cols=13  Identities=23%  Similarity=0.552  Sum_probs=8.4

Q ss_pred             CceeCCCCCccCC
Q psy5652          34 HLYVCFKCGYHQY   46 (92)
Q Consensus        34 ~~~~c~~c~~~~~   46 (92)
                      ..|.|..|++.+.
T Consensus        20 ~rf~C~tCpY~~~   32 (105)
T KOG2906|consen   20 NRFSCRTCPYVFP   32 (105)
T ss_pred             eeEEcCCCCceee
Confidence            3567777776554


No 229
>PF14375 Cys_rich_CWC:  Cysteine-rich CWC
Probab=30.40  E-value=27  Score=14.94  Aligned_cols=11  Identities=18%  Similarity=0.437  Sum_probs=6.1

Q ss_pred             ccccccccccc
Q psy5652           3 CIFCRQLLPMD   13 (92)
Q Consensus         3 C~~C~~~f~~~   13 (92)
                      |+.|+..|.-.
T Consensus         1 CP~Cg~~f~C~   11 (50)
T PF14375_consen    1 CPRCGAPFECG   11 (50)
T ss_pred             CCCCCCcCCCC
Confidence            55566555544


No 230
>COG1326 Uncharacterized archaeal Zn-finger protein [General function prediction only]
Probab=30.30  E-value=74  Score=18.30  Aligned_cols=10  Identities=30%  Similarity=0.747  Sum_probs=4.8

Q ss_pred             CccCCcCccc
Q psy5652          63 PFKCEFCAHS   72 (92)
Q Consensus        63 ~~~c~~c~~~   72 (92)
                      -+.|..||..
T Consensus        30 lvrC~eCG~V   39 (201)
T COG1326          30 LVRCEECGTV   39 (201)
T ss_pred             EEEccCCCcE
Confidence            3455555543


No 231
>PF06170 DUF983:  Protein of unknown function (DUF983);  InterPro: IPR009325 This family consists of several bacterial proteins of unknown function.
Probab=30.22  E-value=29  Score=16.93  Aligned_cols=12  Identities=17%  Similarity=0.293  Sum_probs=6.6

Q ss_pred             cccccccccccc
Q psy5652           2 VCIFCRQLLPMD   13 (92)
Q Consensus         2 ~C~~C~~~f~~~   13 (92)
                      .|+.||..|...
T Consensus        10 ~C~~CG~d~~~~   21 (86)
T PF06170_consen   10 RCPHCGLDYSHA   21 (86)
T ss_pred             cccccCCccccC
Confidence            366666555443


No 232
>PF14787 zf-CCHC_5:  GAG-polyprotein viral zinc-finger; PDB: 1CL4_A 1DSV_A.
Probab=30.21  E-value=18  Score=14.62  Aligned_cols=13  Identities=23%  Similarity=0.375  Sum_probs=6.7

Q ss_pred             cCCcCccccCChH
Q psy5652          65 KCEFCAHSATSKS   77 (92)
Q Consensus        65 ~c~~c~~~~~~~~   77 (92)
                      .|+.|++.|.+.+
T Consensus         4 ~CprC~kg~Hwa~   16 (36)
T PF14787_consen    4 LCPRCGKGFHWAS   16 (36)
T ss_dssp             C-TTTSSSCS-TT
T ss_pred             cCcccCCCcchhh
Confidence            4666776665543


No 233
>cd01410 SIRT7 SIRT7: Eukaryotic and prokaryotic group (class4) which includes human sirtuin SIRT6, SIRT7, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span.
Probab=29.99  E-value=1.1e+02  Score=17.42  Aligned_cols=43  Identities=19%  Similarity=0.325  Sum_probs=25.2

Q ss_pred             CCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccc
Q psy5652          27 MPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHS   72 (92)
Q Consensus        27 ~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~   72 (92)
                      ...|..-....|..|+..+.......   ........-.|+.|+..
T Consensus        87 ielHG~~~~~~C~~C~~~~~~~~~~~---~~~~~~~~p~C~~Cgg~  129 (206)
T cd01410          87 SELHGNMFIEVCKSCGPEYVRDDVVE---TRGDKETGRRCHACGGI  129 (206)
T ss_pred             EEecCCcCcccCCCCCCccchHHHHH---HhhcCCCCCcCCCCcCc
Confidence            45666666788999997765543221   11122234568888754


No 234
>KOG2636|consensus
Probab=29.84  E-value=47  Score=21.68  Aligned_cols=28  Identities=25%  Similarity=0.450  Sum_probs=20.3

Q ss_pred             CCCCCceeCCCCC-ccCCCHHHHHHHHHH
Q psy5652          30 PDSSHLYVCFKCG-YHQYNSDRMKRHIRT   57 (92)
Q Consensus        30 ~~~~~~~~c~~c~-~~~~~~~~l~~h~~~   57 (92)
                      |.=.+.|.|.+|| +.+.-...+++|-.-
T Consensus       396 HGL~~ey~CEICGNy~Y~GrkaF~RHF~E  424 (497)
T KOG2636|consen  396 HGLDIEYNCEICGNYVYKGRKAFDRHFNE  424 (497)
T ss_pred             cCCCcccceeeccCccccCcHHHHHHhHH
Confidence            3434569999999 677777778888654


No 235
>KOG2272|consensus
Probab=29.76  E-value=20  Score=21.41  Aligned_cols=21  Identities=24%  Similarity=0.360  Sum_probs=13.6

Q ss_pred             CCCCCCCCceeCCCCCccCCC
Q psy5652          27 MPRPDSSHLYVCFKCGYHQYN   47 (92)
Q Consensus        27 ~~~~~~~~~~~c~~c~~~~~~   47 (92)
                      +..|+-...|.|..|.+.|.-
T Consensus       213 mgKhWHveHFvCa~CekPFlG  233 (332)
T KOG2272|consen  213 MGKHWHVEHFVCAKCEKPFLG  233 (332)
T ss_pred             hccccchhheeehhcCCcccc
Confidence            455555556777777776654


No 236
>PF05766 NinG:  Bacteriophage Lambda NinG protein;  InterPro: IPR008713 The ninR region of phage lambda contains two recombination genes, ninB (also known as orf) and ninG (also known as rap). These genes are involved in the RecF and RecBCD recombination pathways of Escherichia coli that operate on phage lambda [, ]. NinB and NinG participate in Red recombination, the primary pathway operating when wild-type lambda grows lytically in rec+ cells [].
Probab=29.70  E-value=30  Score=19.66  Aligned_cols=16  Identities=13%  Similarity=0.245  Sum_probs=11.3

Q ss_pred             cccccccccccccccc
Q psy5652           2 VCIFCRQLLPMDADFI   17 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~   17 (92)
                      +|.+|+..|.-...++
T Consensus         8 KCKvCg~~F~P~~s~q   23 (189)
T PF05766_consen    8 KCKVCGEWFVPARSNQ   23 (189)
T ss_pred             cCcccCCccccCCCce
Confidence            5888888887655544


No 237
>COG1327 Predicted transcriptional regulator, consists of a Zn-ribbon and ATP-cone domains [Transcription]
Probab=29.64  E-value=25  Score=19.24  Aligned_cols=17  Identities=18%  Similarity=0.280  Sum_probs=13.7

Q ss_pred             ccccccccccccccccc
Q psy5652           2 VCIFCRQLLPMDADFIL   18 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~   18 (92)
                      .|..|+..|.+...+..
T Consensus        30 eC~~C~~RFTTfE~~El   46 (156)
T COG1327          30 ECLECGERFTTFERAEL   46 (156)
T ss_pred             cccccccccchhheeee
Confidence            48999999999876553


No 238
>COG5112 UFD2 U1-like Zn-finger-containing protein [General function prediction only]
Probab=29.49  E-value=29  Score=17.76  Aligned_cols=25  Identities=12%  Similarity=0.260  Sum_probs=20.2

Q ss_pred             CCCceeCCCCCccCCCHHHHHHHHH
Q psy5652          32 SSHLYVCFKCGYHQYNSDRMKRHIR   56 (92)
Q Consensus        32 ~~~~~~c~~c~~~~~~~~~l~~h~~   56 (92)
                      +...+.|.+|.+-|.....|..|.+
T Consensus        52 GlGqhYCieCaryf~t~~aL~~Hkk   76 (126)
T COG5112          52 GLGQHYCIECARYFITEKALMEHKK   76 (126)
T ss_pred             CCceeeeehhHHHHHHHHHHHHHhc
Confidence            3446889999999999888888875


No 239
>PRK14138 NAD-dependent deacetylase; Provisional
Probab=29.37  E-value=1.3e+02  Score=17.76  Aligned_cols=42  Identities=17%  Similarity=0.419  Sum_probs=25.6

Q ss_pred             CCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccc
Q psy5652          27 MPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHS   72 (92)
Q Consensus        27 ~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~   72 (92)
                      ...|..-....|..|+..+.......   ..... ..-.|+.|+..
T Consensus       111 ielHG~~~~~~C~~C~~~~~~~~~~~---~~~~~-~~p~Cp~Cgg~  152 (244)
T PRK14138        111 IELHGNVEEYYCVRCGKRYTVEDVIE---KLEKS-DVPRCDDCSGL  152 (244)
T ss_pred             EEccCCcCeeEECCCCCcccHHHHHH---HHhcC-CCCCCCCCCCe
Confidence            45667667788999998877654433   11112 23468888743


No 240
>PF09845 DUF2072:  Zn-ribbon containing protein (DUF2072);  InterPro: IPR018645  This archaeal Zinc-ribbon containing proteins have no known function. 
Probab=28.65  E-value=40  Score=17.96  Aligned_cols=17  Identities=18%  Similarity=0.372  Sum_probs=12.4

Q ss_pred             Ccccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDADFI   17 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~   17 (92)
                      ++|.-|++.|.+-+.-.
T Consensus         2 H~Ct~Cg~~f~dgs~ei   18 (131)
T PF09845_consen    2 HQCTKCGRVFEDGSKEI   18 (131)
T ss_pred             cccCcCCCCcCCCcHHH
Confidence            46888888888777433


No 241
>PF03884 DUF329:  Domain of unknown function (DUF329);  InterPro: IPR005584 The biological function of these short proteins is unknown, but they contain four conserved cysteines, suggesting that they all bind zinc. YacG (Q5X8H6 from SWISSPROT) from Escherichia coli has been shown to bind zinc and contains the structural motifs typical of zinc-binding proteins []. The conserved four cysteine motif in these proteins (-C-X(2)-C-X(15)-C-X(3)-C-) is not found in other zinc-binding proteins with known structures.; GO: 0008270 zinc ion binding; PDB: 1LV3_A.
Probab=28.23  E-value=20  Score=16.08  Aligned_cols=11  Identities=18%  Similarity=0.552  Sum_probs=4.1

Q ss_pred             ccccccccccc
Q psy5652           2 VCIFCRQLLPM   12 (92)
Q Consensus         2 ~C~~C~~~f~~   12 (92)
                      .|++|++.+..
T Consensus         4 ~CP~C~k~~~~   14 (57)
T PF03884_consen    4 KCPICGKPVEW   14 (57)
T ss_dssp             E-TTT--EEE-
T ss_pred             cCCCCCCeecc
Confidence            46777765444


No 242
>cd01413 SIR2_Af2 SIR2_Af2: Archaeal and prokaryotic group which includes Archaeoglobus fulgidus Sir2-Af2, Sulfolobus solfataricus ssSir2, and several bacterial homologs; and are members of the SIR2 family of proteins, silent information regulator 2 (Sir2) enzymes which catalyze NAD+-dependent protein/histone deacetylation. Sir2 proteins have been shown to regulate gene silencing, DNA repair, metabolic enzymes, and life span. The Sir2 homolog from the archaea Sulfolobus solftaricus deacetylates the non-specific DNA protein Alba to mediate transcription repression.
Probab=28.05  E-value=1.2e+02  Score=17.44  Aligned_cols=41  Identities=15%  Similarity=0.256  Sum_probs=24.1

Q ss_pred             CCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccc
Q psy5652          27 MPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHS   72 (92)
Q Consensus        27 ~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~   72 (92)
                      ...|..-....|..|+..+..... .    .......-.|+.|+..
T Consensus       105 ~elHG~l~~~~C~~C~~~~~~~~~-~----~~~~~~~p~C~~Cgg~  145 (222)
T cd01413         105 IELHGTLQTAYCVNCGSKYDLEEV-K----YAKKHEVPRCPKCGGI  145 (222)
T ss_pred             EEccCCcCcceECCCCCCcchhHH-H----HhccCCCCcCCCCCCc
Confidence            456666667889999987765532 1    1111223468778643


No 243
>PF14149 YhfH:  YhfH-like protein
Probab=27.73  E-value=6.3  Score=16.00  Aligned_cols=8  Identities=25%  Similarity=0.791  Sum_probs=4.4

Q ss_pred             cccccccc
Q psy5652           3 CIFCRQLL   10 (92)
Q Consensus         3 C~~C~~~f   10 (92)
                      |..||+.+
T Consensus        16 C~~CG~~i   23 (37)
T PF14149_consen   16 CTECGKEI   23 (37)
T ss_pred             cHHHHHHH
Confidence            55666543


No 244
>PF08209 Sgf11:  Sgf11 (transcriptional regulation protein);  InterPro: IPR013246 The Sgf11 family is a SAGA complex subunit in Saccharomyces cerevisiae (Baker's yeast). The SAGA complex is a multisubunit protein complex involved in transcriptional regulation. SAGA combines proteins involved in interactions with DNA-bound activators and TATA-binding protein (TBP), as well as enzymes for histone acetylation and deubiquitylation [].; PDB: 3M99_B 2LO2_A 3MHH_C 3MHS_C.
Probab=27.59  E-value=34  Score=13.45  Aligned_cols=21  Identities=29%  Similarity=0.526  Sum_probs=11.4

Q ss_pred             ceeCCCCCccCCCHHHHHHHHH
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIR   56 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~   56 (92)
                      .+.|+.|++..... .+..|+.
T Consensus         4 ~~~C~nC~R~v~a~-RfA~HLe   24 (33)
T PF08209_consen    4 YVECPNCGRPVAAS-RFAPHLE   24 (33)
T ss_dssp             EEE-TTTSSEEEGG-GHHHHHH
T ss_pred             eEECCCCcCCcchh-hhHHHHH
Confidence            46788887755433 3455543


No 245
>PF02891 zf-MIZ:  MIZ/SP-RING zinc finger;  InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents MIZ-type zinc finger domains. Miz1 (Msx-interacting-zinc finger) is a zinc finger-containing protein with homology to the yeast protein, Nfi-1. Miz1 is a sequence specific DNA binding protein that can function as a positive-acting transcription factor. Miz1 binds to the homeobox protein Msx2, enhancing the specific DNA-binding ability of Msx2 []. Other proteins containing this domain include the human pias family (protein inhibitor of activated STAT protein). More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 3I2D_A.
Probab=27.44  E-value=53  Score=14.07  Aligned_cols=9  Identities=33%  Similarity=1.110  Sum_probs=3.6

Q ss_pred             CccCCcCcc
Q psy5652          63 PFKCEFCAH   71 (92)
Q Consensus        63 ~~~c~~c~~   71 (92)
                      .|.|+.|++
T Consensus        41 ~W~CPiC~~   49 (50)
T PF02891_consen   41 KWKCPICNK   49 (50)
T ss_dssp             --B-TTT--
T ss_pred             CeECcCCcC
Confidence            489998864


No 246
>PF14599 zinc_ribbon_6:  Zinc-ribbon; PDB: 2K2D_A.
Probab=27.31  E-value=18  Score=16.46  Aligned_cols=22  Identities=23%  Similarity=0.582  Sum_probs=7.4

Q ss_pred             ccccccccccccccccccccCC
Q psy5652           3 CIFCRQLLPMDADFILGHCKRC   24 (92)
Q Consensus         3 C~~C~~~f~~~~~l~~h~~~~~   24 (92)
                      |.+|++..........|.|..|
T Consensus        33 CNDC~~~s~v~fH~lg~KC~~C   54 (61)
T PF14599_consen   33 CNDCNAKSEVPFHFLGHKCSHC   54 (61)
T ss_dssp             ESSS--EEEEE--TT----TTT
T ss_pred             CCCCCCccceeeeHhhhcCCCC
Confidence            6666665544444444444444


No 247
>PLN02748 tRNA dimethylallyltransferase
Probab=27.31  E-value=65  Score=21.16  Aligned_cols=25  Identities=24%  Similarity=0.490  Sum_probs=19.6

Q ss_pred             CceeCCCCCc-cCCCHHHHHHHHHHh
Q psy5652          34 HLYVCFKCGY-HQYNSDRMKRHIRTH   58 (92)
Q Consensus        34 ~~~~c~~c~~-~~~~~~~l~~h~~~~   58 (92)
                      +.|.|..|+. .+.....+..|+...
T Consensus       417 ~~~~Ce~C~~~~~~G~~eW~~Hlksr  442 (468)
T PLN02748        417 TQYVCEACGNKVLRGAHEWEQHKQGR  442 (468)
T ss_pred             ccccccCCCCcccCCHHHHHHHhcch
Confidence            5788999997 687888888887653


No 248
>COG3024 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.16  E-value=29  Score=15.99  Aligned_cols=8  Identities=25%  Similarity=0.609  Sum_probs=4.8

Q ss_pred             cccccccc
Q psy5652           2 VCIFCRQL    9 (92)
Q Consensus         2 ~C~~C~~~    9 (92)
                      +|+.|++-
T Consensus         9 ~CP~Cgkp   16 (65)
T COG3024           9 PCPTCGKP   16 (65)
T ss_pred             cCCCCCCc
Confidence            46666654


No 249
>COG4391 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=27.02  E-value=44  Score=15.30  Aligned_cols=13  Identities=23%  Similarity=0.278  Sum_probs=8.3

Q ss_pred             CceeCCCCCccCC
Q psy5652          34 HLYVCFKCGYHQY   46 (92)
Q Consensus        34 ~~~~c~~c~~~~~   46 (92)
                      ..-.|+.|+..|.
T Consensus        47 gev~CPYC~t~y~   59 (62)
T COG4391          47 GEVVCPYCSTRYR   59 (62)
T ss_pred             CcEecCccccEEE
Confidence            3456777776654


No 250
>COG1655 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=26.57  E-value=27  Score=20.64  Aligned_cols=18  Identities=11%  Similarity=0.202  Sum_probs=14.2

Q ss_pred             Cccccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDADFIL   18 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~   18 (92)
                      +.|++|+-.|..+.-+..
T Consensus        20 ieCPvC~tkFkkeev~tg   37 (267)
T COG1655          20 IECPVCNTKFKKEEVKTG   37 (267)
T ss_pred             eccCcccchhhhhheecc
Confidence            469999999988876553


No 251
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=26.50  E-value=57  Score=14.83  Aligned_cols=18  Identities=22%  Similarity=0.408  Sum_probs=11.3

Q ss_pred             CCccCCcCccccCChHHH
Q psy5652          62 RPFKCEFCAHSATSKSNL   79 (92)
Q Consensus        62 ~~~~c~~c~~~~~~~~~l   79 (92)
                      .|..|..||+.......-
T Consensus         3 iPVRCFTCGkvi~~~~e~   20 (60)
T PF01194_consen    3 IPVRCFTCGKVIGNKWEE   20 (60)
T ss_dssp             -SSS-STTTSBTCGHHHH
T ss_pred             CceecCCCCCChhHhHHH
Confidence            477888899877655443


No 252
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=26.32  E-value=32  Score=18.28  Aligned_cols=33  Identities=21%  Similarity=0.589  Sum_probs=20.4

Q ss_pred             CceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccccC
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSAT   74 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~~   74 (92)
                      -.|.|..|+..+.....      .  ....|.|..|+..+.
T Consensus       122 ~~~~C~~C~~~~~r~~~------~--~~~~~~C~~C~~~l~  154 (157)
T PF10263_consen  122 YVYRCPSCGREYKRHRR------S--KRKRYRCGRCGGPLV  154 (157)
T ss_pred             eEEEcCCCCCEeeeecc------c--chhhEECCCCCCEEE
Confidence            46889999876633322      2  223488988886553


No 253
>PF04216 FdhE:  Protein involved in formate dehydrogenase formation;  InterPro: IPR006452 This family of sequences describe an accessory protein required for the assembly of formate dehydrogenase of certain proteobacteria although not present in the final complex []. The exact nature of the function of FdhE in the assembly of the complex is unknown, but considering the presence of selenocysteine, molybdopterin, iron-sulphur clusters and cytochrome b556, it is likely to be involved in the insertion of cofactors. ; GO: 0005737 cytoplasm; PDB: 2FIY_B.
Probab=26.16  E-value=28  Score=20.89  Aligned_cols=36  Identities=19%  Similarity=0.280  Sum_probs=13.5

Q ss_pred             CceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCc
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCA   70 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~   70 (92)
                      ....|+.||..-........ .....+.+...|..|+
T Consensus       210 ~R~~Cp~Cg~~~~~~l~~~~-~e~~~~~rve~C~~C~  245 (290)
T PF04216_consen  210 VRIKCPYCGNTDHEKLEYFT-VEGEPAYRVEVCESCG  245 (290)
T ss_dssp             -TTS-TTT---SS-EEE---------SEEEEEETTTT
T ss_pred             cCCCCcCCCCCCCcceeeEe-cCCCCcEEEEECCccc
Confidence            34578888875443322110 1122344567787777


No 254
>TIGR00686 phnA alkylphosphonate utilization operon protein PhnA. The protein family includes an uncharacterized member designated phnA in Escherichia coli, part of a large operon associated with alkylphosphonate uptake and carbon-phosphorus bond cleavage. This protein is not related to the characterized phosphonoacetate hydrolase designated PhnA by Kulakova, et al. (2001, 1997).
Probab=26.07  E-value=59  Score=16.75  Aligned_cols=13  Identities=23%  Similarity=0.519  Sum_probs=8.1

Q ss_pred             CceeCCCCCccCC
Q psy5652          34 HLYVCFKCGYHQY   46 (92)
Q Consensus        34 ~~~~c~~c~~~~~   46 (92)
                      ..|.|++|+..+.
T Consensus        18 ~~~iCpeC~~EW~   30 (109)
T TIGR00686        18 TQLICPSCLYEWN   30 (109)
T ss_pred             CeeECcccccccc
Confidence            3467777775544


No 255
>KOG0717|consensus
Probab=26.07  E-value=58  Score=21.45  Aligned_cols=22  Identities=18%  Similarity=0.428  Sum_probs=19.5

Q ss_pred             eeCCCCCccCCCHHHHHHHHHH
Q psy5652          36 YVCFKCGYHQYNSDRMKRHIRT   57 (92)
Q Consensus        36 ~~c~~c~~~~~~~~~l~~h~~~   57 (92)
                      +.|.+|.+.|.+.-.+..|..+
T Consensus       293 lyC~vCnKsFKseKq~kNHEnS  314 (508)
T KOG0717|consen  293 LYCVVCNKSFKSEKQLKNHENS  314 (508)
T ss_pred             eEEeeccccccchHHHHhhHHH
Confidence            7899999999999999988764


No 256
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=26.01  E-value=65  Score=14.78  Aligned_cols=12  Identities=33%  Similarity=0.592  Sum_probs=5.7

Q ss_pred             ceeCCCCCccCC
Q psy5652          35 LYVCFKCGYHQY   46 (92)
Q Consensus        35 ~~~c~~c~~~~~   46 (92)
                      |-.|-.||+...
T Consensus         4 PiRCFsCGkvi~   15 (63)
T COG1644           4 PVRCFSCGKVIG   15 (63)
T ss_pred             ceEeecCCCCHH
Confidence            334555555433


No 257
>PF08996 zf-DNA_Pol:  DNA Polymerase alpha zinc finger;  InterPro: IPR015088 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The DNA Polymerase alpha zinc finger domain adopts an alpha-helix-like structure, followed by three turns, all of which involve proline. The resulting motif is a helix-turn-helix motif, in contrast to other zinc finger domains, which show anti-parallel sheet and helix conformation. Zinc binding occurs due to the presence of four cysteine residues positioned to bind the metal centre in a tetrahedral coordination geometry. The function of this domain is uncertain: it has been proposed that the zinc finger motif may be an essential part of the DNA binding domain [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0001882 nucleoside binding, 0003887 DNA-directed DNA polymerase activity, 0006260 DNA replication; PDB: 3FLO_D 1N5G_A 1K0P_A 1K18_A.
Probab=25.74  E-value=44  Score=18.76  Aligned_cols=38  Identities=16%  Similarity=0.177  Sum_probs=14.8

Q ss_pred             CcccccccccccccccccccccCCCCCCCCCCCCceeCCCCCccCC
Q psy5652           1 MVCIFCRQLLPMDADFILGHCKRCSNMPRPDSSHLYVCFKCGYHQY   46 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~h~~~~~~~~~~~~~~~~~~c~~c~~~~~   46 (92)
                      ++|+.|+..|....-...        ...........|+.|+..+.
T Consensus        19 ~~C~~C~~~~~f~g~~~~--------~~~~~~~~~~~C~~C~~~~~   56 (188)
T PF08996_consen   19 LTCPSCGTEFEFPGVFEE--------DGDDVSPSGLQCPNCSTPLS   56 (188)
T ss_dssp             EE-TTT--EEEE-SSS----------SSEEEETTEEEETTT--B--
T ss_pred             eECCCCCCCccccccccC--------CccccccCcCcCCCCCCcCC
Confidence            358888877766654331        00101123467888887443


No 258
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=25.69  E-value=33  Score=18.35  Aligned_cols=13  Identities=15%  Similarity=0.350  Sum_probs=10.1

Q ss_pred             CccCCcCccccCC
Q psy5652          63 PFKCEFCAHSATS   75 (92)
Q Consensus        63 ~~~c~~c~~~~~~   75 (92)
                      =+.|+.|++.|=.
T Consensus       124 f~~C~~C~kiyW~  136 (147)
T PF01927_consen  124 FWRCPGCGKIYWE  136 (147)
T ss_pred             EEECCCCCCEecc
Confidence            4789999998733


No 259
>TIGR01385 TFSII transcription elongation factor S-II. This model represents eukaryotic transcription elongation factor S-II. This protein allows stalled RNA transcription complexes to perform a cleavage of the nascent RNA and restart at the newly generated 3-prime end.
Probab=25.59  E-value=83  Score=19.34  Aligned_cols=37  Identities=22%  Similarity=0.462  Sum_probs=17.1

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhC--CCCccCCcCcccc
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTG--ERPFKCEFCAHSA   73 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~--~~~~~c~~c~~~~   73 (92)
                      .+.|+.|+..=.....++  .+....  ..-|.|..|+..+
T Consensus       258 ~~~C~~C~~~~~~~~q~Q--trsaDEpmT~f~~C~~Cg~~w  296 (299)
T TIGR01385       258 LFTCGKCKQKKCTYYQLQ--TRSADEPMTTFVTCEECGNRW  296 (299)
T ss_pred             cccCCCCCCccceEEEec--ccCCCCCCeEEEEcCCCCCee
Confidence            467777774322222222  222111  1225777777554


No 260
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism]
Probab=25.29  E-value=58  Score=19.88  Aligned_cols=8  Identities=38%  Similarity=0.816  Sum_probs=3.6

Q ss_pred             eeCCCCCc
Q psy5652          36 YVCFKCGY   43 (92)
Q Consensus        36 ~~c~~c~~   43 (92)
                      -.|+.|+.
T Consensus        29 ~KCp~c~~   36 (294)
T COG0777          29 TKCPSCGE   36 (294)
T ss_pred             eECCCccc
Confidence            34444443


No 261
>KOG2879|consensus
Probab=25.26  E-value=51  Score=20.07  Aligned_cols=12  Identities=25%  Similarity=0.924  Sum_probs=8.4

Q ss_pred             CCccCCcCcccc
Q psy5652          62 RPFKCEFCAHSA   73 (92)
Q Consensus        62 ~~~~c~~c~~~~   73 (92)
                      ..|.|+.||...
T Consensus       275 asf~Cp~Cg~~~  286 (298)
T KOG2879|consen  275 ASFTCPLCGENV  286 (298)
T ss_pred             hhcccCccCCCC
Confidence            457888888654


No 262
>KOG1088|consensus
Probab=25.21  E-value=38  Score=17.71  Aligned_cols=21  Identities=19%  Similarity=-0.061  Sum_probs=14.4

Q ss_pred             CCCCCCCceeCCCCCccCCCH
Q psy5652          28 PRPDSSHLYVCFKCGYHQYNS   48 (92)
Q Consensus        28 ~~~~~~~~~~c~~c~~~~~~~   48 (92)
                      .++-.+....|++||+.|+-+
T Consensus        91 e~~v~EG~l~CpetG~vfpI~  111 (124)
T KOG1088|consen   91 EIDVIEGELVCPETGRVFPIS  111 (124)
T ss_pred             hhhhccceEecCCCCcEeecc
Confidence            444455567899998887654


No 263
>smart00746 TRASH metallochaperone-like domain.
Probab=25.03  E-value=47  Score=11.74  Aligned_cols=9  Identities=33%  Similarity=0.903  Sum_probs=5.5

Q ss_pred             ccccccccc
Q psy5652           3 CIFCRQLLP   11 (92)
Q Consensus         3 C~~C~~~f~   11 (92)
                      |+.|++.+.
T Consensus         1 c~~C~~~~~    9 (39)
T smart00746        1 CSFCGKDIY    9 (39)
T ss_pred             CCCCCCCcc
Confidence            566666654


No 264
>PRK00481 NAD-dependent deacetylase; Provisional
Probab=24.73  E-value=1.2e+02  Score=17.67  Aligned_cols=38  Identities=26%  Similarity=0.388  Sum_probs=22.8

Q ss_pred             CCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCccc
Q psy5652          27 MPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHS   72 (92)
Q Consensus        27 ~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~   72 (92)
                      ...|..-....|..|++.+.....+.       .. .-.|+.|+..
T Consensus       114 ~elHG~~~~~~C~~C~~~~~~~~~~~-------~~-~p~C~~Cgg~  151 (242)
T PRK00481        114 IELHGSLLRARCTKCGQTYDLDEYLK-------PE-PPRCPKCGGI  151 (242)
T ss_pred             eeccCCcCceeeCCCCCCcChhhhcc-------CC-CCCCCCCCCc
Confidence            46667667788888987765543221       11 2238888743


No 265
>PF14122 YokU:  YokU-like protein
Probab=24.55  E-value=24  Score=17.30  Aligned_cols=14  Identities=21%  Similarity=0.468  Sum_probs=8.1

Q ss_pred             cccccccccccccc
Q psy5652           2 VCIFCRQLLPMDAD   15 (92)
Q Consensus         2 ~C~~C~~~f~~~~~   15 (92)
                      .|..||+.+.+..-
T Consensus        37 ~C~~CgmvYq~d~v   50 (87)
T PF14122_consen   37 ICSNCGMVYQDDEV   50 (87)
T ss_pred             eecCCCcEEehhHH
Confidence            46666666655543


No 266
>PRK08222 hydrogenase 4 subunit H; Validated
Probab=24.50  E-value=73  Score=17.79  Aligned_cols=19  Identities=11%  Similarity=0.380  Sum_probs=14.8

Q ss_pred             CCccCCcCccccCChHHHH
Q psy5652          62 RPFKCEFCAHSATSKSNLK   80 (92)
Q Consensus        62 ~~~~c~~c~~~~~~~~~l~   80 (92)
                      ....|..|++.|.....+.
T Consensus       113 ~~~~C~~Cg~~f~~~k~i~  131 (181)
T PRK08222        113 HLQRCSRCERPFAPQKTVA  131 (181)
T ss_pred             ccCcCcccCCccCcHhHHH
Confidence            5788999999998765544


No 267
>COG3357 Predicted transcriptional regulator containing an HTH domain fused to a Zn-ribbon [Transcription]
Probab=24.36  E-value=41  Score=16.74  Aligned_cols=14  Identities=29%  Similarity=0.766  Sum_probs=10.8

Q ss_pred             CCccCCcCccccCC
Q psy5652          62 RPFKCEFCAHSATS   75 (92)
Q Consensus        62 ~~~~c~~c~~~~~~   75 (92)
                      +|-.|..||..|..
T Consensus        57 ~Pa~CkkCGfef~~   70 (97)
T COG3357          57 RPARCKKCGFEFRD   70 (97)
T ss_pred             cChhhcccCccccc
Confidence            57788889877764


No 268
>COG1885 Uncharacterized protein conserved in archaea [Function unknown]
Probab=24.28  E-value=39  Score=17.24  Aligned_cols=11  Identities=18%  Similarity=0.443  Sum_probs=7.1

Q ss_pred             ccccccccccc
Q psy5652           2 VCIFCRQLLPM   12 (92)
Q Consensus         2 ~C~~C~~~f~~   12 (92)
                      .|+.||..|..
T Consensus        51 ~CP~Cg~~~e~   61 (115)
T COG1885          51 SCPKCGEPFES   61 (115)
T ss_pred             cCCCCCCccce
Confidence            47777766543


No 269
>PF14354 Lar_restr_allev:  Restriction alleviation protein Lar
Probab=24.22  E-value=36  Score=14.90  Aligned_cols=8  Identities=38%  Similarity=0.982  Sum_probs=5.5

Q ss_pred             cccccccc
Q psy5652           2 VCIFCRQL    9 (92)
Q Consensus         2 ~C~~C~~~    9 (92)
                      .|++||..
T Consensus         5 PCPFCG~~   12 (61)
T PF14354_consen    5 PCPFCGSA   12 (61)
T ss_pred             CCCCCCCc
Confidence            48888744


No 270
>PLN03238 probable histone acetyltransferase MYST; Provisional
Probab=24.13  E-value=1.5e+02  Score=18.33  Aligned_cols=25  Identities=24%  Similarity=0.499  Sum_probs=20.5

Q ss_pred             CCceeCCCCCccCCCHHHHHHHHHH
Q psy5652          33 SHLYVCFKCGYHQYNSDRMKRHIRT   57 (92)
Q Consensus        33 ~~~~~c~~c~~~~~~~~~l~~h~~~   57 (92)
                      ...|.|..|-+-+.+...+..|+..
T Consensus        46 ~~lyiCe~Clky~~~~~~l~~H~~~   70 (290)
T PLN03238         46 TKLYICEYCLKYMRKKKSLLRHLAK   70 (290)
T ss_pred             CeEEEcCCCcchhCCHHHHHHHHHh
Confidence            3568899999888888888888763


No 271
>PF10537 WAC_Acf1_DNA_bd:  ATP-utilising chromatin assembly and remodelling N-terminal;  InterPro: IPR013136 ACF (for ATP-utilising chromatin assembly and remodeling factor) is a chromatin-remodeling complex that catalyzes the ATP-dependent assembly of periodic nucleosome arrays. This reaction utilises the energy of ATP hydrolysis by ISWI, the smaller of the two subunits of ACF. Acf1, the large subunit of ACF, is essential for the full activity of the complex. The WAC (WSTF/Acf1/cbp146) domain is an ~110-residue module present at the N-termini of Acf1-related proteins in a variety of organisms. It is found in association with other domains such as the bromodomain, the PHD-type zinc finger, DDT or WAKS. The DNA-binding region of Acf1 includes the WAC domain, which is necessary for the efficient binding of ACF complex to DNA. It seems probable that the WAC domain will be involved in DNA binding in other related factors [, ].   Some proteins known to contain a WAC domain are the Drosophila melanogaster (Fruit fly) ATP-dependent chromatin assembly factor large subunit Acf1, human WSTF (Williams syndrome transcription factor), mouse cbp146, yeast imitation switch two complex protein 1 (ITC1 or YGL133w), and yeast protein YPL216w. 
Probab=24.01  E-value=1.1e+02  Score=15.43  Aligned_cols=35  Identities=11%  Similarity=0.186  Sum_probs=14.6

Q ss_pred             eeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcc
Q psy5652          36 YVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAH   71 (92)
Q Consensus        36 ~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   71 (92)
                      |.|+.-++.|.+.......+.. -.++.|.|...|+
T Consensus         4 f~i~~T~EiF~dYe~Y~~R~~~-y~~~vwtC~~TGk   38 (102)
T PF10537_consen    4 FYIPFTGEIFRDYEEYLKRMIL-YNQRVWTCEITGK   38 (102)
T ss_pred             EEeCCCCcccCCHHHHHHHHHH-HhCCeeEEecCCC
Confidence            4444444445444443333222 1234455544443


No 272
>PRK10220 hypothetical protein; Provisional
Probab=23.98  E-value=1e+02  Score=16.00  Aligned_cols=14  Identities=21%  Similarity=0.702  Sum_probs=8.4

Q ss_pred             CceeCCCCCccCCC
Q psy5652          34 HLYVCFKCGYHQYN   47 (92)
Q Consensus        34 ~~~~c~~c~~~~~~   47 (92)
                      -.|.|++|+.-+..
T Consensus        19 ~~~vCpeC~hEW~~   32 (111)
T PRK10220         19 GMYICPECAHEWND   32 (111)
T ss_pred             CeEECCcccCcCCc
Confidence            35677777755443


No 273
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=23.95  E-value=24  Score=19.35  Aligned_cols=43  Identities=23%  Similarity=0.376  Sum_probs=26.6

Q ss_pred             CCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcccc
Q psy5652          27 MPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSA   73 (92)
Q Consensus        27 ~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   73 (92)
                      ...|..-....|..|++.+....... .  ... ...-.|+.|+...
T Consensus        97 ielHG~l~~~~C~~C~~~~~~~~~~~-~--~~~-~~~~~C~~C~~~l  139 (178)
T PF02146_consen   97 IELHGSLFRLRCSKCGKEYDREDIVD-S--IDE-EEPPRCPKCGGLL  139 (178)
T ss_dssp             EETTEEEEEEEETTTSBEEEGHHHHH-H--HHT-TSSCBCTTTSCBE
T ss_pred             HHHHhhhceeeecCCCccccchhhcc-c--ccc-cccccccccCccC
Confidence            45666666789999999887654322 1  122 2334888888644


No 274
>PF09779 Ima1_N:  Ima1 N-terminal domain;  InterPro: IPR018617  Members of this family of uncharacterised novel proteins have no known function. 
Probab=23.87  E-value=1.2e+02  Score=15.95  Aligned_cols=9  Identities=22%  Similarity=0.681  Sum_probs=5.5

Q ss_pred             ceeCCCCCc
Q psy5652          35 LYVCFKCGY   43 (92)
Q Consensus        35 ~~~c~~c~~   43 (92)
                      .|.|+.|+.
T Consensus        20 ~w~C~~C~q   28 (131)
T PF09779_consen   20 NWTCPHCEQ   28 (131)
T ss_pred             eeECCCCCC
Confidence            366766663


No 275
>PF13408 Zn_ribbon_recom:  Recombinase zinc beta ribbon domain
Probab=23.80  E-value=29  Score=14.81  Aligned_cols=11  Identities=18%  Similarity=0.446  Sum_probs=7.9

Q ss_pred             ccccccccccc
Q psy5652           2 VCIFCRQLLPM   12 (92)
Q Consensus         2 ~C~~C~~~f~~   12 (92)
                      .|..||..+..
T Consensus         7 ~C~~CG~~m~~   17 (58)
T PF13408_consen    7 RCGHCGSKMTR   17 (58)
T ss_pred             EcccCCcEeEE
Confidence            58888877655


No 276
>PHA02446 hypothetical protein
Probab=23.71  E-value=37  Score=17.70  Aligned_cols=20  Identities=15%  Similarity=0.067  Sum_probs=11.2

Q ss_pred             CCCCCCCCCceeCCCCCccC
Q psy5652          26 NMPRPDSSHLYVCFKCGYHQ   45 (92)
Q Consensus        26 ~~~~~~~~~~~~c~~c~~~~   45 (92)
                      .+..|.+..-..|+..|...
T Consensus        79 ~~eahpd~l~qecplsgqsv   98 (166)
T PHA02446         79 IVEAHPDKLLQECPLSGQSV   98 (166)
T ss_pred             ccccCcHHHHHhCCCCCCcc
Confidence            34555555555666666543


No 277
>KOG3399|consensus
Probab=23.70  E-value=1e+02  Score=16.32  Aligned_cols=18  Identities=28%  Similarity=0.611  Sum_probs=10.9

Q ss_pred             Cccccccccccccccccc
Q psy5652           1 MVCIFCRQLLPMDADFIL   18 (92)
Q Consensus         1 ~~C~~C~~~f~~~~~l~~   18 (92)
                      |.|..|..-|....++..
T Consensus        16 y~C~~C~thla~~~dliS   33 (122)
T KOG3399|consen   16 YSCAHCKTHLARHDDLIS   33 (122)
T ss_pred             EeccCCcccccchhhccc
Confidence            456666666666666653


No 278
>COG0675 Transposase and inactivated derivatives [DNA replication, recombination, and repair]
Probab=23.64  E-value=91  Score=18.67  Aligned_cols=12  Identities=42%  Similarity=0.847  Sum_probs=6.5

Q ss_pred             CCccCCcCcccc
Q psy5652          62 RPFKCEFCAHSA   73 (92)
Q Consensus        62 ~~~~c~~c~~~~   73 (92)
                      +.|.|+.||..+
T Consensus       321 r~~~C~~cg~~~  332 (364)
T COG0675         321 RLFKCPRCGFVH  332 (364)
T ss_pred             eeEECCCCCCee
Confidence            346666666443


No 279
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=23.62  E-value=27  Score=13.22  Aligned_cols=10  Identities=30%  Similarity=0.597  Sum_probs=4.3

Q ss_pred             CceeCCCCCc
Q psy5652          34 HLYVCFKCGY   43 (92)
Q Consensus        34 ~~~~c~~c~~   43 (92)
                      ..-.|+.|+.
T Consensus        20 ~~r~C~~Cg~   29 (32)
T PF09297_consen   20 WARRCPSCGH   29 (32)
T ss_dssp             S-EEESSSS-
T ss_pred             CEeECCCCcC
Confidence            4445555553


No 280
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1. All proteins in this family for which functions are known are cyclin dependent protein kinases that are components of TFIIH, a complex that is involved in nucleotide excision repair and transcription initiation. Also known as MAT1 (menage a trois 1). This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=23.57  E-value=1.1e+02  Score=19.05  Aligned_cols=9  Identities=22%  Similarity=0.530  Sum_probs=5.9

Q ss_pred             Ccccccccc
Q psy5652           1 MVCIFCRQL    9 (92)
Q Consensus         1 ~~C~~C~~~    9 (92)
                      +.|++|...
T Consensus         4 ~~CP~Ck~~   12 (309)
T TIGR00570         4 QGCPRCKTT   12 (309)
T ss_pred             CCCCcCCCC
Confidence            358888653


No 281
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=23.40  E-value=94  Score=14.27  Aligned_cols=13  Identities=31%  Similarity=0.616  Sum_probs=7.4

Q ss_pred             ceeCCCCCccCCC
Q psy5652          35 LYVCFKCGYHQYN   47 (92)
Q Consensus        35 ~~~c~~c~~~~~~   47 (92)
                      |-.|-.||+...+
T Consensus         4 PvRCFTCGkvi~~   16 (62)
T PRK04016          4 PVRCFTCGKVIAE   16 (62)
T ss_pred             CeEecCCCCChHH
Confidence            4456666665444


No 282
>PHA02942 putative transposase; Provisional
Probab=22.89  E-value=1.1e+02  Score=19.53  Aligned_cols=12  Identities=33%  Similarity=0.753  Sum_probs=7.0

Q ss_pred             CCccCCcCcccc
Q psy5652          62 RPFKCEFCAHSA   73 (92)
Q Consensus        62 ~~~~c~~c~~~~   73 (92)
                      +.|.|+.||...
T Consensus       341 r~f~C~~CG~~~  352 (383)
T PHA02942        341 RYFHCPSCGYEN  352 (383)
T ss_pred             CEEECCCCCCEe
Confidence            456666666443


No 283
>PF03966 Trm112p:  Trm112p-like protein;  InterPro: IPR005651 This family of short proteins have no known function. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The function of this family is uncertain. The bacterial members are about 60-70 amino acids in length and the eukaryotic examples are about 120 amino acids in length. The C terminus contains the strongest conservation. The entry contains 2 families:  Trm112, which is required for tRNA methylation in Saccharomyces cerevisiae (Baker's yeast) and is found in complexes with 2 tRNA methylases (TRM9 and TRM11) also with putative methyltransferase YDR140W []. The zinc-finger protein Ynr046w is plurifunctional and a component of the eRF1 methyltransferase in yeast []. The crystal structure of Ynr046w has been determined to 1.7 A resolution. It comprises a zinc-binding domain built from both the N- and C-terminal sequences and an inserted domain, absent from bacterial and archaeal orthologs of the protein, composed of three alpha-helices []. UPF0434, which are proteins that are functionally uncharacterised.  ; PDB: 3Q87_A 2KPI_A 2K5R_A 2HF1_A 2JS4_A 2J6A_A 2JR6_A 2PK7_A 2JNY_A.
Probab=22.78  E-value=31  Score=15.72  Aligned_cols=18  Identities=17%  Similarity=0.235  Sum_probs=12.4

Q ss_pred             CCCCCCceeCCCCCccCC
Q psy5652          29 RPDSSHLYVCFKCGYHQY   46 (92)
Q Consensus        29 ~~~~~~~~~c~~c~~~~~   46 (92)
                      .+..+....|+.|++.|+
T Consensus        47 ~~i~eg~L~Cp~c~r~YP   64 (68)
T PF03966_consen   47 VEIVEGELICPECGREYP   64 (68)
T ss_dssp             EETTTTEEEETTTTEEEE
T ss_pred             ccccCCEEEcCCCCCEEe
Confidence            344445778899988775


No 284
>PF07295 DUF1451:  Protein of unknown function (DUF1451);  InterPro: IPR009912 This family consists of several hypothetical bacterial proteins of around 160 residues in length. Members of this family contain four highly conserved cysteine resides toward the C-terminal region of the protein. The function of this family is unknown.
Probab=22.67  E-value=17  Score=19.64  Aligned_cols=29  Identities=34%  Similarity=0.576  Sum_probs=17.9

Q ss_pred             CCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcc
Q psy5652          33 SHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAH   71 (92)
Q Consensus        33 ~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   71 (92)
                      ...+.|..||.....         .+++ .--.|+.|+.
T Consensus       110 ~G~l~C~~Cg~~~~~---------~~~~-~l~~Cp~C~~  138 (146)
T PF07295_consen  110 PGTLVCENCGHEVEL---------THPE-RLPPCPKCGH  138 (146)
T ss_pred             CceEecccCCCEEEe---------cCCC-cCCCCCCCCC
Confidence            346899999965322         1233 3347888884


No 285
>PTZ00448 hypothetical protein; Provisional
Probab=22.34  E-value=90  Score=19.90  Aligned_cols=23  Identities=26%  Similarity=0.697  Sum_probs=19.2

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHH
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRT   57 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~   57 (92)
                      .|.|..|+-.|.+......|.++
T Consensus       314 ~~tC~~C~v~F~~~~~qR~H~KS  336 (373)
T PTZ00448        314 MLLCRKCNIQLMDHNAFKQHYRS  336 (373)
T ss_pred             CccccccccccCCHHHHHHHhhh
Confidence            57899999999888778888775


No 286
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=22.29  E-value=54  Score=14.72  Aligned_cols=10  Identities=20%  Similarity=0.836  Sum_probs=3.7

Q ss_pred             cccccccccc
Q psy5652           2 VCIFCRQLLP   11 (92)
Q Consensus         2 ~C~~C~~~f~   11 (92)
                      .|..|++.|.
T Consensus        11 ~C~~C~~~F~   20 (69)
T PF01363_consen   11 NCMICGKKFS   20 (69)
T ss_dssp             B-TTT--B-B
T ss_pred             cCcCcCCcCC
Confidence            3677777773


No 287
>smart00731 SprT SprT homologues. Predicted to have roles in transcription elongation. Contains a conserved HExxH motif, indicating a metalloprotease function.
Probab=22.02  E-value=48  Score=17.66  Aligned_cols=33  Identities=21%  Similarity=0.516  Sum_probs=20.1

Q ss_pred             CceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcccc
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAHSA   73 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~~~   73 (92)
                      -.|.|..|+..+...       +.+.....|.|..|+..+
T Consensus       111 ~~y~C~~C~~~~~~~-------rr~~~~~~y~C~~C~g~l  143 (146)
T smart00731      111 YPYRCTGCGQRYLRV-------RRSNNVSRYRCGKCGGKL  143 (146)
T ss_pred             EEEECCCCCCCCceE-------ccccCcceEEcCCCCCEE
Confidence            378898898766421       112222458888887654


No 288
>PF15616 TerY-C:  TerY-C metal binding domain
Probab=22.02  E-value=71  Score=17.06  Aligned_cols=13  Identities=31%  Similarity=0.945  Sum_probs=8.6

Q ss_pred             CCCCccCCcCccc
Q psy5652          60 GERPFKCEFCAHS   72 (92)
Q Consensus        60 ~~~~~~c~~c~~~   72 (92)
                      ++....|+.|+..
T Consensus       102 g~~~~~CPwCg~~  114 (131)
T PF15616_consen  102 GEGEVTCPWCGNE  114 (131)
T ss_pred             CCCCEECCCCCCe
Confidence            4556778888754


No 289
>PRK00418 DNA gyrase inhibitor; Reviewed
Probab=22.00  E-value=45  Score=15.27  Aligned_cols=9  Identities=22%  Similarity=0.593  Sum_probs=5.6

Q ss_pred             ccccccccc
Q psy5652           2 VCIFCRQLL   10 (92)
Q Consensus         2 ~C~~C~~~f   10 (92)
                      .|+.|++..
T Consensus         8 ~CP~C~k~~   16 (62)
T PRK00418          8 NCPTCGKPV   16 (62)
T ss_pred             cCCCCCCcc
Confidence            477777643


No 290
>TIGR00627 tfb4 transcription factor tfb4. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).
Probab=21.80  E-value=1.1e+02  Score=18.58  Aligned_cols=12  Identities=25%  Similarity=0.340  Sum_probs=8.0

Q ss_pred             ceeCCCCCccCC
Q psy5652          35 LYVCFKCGYHQY   46 (92)
Q Consensus        35 ~~~c~~c~~~~~   46 (92)
                      .|.|+.|...|-
T Consensus       255 GyvCs~Clsi~C  266 (279)
T TIGR00627       255 GFVCSVCLSVLC  266 (279)
T ss_pred             eEECCCccCCcC
Confidence            477777766554


No 291
>PTZ00043 cytochrome c oxidase subunit; Provisional
Probab=21.74  E-value=52  Score=19.45  Aligned_cols=16  Identities=25%  Similarity=0.411  Sum_probs=12.3

Q ss_pred             CCCceeCCCCCccCCC
Q psy5652          32 SSHLYVCFKCGYHQYN   47 (92)
Q Consensus        32 ~~~~~~c~~c~~~~~~   47 (92)
                      .+++..|++||.-|.-
T Consensus       178 EGkpqRCpECGqVFKL  193 (268)
T PTZ00043        178 EGFLYRCGECDQIFML  193 (268)
T ss_pred             CCCCccCCCCCcEEEE
Confidence            3468899999987754


No 292
>PF13445 zf-RING_UBOX:  RING-type zinc-finger; PDB: 2CT2_A.
Probab=21.73  E-value=44  Score=13.87  Aligned_cols=14  Identities=21%  Similarity=0.109  Sum_probs=6.4

Q ss_pred             ceeCCCCCccCCCHH
Q psy5652          35 LYVCFKCGYHQYNSD   49 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~   49 (92)
                      |..-+ ||..|....
T Consensus        14 P~~L~-CGH~~c~~c   27 (43)
T PF13445_consen   14 PMVLP-CGHVFCKDC   27 (43)
T ss_dssp             EEE-S-SS-EEEHHH
T ss_pred             CEEEe-CccHHHHHH
Confidence            44433 777665543


No 293
>PRK12860 transcriptional activator FlhC; Provisional
Probab=21.54  E-value=61  Score=18.49  Aligned_cols=29  Identities=28%  Similarity=0.649  Sum_probs=18.4

Q ss_pred             CceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCc
Q psy5652          34 HLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCA   70 (92)
Q Consensus        34 ~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~   70 (92)
                      ....|..|+..|....        +.....|.|+.|.
T Consensus       133 ~l~~C~~Cgg~fv~~~--------~e~~~~f~CplC~  161 (189)
T PRK12860        133 QLARCCRCGGKFVTHA--------HDLRHNFVCGLCQ  161 (189)
T ss_pred             eeccCCCCCCCeeccc--------cccCCCCcCCCCC
Confidence            3467888887776321        2333578888886


No 294
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=21.47  E-value=83  Score=13.36  Aligned_cols=10  Identities=20%  Similarity=0.780  Sum_probs=6.2

Q ss_pred             cccccccccc
Q psy5652           3 CIFCRQLLPM   12 (92)
Q Consensus         3 C~~C~~~f~~   12 (92)
                      |..|++.|..
T Consensus         5 C~~C~~~F~~   14 (57)
T cd00065           5 CMGCGKPFTL   14 (57)
T ss_pred             CcccCccccC
Confidence            6666666654


No 295
>KOG1994|consensus
Probab=21.39  E-value=55  Score=19.34  Aligned_cols=23  Identities=22%  Similarity=0.492  Sum_probs=19.3

Q ss_pred             CCCCccCCcCccccCChHHHHHH
Q psy5652          60 GERPFKCEFCAHSATSKSNLKMH   82 (92)
Q Consensus        60 ~~~~~~c~~c~~~~~~~~~l~~h   82 (92)
                      ....|-|..||..|.....|..|
T Consensus       236 R~eh~YC~fCG~~y~~~edl~eh  258 (268)
T KOG1994|consen  236 RSEHYYCFFCGIKYKDEEDLYEH  258 (268)
T ss_pred             hccceEEEEeccccCCHHHHHHh
Confidence            34579999999999999888777


No 296
>TIGR03826 YvyF flagellar operon protein TIGR03826. This gene is found in flagellar operons of Bacillus-related organisms. Its function has not been determined and an official gene symbol has not been assigned, although the gene is designated yvyF in B. subtilus. A tentative assignment as a regulator is suggested in the NCBI record GI:16080597.
Probab=20.83  E-value=32  Score=18.45  Aligned_cols=11  Identities=27%  Similarity=0.552  Sum_probs=9.0

Q ss_pred             ccccccccccc
Q psy5652           2 VCIFCRQLLPM   12 (92)
Q Consensus         2 ~C~~C~~~f~~   12 (92)
                      .|+.||+.|..
T Consensus         5 nC~~CgklF~~   15 (137)
T TIGR03826         5 NCPKCGRLFVK   15 (137)
T ss_pred             cccccchhhhh
Confidence            48889988887


No 297
>TIGR03655 anti_R_Lar restriction alleviation protein, Lar family. Restriction alleviation proteins provide a countermeasure to host cell restriction enzyme defense against foreign DNA such as phage or plasmids. This family consists of homologs to the phage antirestriction protein Lar, and most members belong to phage genomes or prophage regions of bacterial genomes.
Probab=20.79  E-value=44  Score=14.38  Aligned_cols=12  Identities=25%  Similarity=0.595  Sum_probs=7.2

Q ss_pred             eeCCCCCccCCC
Q psy5652          36 YVCFKCGYHQYN   47 (92)
Q Consensus        36 ~~c~~c~~~~~~   47 (92)
                      +.|..|+-....
T Consensus        27 ~~C~~Cga~~~~   38 (53)
T TIGR03655        27 FECSTCGASGPV   38 (53)
T ss_pred             EECCCCCCCccc
Confidence            467777755443


No 298
>PRK12722 transcriptional activator FlhC; Provisional
Probab=20.70  E-value=64  Score=18.36  Aligned_cols=29  Identities=31%  Similarity=0.612  Sum_probs=17.6

Q ss_pred             ceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcc
Q psy5652          35 LYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAH   71 (92)
Q Consensus        35 ~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   71 (92)
                      ...|..|+..|....        +.....|.|+.|..
T Consensus       134 l~~C~~Cgg~fv~~~--------~e~~~~f~CplC~~  162 (187)
T PRK12722        134 LSSCNCCGGHFVTHA--------HDPVGSFVCGLCQP  162 (187)
T ss_pred             eccCCCCCCCeeccc--------cccCCCCcCCCCCC
Confidence            456777887775322        12234688888764


No 299
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=20.66  E-value=39  Score=13.62  Aligned_cols=7  Identities=29%  Similarity=0.638  Sum_probs=4.7

Q ss_pred             ccccccc
Q psy5652           2 VCIFCRQ    8 (92)
Q Consensus         2 ~C~~C~~    8 (92)
                      .|+.|+.
T Consensus         3 ~CP~Cg~    9 (39)
T PF01396_consen    3 KCPKCGG    9 (39)
T ss_pred             CCCCCCc
Confidence            4777773


No 300
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=20.22  E-value=83  Score=18.77  Aligned_cols=41  Identities=27%  Similarity=0.460  Sum_probs=24.4

Q ss_pred             CCCCCCCCceeCCCCCccCCCHHHHHHHHHHhhCCCCccCCcCcc
Q psy5652          27 MPRPDSSHLYVCFKCGYHQYNSDRMKRHIRTHTGERPFKCEFCAH   71 (92)
Q Consensus        27 ~~~~~~~~~~~c~~c~~~~~~~~~l~~h~~~~~~~~~~~c~~c~~   71 (92)
                      ...|.+-..+.|..|+..+........   ...+ .+=.|+.|+.
T Consensus       114 i~lHGsl~~~~C~~C~~~~~~~~~~~~---~~~~-~~p~C~~Cg~  154 (250)
T COG0846         114 IELHGSLKRVRCSKCGNQYYDEDVIKF---IEDG-LIPRCPKCGG  154 (250)
T ss_pred             EEeccceeeeEeCCCcCccchhhhhhh---cccC-CCCcCccCCC
Confidence            345666677889999887764441111   1111 3457888886


No 301
>COG2995 PqiA Uncharacterized paraquat-inducible protein A [Function unknown]
Probab=20.17  E-value=1.1e+02  Score=19.88  Aligned_cols=16  Identities=19%  Similarity=0.441  Sum_probs=11.0

Q ss_pred             ccccccccccccccccc
Q psy5652           2 VCIFCRQLLPMDADFIL   18 (92)
Q Consensus         2 ~C~~C~~~f~~~~~l~~   18 (92)
                      .|++||..+.-. .|..
T Consensus        20 ~C~eCd~~~~~P-~l~~   35 (418)
T COG2995          20 LCPECDMLVSLP-RLDS   35 (418)
T ss_pred             cCCCCCceeccc-cCCC
Confidence            488888887776 3443


Done!